HHsearch alignment for GI: 254780506 and conserved domain: PRK07063

>PRK07063 short chain dehydrogenase; Provisional.
Probab=91.86  E-value=0.2  Score=30.73  Aligned_cols=31  Identities=16%  Similarity=0.220  Sum_probs=15.9

Q ss_pred             CCCCCHHHHHHHCCEEEEECCCCCCCCCCCCC
Q ss_conf             67653477642235736522443212201047
Q gi|254780506|r  193 SKTKNLPEICRTADILVVAVGRPRMVQVDWIK  224 (306)
Q Consensus       193 s~T~~l~~~~~~ADivIsAvG~p~~i~~~~vk  224 (306)
T Consensus       166 ~lTr~lA~e~a~~gIrVNaI-~PG~i~T~~~~  196 (259)
T PRK07063        166 GLTRALGIEYAARNVRVNAI-APGYIETQLTE  196 (259)
T ss_pred             HHHHHHHHHHHHHCEEEEEE-EECCCCCHHHH
T ss_conf             99999999971419299989-76779877689