HHsearch alignment for GI: 254780506 and conserved domain: PRK07326

>PRK07326 short chain dehydrogenase; Provisional.
Probab=91.38  E-value=0.23  Score=30.40  Aligned_cols=32  Identities=19%  Similarity=0.122  Sum_probs=24.1

Q ss_pred             CCCCCCHHHHHHHCCEEEEECCCCCCCCCCCCC
Q ss_conf             467653477642235736522443212201047
Q gi|254780506|r  192 HSKTKNLPEICRTADILVVAVGRPRMVQVDWIK  224 (306)
Q Consensus       192 hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~vk  224 (306)
T Consensus       160 ~~lt~~la~El~~~gIrVn~v~-PG~v~T~~~~  191 (235)
T PRK07326        160 LGLSEALMLDLRDYDVRVSTIM-PGSVATHFNG  191 (235)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEE-ECCEECCCCC
T ss_conf             9999999998474694999998-0589078889