HHsearch alignment for GI: 254780506 and conserved domain: PRK07478

>PRK07478 short chain dehydrogenase; Provisional.
Probab=92.05  E-value=0.18  Score=31.09  Aligned_cols=42  Identities=17%  Similarity=0.086  Sum_probs=21.6

Q ss_pred             HHHHHHHCCCEEECCCCCCCHHHHHHHCCEEEEECCCCCCCCCCCCC
Q ss_conf             99998620453312467653477642235736522443212201047
Q gi|254780506|r  178 GQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIK  224 (306)
Q Consensus       178 a~lL~~~~atVti~hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~vk  224 (306)
T Consensus       155 ~~Y~asKaav~----~lTr~lA~E~a~~gIrVNaV-~PG~i~T~~~~  196 (254)
T PRK07478        155 AAYAASKAGLI----GLTQVLAAEYGARGIRVNAL-LPGGTDTPMGR  196 (254)
T ss_pred             HHHHHHHHHHH----HHHHHHHHHHCCCCEEEEEE-EECCCCCHHHH
T ss_conf             56798899999----99999999857038599999-77989887576