HHsearch alignment for GI: 254780506 and conserved domain: PRK07774

>PRK07774 short chain dehydrogenase; Provisional.
Probab=93.90  E-value=0.068  Score=34.04  Aligned_cols=54  Identities=9%  Similarity=0.032  Sum_probs=23.1

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCC-CHHHHHHHHHHHCC-CCCCCEEE
Q ss_conf             9996798678999999999999839700002474111-22669999998523-12212588
Q gi|254780506|r   37 VVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDI-SQIDLENAVLSLNK-DDSIHGIL   95 (306)
Q Consensus        37 vIlvGddpaS~~Yv~~K~K~a~~lGI~~~~~~l~~~~-se~el~~~I~~LN~-d~~V~GIl   95 (306)
T Consensus        33 V~i~~~~~~~---~~~~~~~i~~~g~~~~~~~~--Dv~~~~~v~~~~~~~~~~fG~iDilV   88 (250)
T PRK07774         33 VVVADINAEG---AERVAKQIVADGGTAIAVQV--DVSDPDSAKAMADRTVSAFGGIDYLV   88 (250)
T ss_pred             EEEEECCHHH---HHHHHHHHHHCCCEEEEEEC--CCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             9999798899---99999999855984999982--58999999999999999839998999