HHsearch alignment for GI: 254780506 and conserved domain: PRK08277

>PRK08277 D-mannonate oxidoreductase; Provisional.
Probab=94.11  E-value=0.059  Score=34.47  Aligned_cols=31  Identities=19%  Similarity=0.090  Sum_probs=19.0

Q ss_pred             CCCCCCHHHHHHHCCEEEEECCCCCCCCCCCC
Q ss_conf             46765347764223573652244321220104
Q gi|254780506|r  192 HSKTKNLPEICRTADILVVAVGRPRMVQVDWI  223 (306)
Q Consensus       192 hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~v  223 (306)
T Consensus       182 ~~lTk~lA~e~a~~gIrVNaI-aPG~i~T~~~  212 (278)
T PRK08277        182 SNFTQWLAVEFAKVGIRVNAI-APGFFLTEQN  212 (278)
T ss_pred             HHHHHHHHHHHCCCCEEEEEE-EECCCCCHHH
T ss_conf             999999999965359499998-5288877266