HHsearch alignment for GI: 254780506 and conserved domain: PRK08410

>PRK08410 2-hydroxyacid dehydrogenase; Provisional.
Probab=96.82  E-value=0.0041  Score=42.53  Aligned_cols=79  Identities=23%  Similarity=0.425  Sum_probs=64.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCC---------CCHHHHHHHCCEEEEECCC----CCCCCCC---
Q ss_conf             72001289961644203468999986204533124676---------5347764223573652244----3212201---
Q gi|254780506|r  158 DLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKT---------KNLPEICRTADILVVAVGR----PRMVQVD---  221 (306)
Q Consensus       158 ~l~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~T---------~~l~~~~~~ADivIsAvG~----p~~i~~~---  221 (306)
T Consensus       142 ~L~gktlGIvG~G~-IG~~va~~l~~fGm~V~~~d~~~~~~~~~~~~~~l~ell~~sDivslh~Plt~~T~~li~~~~l~  220 (311)
T PRK08410        142 EIKGKKWGIIGLGT-IGKRVAKIAQAFGAEVVYYSTSGKNKNSEYERLSLEELLKTSDIISIHAPLNEKTKNLINYEELK  220 (311)
T ss_pred             CCCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCCCCCCCCCEECCHHHHHHHCCEEEEECCCCCCCCCHHHHHHHH
T ss_conf             10588899984474-89999999997699899989843124578135789999873780145335762223401289996


Q ss_pred             CCCCCCEEEEEEEEEC
Q ss_conf             0476626998311111
Q gi|254780506|r  222 WIKTGSLVIDVGINRI  237 (306)
Q Consensus       222 ~vk~gavvIDvGi~~~  237 (306)
T Consensus       221 ~Mk~~a~lIN~aRG~i  236 (311)
T PRK08410        221 LLKDGAILINVGRGGI  236 (311)
T ss_pred             HCCCCCEEEEECCCCC
T ss_conf             3045755999257422