HHsearch alignment for GI: 254780506 and conserved domain: PRK08594

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=92.61  E-value=0.17  Score=31.27  Aligned_cols=39  Identities=21%  Similarity=0.322  Sum_probs=15.4

Q ss_pred             HHHHHC-CCCEEECCCCCCC-CHHHHHHHHHHHCC-CCCCCEEE
Q ss_conf             999983-9700002474111-22669999998523-12212588
Q gi|254780506|r   55 RMAKHC-GFHSVQYNFPVDI-SQIDLENAVLSLNK-DDSIHGIL   95 (306)
Q Consensus        55 K~a~~l-GI~~~~~~l~~~~-se~el~~~I~~LN~-d~~V~GIl   95 (306)
T Consensus        50 ~~~~~~~~~~~~~~~--~Dvs~~~~v~~~~~~~~~~~g~id~lv   91 (256)
T PRK08594         50 ELAETLEQQESLVLP--CDVTSDEEITACFETIKKEVGVIHGVA   91 (256)
T ss_pred             HHHHHHCCCCEEEEE--CCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             999870799479999--138999999999999999858867466