HHsearch alignment for GI: 254780506 and conserved domain: PRK08605

>PRK08605 D-lactate dehydrogenase; Validated.
Probab=97.10  E-value=0.015  Score=38.51  Aligned_cols=177  Identities=12%  Similarity=0.157  Sum_probs=99.5

Q ss_pred             ECCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCC---
Q ss_conf             67986789999999999998397000024741112266999999852312212588834688711378898606874---
Q gi|254780506|r   40 VGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPE---  116 (306)
Q Consensus        40 vGddpaS~~Yv~~K~K~a~~lGI~~~~~~l~~~~se~el~~~I~~LN~d~~V~GIlvQlPLP~~id~~~i~~~I~p~---  116 (306)
T Consensus         7 ~~~~~~e~~~~~---~~~~~~~~ev~~~--~~~-~~ee~i~~~~------~~D~i~v~~~~--~i~~~-vl~~~~~l~iK   71 (332)
T PRK08605          7 MSVRDEDAPYIK---AWAEKHHVEVDLT--KEA-LTDDNVEEVE------GFDGLSLSQQI--PLSEA-IYKLLNELGIK   71 (332)
T ss_pred             EECCHHHHHHHH---HHHHHCCCEEEEE--CCC-CCHHHHHHHC------CCCEEEEECCC--CCCHH-HHHHHHHCCCE
T ss_conf             827665699999---9888659079996--699-9989999857------99889997079--77999-99966636977


Q ss_pred             -----------CCHHHCCHHHHHHHHHCCCCCCCCCCCHHHHHHHH----HH------------------HCCCCCCCCE
Q ss_conf             -----------35132155338887304778875676679999999----98------------------6787720012
Q gi|254780506|r  117 -----------KDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLI----EQ------------------FKGCDLSGQH  163 (306)
Q Consensus       117 -----------KDVDGl~~~N~g~l~~~~~~~~~~PcTp~av~~ll----~~------------------y~~i~l~Gk~  163 (306)
T Consensus        72 ~I~r~gvG~DnIDl~~a~~~gI--~V~-n~P~~~~~aVAE~ai~liL~l~R~i~~~~~~~~~~~~~w~~~~~g~~l~~kt  148 (332)
T PRK08605         72 QIAQRSAGFDTYDLELANKYNI--IIS-NVPSYSPESIAEFTVTQAINLVRHFNLIQTKVREHDFRWEPPILSRSIKDLK  148 (332)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC--EEE-ECCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCEECCCCE
T ss_conf             9997772174546999997999--899-5998684899999999999998565999999982587647765754503778


Q ss_pred             EEEECCCCCCHHHHHHHHH-HHCCCEEECCCCC-----------CCHHHHHHHCCEEEEECCC----CCCCCCCC---CC
Q ss_conf             8996164420346899998-6204533124676-----------5347764223573652244----32122010---47
Q gi|254780506|r  164 AVVIGRSNLFGKPMGQLLL-SRNATVTMAHSKT-----------KNLPEICRTADILVVAVGR----PRMVQVDW---IK  224 (306)
Q Consensus       164 vvVvGrs~~VG~Pla~lL~-~~~atVti~hs~T-----------~~l~~~~~~ADivIsAvG~----p~~i~~~~---vk  224 (306)
T Consensus       149 vGIiG~G~-IG~~vak~~a~~fgm~vi~yd~~~~~~~~~~~~~~~~l~ell~~sDiIslh~Plt~~T~~lI~~~~l~~MK  227 (332)
T PRK08605        149 VAVIGTGR-IGLAVAKIFAKGYGCDVVAYDPFPNAKAATYVDYKDTIEEAVEGADIVTLHMPATKYNTYLFNADLFKHFK  227 (332)
T ss_pred             EEEEEEEH-HHHHHHHHHHHHCCCEEEEECCCCCHHHHHCCEECCCHHHHHHHCCEEEEECCCCHHHHHHCCHHHHHHCC
T ss_conf             99997436-88999999987569826787788765566207021689999864999999336883550121899997224


Q ss_pred             CCCEEEEEEEE
Q ss_conf             66269983111
Q gi|254780506|r  225 TGSLVIDVGIN  235 (306)
Q Consensus       225 ~gavvIDvGi~  235 (306)
T Consensus       228 ~~a~lINtaRG  238 (332)
T PRK08605        228 KGAVFVNCARG  238 (332)
T ss_pred             CCCEEEEECCC
T ss_conf             79689990686