HHsearch alignment for GI: 254780506 and conserved domain: PRK08703

>PRK08703 short chain dehydrogenase; Provisional.
Probab=93.65  E-value=0.079  Score=33.55  Aligned_cols=69  Identities=14%  Similarity=0.089  Sum_probs=31.2

Q ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCC-CCCHHHH-HHHHHHHCCCEEECCCCCCCHHHHHHHC-CEEEEECCCCCCCCCC
Q ss_conf             99999999867877200128996164-4203468-9999862045331246765347764223-5736522443212201
Q gi|254780506|r  145 AGAILLIEQFKGCDLSGQHAVVIGRS-NLFGKPM-GQLLLSRNATVTMAHSKTKNLPEICRTA-DILVVAVGRPRMVQVD  221 (306)
Q Consensus       145 ~av~~ll~~y~~i~l~Gk~vvVvGrs-~~VG~Pl-a~lL~~~~atVti~hs~T~~l~~~~~~A-DivIsAvG~p~~i~~~  221 (306)
T Consensus       128 ~~~~p~m~~~-~----~g~Ii~isS~~~~~~~~~~~~Y~asKaal----~~ltk~lA~E~~~~g~IrVN~i~-PG~i~T~  197 (239)
T PRK08703        128 RALFPLLKQS-P----DASVIFVGESHGETPKAYWGGFGASKAAL----NYLCKVAADEWERFGNLRANVLV-PGPINSP  197 (239)
T ss_pred             HHHHHHHHHC-C----CEEEEEEECHHHCCCCCCCHHHHHHHHHH----HHHHHHHHHHHCCCCCEEEEEEE-ECCCCCC
T ss_conf             9999999877-9----90899981445477898866899999999----99999999984789898999998-4889796


Q ss_pred             CC
Q ss_conf             04
Q gi|254780506|r  222 WI  223 (306)
Q Consensus       222 ~v  223 (306)
T Consensus       198 ~~  199 (239)
T PRK08703        198 QR  199 (239)
T ss_pred             CH
T ss_conf             81