HHsearch alignment for GI: 254780506 and conserved domain: PRK10637

>PRK10637 cysG siroheme synthase; Provisional.
Probab=90.84  E-value=0.64  Score=27.25  Aligned_cols=34  Identities=12%  Similarity=0.065  Sum_probs=18.3

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCC
Q ss_conf             9996798678999999999999839700002474111
Q gi|254780506|r   37 VVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDI   73 (306)
Q Consensus        37 vIlvGddpaS~~Yv~~K~K~a~~lGI~~~~~~l~~~~   73 (306)
T Consensus        76 ViaATdd~~vn---~~i~~~a~~~~ilVNvvD~p~lc  109 (457)
T PRK10637         76 AIAATDDDAVN---QRVSEAAEARRIFCNVVDAPKAA  109 (457)
T ss_pred             EEEECCCHHHH---HHHHHHHHHCCCEEEECCCCCCC
T ss_conf             99906999999---99999999829868845882448