HHsearch alignment for GI: 254780506 and conserved domain: PRK11199

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional.
Probab=95.62  E-value=0.043  Score=35.44  Aligned_cols=73  Identities=14%  Similarity=0.245  Sum_probs=60.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCC-CCHHHHHHHCCEEEEECCCCCC------CCCCCCCCCCEEEEE
Q ss_conf             001289961644203468999986204533124676-5347764223573652244321------220104766269983
Q gi|254780506|r  160 SGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKT-KNLPEICRTADILVVAVGRPRM------VQVDWIKTGSLVIDV  232 (306)
Q Consensus       160 ~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~T-~~l~~~~~~ADivIsAvG~p~~------i~~~~vk~gavvIDv  232 (306)
T Consensus        97 ~~~~i~IIGG~G~mG~~F~~~f~~sGy~V~ild~~dw~~~~~~~~~advViVsVPI~~T~~VI~~l--~~l~~~~lL~Di  174 (374)
T PRK11199         97 DLRPVVIVGGKGQLGRLFAKMLTLSGYQVRILEKDDWDRADDILADAGMVIVSVPIHLTEEVIEKL--PPLPEDCILVDL  174 (374)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHCCCEEEEEECHHHHHHHHHHC--CCCCCCCEEEEC
T ss_conf             987179980798277999999996798799616444534898871799899981458899999857--789998689861


Q ss_pred             EE
Q ss_conf             11
Q gi|254780506|r  233 GI  234 (306)
Q Consensus       233 Gi  234 (306)
T Consensus       175 TS  176 (374)
T PRK11199        175 TS  176 (374)
T ss_pred             HH
T ss_conf             00