HHsearch alignment for GI: 254780506 and conserved domain: PRK11790

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional.
Probab=96.19  E-value=0.017  Score=38.21  Aligned_cols=168  Identities=14%  Similarity=0.222  Sum_probs=98.3

Q ss_pred             HHHCCCC-EEECCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCHH----HCCHHHHHHHH
Q ss_conf             9983970-000247411122669999998523122125888346887113788986068743513----21553388873
Q gi|254780506|r   57 AKHCGFH-SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD----GLHVVNAGKVM  131 (306)
Q Consensus        57 a~~lGI~-~~~~~l~~~~se~el~~~I~~LN~d~~V~GIlvQlPLP~~id~~~i~~~I~p~KDVD----Gl~~~N~g~l~  131 (306)
T Consensus        27 L~~~G~~~v~~--~~~~l~~eeL~~~i~------~~d~liiRS~t--~vt~~-vi~~a~~Lk~I~r~GvG~dnIDl~aa~   95 (409)
T PRK11790         27 LRAAGYTNIEY--HKGALDEEELKEAIK------DAHFIGIRSRT--QLTEE-VLEAAEKLVAIGCFCIGTNQVDLDAAA   95 (409)
T ss_pred             HHHCCCEEEEE--CCCCCCHHHHHHHHC------CCCEEEECCCC--CCCHH-HHHCCCCCEEEEECCCCCCCCCHHHHH
T ss_conf             99779977882--689999999999856------79899991798--73999-994399971999832157740899998


Q ss_pred             HCCCCCCCCC-----CCHHHHHHHH----H-----------------HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             0477887567-----6679999999----9-----------------867877200128996164420346899998620
Q gi|254780506|r  132 IGDFTTGLVP-----CTPAGAILLI----E-----------------QFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRN  185 (306)
Q Consensus       132 ~~~~~~~~~P-----cTp~av~~ll----~-----------------~y~~i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~  185 (306)
T Consensus        96 ~~GI~V~NtPg~Na~aVAEl~i~l~L~l~R~i~~~~~~~~~G~W~k~~~~~~El~GKtlGIIG~G~-IG~~VA~~a~~fG  174 (409)
T PRK11790         96 KRGIPVFNAPFSNTRSVAELVLGEIILLLRGIPEKNAKAHRGGWNKSAAGSFEVRGKTLGIVGYGH-IGTQLSVLAESLG  174 (409)
T ss_pred             HCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCEEEEECCCH-HHHHHHHHHHHCC
T ss_conf             699489969997728899999999999986479999999829987567775563587898636754-7699999998769


Q ss_pred             CCEEECCC----------CCCCHHHHHHHCCEEEEECCC----CCCCCCC---CCCCCCEEEEEEEEE
Q ss_conf             45331246----------765347764223573652244----3212201---047662699831111
Q gi|254780506|r  186 ATVTMAHS----------KTKNLPEICRTADILVVAVGR----PRMVQVD---WIKTGSLVIDVGINR  236 (306)
Q Consensus       186 atVti~hs----------~T~~l~~~~~~ADivIsAvG~----p~~i~~~---~vk~gavvIDvGi~~  236 (306)
T Consensus       175 m~Vi~yD~~~~~~~~~~~~~~sl~ell~~sD~IslH~Plt~~T~~lIn~~~l~~MK~ga~LIN~ARG~  242 (409)
T PRK11790        175 MRVIFYDIEDKLPLGNATQVGSLEELLAQSDVVSLHVPETPSTKNMIGAEELALMKPGAILINASRGT  242 (409)
T ss_pred             CEEEEECCHHHCCCCCCEECCCHHHHHHHCCEEEECCCCCHHHHCCCCHHHHHHCCCCCEEEECCCCH
T ss_conf             98999786021256684674889999875999998267984663104399997269998999868851