HHsearch alignment for GI: 254780506 and conserved domain: PTZ00079

>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional.
Probab=93.78  E-value=0.57  Score=27.63  Aligned_cols=83  Identities=22%  Similarity=0.182  Sum_probs=59.6

Q ss_pred             HHHHHHCCCCCCHH----HCCHHHHHHHHHC------C-------------CCCCCCCCCHHHHHHH----HHHHCCCCC
Q ss_conf             88986068743513----2155338887304------7-------------7887567667999999----998678772
Q gi|254780506|r  107 QSIIQSIVPEKDVD----GLHVVNAGKVMIG------D-------------FTTGLVPCTPAGAILL----IEQFKGCDL  159 (306)
Q Consensus       107 ~~i~~~I~p~KDVD----Gl~~~N~g~l~~~------~-------------~~~~~~PcTp~av~~l----l~~y~~i~l  159 (306)
T Consensus       172 ~eL~~~IGp~~DVPApDiGtg~remgwm~d~Y~~i~~~~~gvvTGKp~~~GGs~gR~eATG~G~vy~~~e~l~~-~~~~l  250 (469)
T PTZ00079        172 TELYRHIGPCTDVPAGDIGVGGREIGYLYGQYKRLRNEFNGVLTGKNVKWGGSNIRPEATGYGAVYFVEEVLKS-LNIVV  250 (469)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCC
T ss_conf             99998539986567876776899999999999850586751771887100686786762428899999999986-79985


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCEEEC
Q ss_conf             00128996164420346899998620453312
Q gi|254780506|r  160 SGQHAVVIGRSNLFGKPMGQLLLSRNATVTMA  191 (306)
Q Consensus       160 ~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~  191 (306)
T Consensus       251 ~gk~vaIqGfGN-Vg~~aA~kl~e~GakVVav  281 (469)
T PTZ00079        251 EKKTAVVSGSGN-VAQYCVEKLLQLGAKVLTL  281 (469)
T ss_pred             CCCEEEEECCCH-HHHHHHHHHHHCCCEEEEE
T ss_conf             788899976673-8999999999769989999