HHsearch alignment for GI: 254780506 and conserved domain: TIGR01692

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators . 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterised 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate . HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase. ; GO: 0008442 3-hydroxyisobutyrate dehydrogenase activity, 0051287 NAD binding.
Probab=90.11  E-value=0.32  Score=29.32  Aligned_cols=90  Identities=29%  Similarity=0.397  Sum_probs=58.5

Q ss_pred             ECCCCCCHHHHHHHHHHHCCCEEECCCCC--------------CCHHHHHHHCCEEEEECCCC----CCCCCC-----CC
Q ss_conf             61644203468999986204533124676--------------53477642235736522443----212201-----04
Q gi|254780506|r  167 IGRSNLFGKPMGQLLLSRNATVTMAHSKT--------------KNLPEICRTADILVVAVGRP----RMVQVD-----WI  223 (306)
Q Consensus       167 vGrs~~VG~Pla~lL~~~~atVti~hs~T--------------~~l~~~~~~ADivIsAvG~p----~~i~~~-----~v  223 (306)
T Consensus         2 IGLGN-MGgPMA~NL~KAGH~v~~FDL~p~av~~~v~aG~~~A~S~~~a~~~Ad~vITMLPAg~HV~sVY~gd~gIL~~~   80 (290)
T TIGR01692         2 IGLGN-MGGPMAANLLKAGHAVRVFDLSPKAVEELVEAGAQAAASAAEAAEGADVVITMLPAGKHVISVYSGDDGILAKV   80 (290)
T ss_pred             CCCCC-CCHHHHHHHHHHCCEEEEEECCHHHHHHHHHCCHHCCCCHHHHHCCCCEEEECCCCCHHHHHHHHCCHHHHCCC
T ss_conf             78888-82279999861187257751788999999960022054579884558868634886034899983313341136


Q ss_pred             CCCCEEEEEEEEECCCCCCCCCEEECCCC--HHHHHH------CCEECCCCCCCCH
Q ss_conf             76626998311111267668856841775--678731------4400898698686
Q gi|254780506|r  224 KTGSLVIDVGINRINSPQLGKTVLVGDVA--DECKSV------VGAITPVPGGVGP  271 (306)
Q Consensus       224 k~gavvIDvGi~~~~~~~~~~~~~~GDvd--~~~~~~------a~~iTPVPGGVGp  271 (306)
T Consensus        81 ~K~~LlIDcSTI--------------DpdsAr~~A~~Aa~~G~~f~DAPVSGG~Gg  122 (290)
T TIGR01692        81 AKGSLLIDCSTI--------------DPDSARKVAELAAAHGLVFVDAPVSGGVGG  122 (290)
T ss_pred             CCCCCEEECCCC--------------CHHHHHHHHHHHHHCCCCEECCCCCCCHHH
T ss_conf             788963324567--------------867899999999981872103677753565