HHsearch alignment for GI: 254780506 and conserved domain: TIGR02853

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=98.54  E-value=1.3e-06  Score=66.79  Aligned_cols=128  Identities=21%  Similarity=0.410  Sum_probs=102.2

Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCC----------------CCHHHHHH
Q ss_conf             67667999999998678772001289961644203468999986204533124676----------------53477642
Q gi|254780506|r  140 VPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKT----------------KNLPEICR  203 (306)
Q Consensus       140 ~PcTp~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~T----------------~~l~~~~~  203 (306)
T Consensus       132 IPtaEGAimMA~e~t-d~TIHgS~v~VlGfGR-tG~tiAr~f~aLGA~V~V~AR~~~dlARI~E~g~~P~~~~~L~~~v~  209 (288)
T TIGR02853       132 IPTAEGAIMMAIEHT-DFTIHGSNVMVLGFGR-TGMTIARTFSALGARVSVGARSSADLARITEMGLEPVPLNKLEEKVA  209 (288)
T ss_pred             CCCHHHHHHHHHHCC-CCCEECCEEEEECCCC-HHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCCHHHHHHHHC
T ss_conf             755678999997248-9625013457884470-56899999972698057531783678999996068827167887650


Q ss_pred             HCCEEEEECCCCCC-CCCCC---CCCCCEEEEEEEEECCCCCCCCCEEECCCCHHHHH---HCCEECC-CCCCCCHHHHH
Q ss_conf             23573652244321-22010---47662699831111126766885684177567873---1440089-86986868999
Q gi|254780506|r  204 TADILVVAVGRPRM-VQVDW---IKTGSLVIDVGINRINSPQLGKTVLVGDVADECKS---VVGAITP-VPGGVGPMTIA  275 (306)
Q Consensus       204 ~ADivIsAvG~p~~-i~~~~---vk~gavvIDvGi~~~~~~~~~~~~~~GDvd~~~~~---~a~~iTP-VPGGVGp~Tva  275 (306)
T Consensus       210 e~DIviNTi--PaLvlt~~~l~~lp~~AviiDLAS~P------------GGtDF~yAk~~Gi~A~LAPGLPGiVAPkTAG  275 (288)
T TIGR02853       210 EIDIVINTI--PALVLTKDVLSKLPKHAVIIDLASKP------------GGTDFEYAKKRGIKALLAPGLPGIVAPKTAG  275 (288)
T ss_pred             CCCEEEECC--CCCCCCHHHHHHCCCCCEEEEECCCC------------CCCCHHHHHHCCCEEEECCCCCCCCCCHHHH
T ss_conf             002477067--63003658995268584899732784------------8737698986298289718787830723567


Q ss_pred             HHHHHHHH
Q ss_conf             99999999
Q gi|254780506|r  276 MLMANTVI  283 (306)
Q Consensus       276 ~L~~N~v~  283 (306)
T Consensus       276 kIlA~VL~  283 (288)
T TIGR02853       276 KILANVLS  283 (288)
T ss_pred             HHHHHHHH
T ss_conf             89999999