HHsearch alignment for GI: 254780506 and conserved domain: pfam03446

>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Probab=96.43  E-value=0.0082  Score=40.40  Aligned_cols=76  Identities=25%  Similarity=0.310  Sum_probs=60.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCEEECCCC--------------CCCHHHHHHHCCEEEEECCCCCCCCC-------
Q ss_conf             128996164420346899998620453312467--------------65347764223573652244321220-------
Q gi|254780506|r  162 QHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSK--------------TKNLPEICRTADILVVAVGRPRMVQV-------  220 (306)
Q Consensus       162 k~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~--------------T~~l~~~~~~ADivIsAvG~p~~i~~-------  220 (306)
T Consensus         2 ~~Ig~IGlG~-MG~~ma~~L~~~g~~v~v~d~~~~~~~~~~~~g~~~~~s~~e~~~~~dvIi~~l~~~~~v~~V~~~~~g   80 (163)
T pfam03446         2 AKIGFIGLGV-MGSPMALNLLKAGYTVTVYNRTPEKVEELVAEGAVAAASPAEAAASADVVITMVPAGAAVDAVIFGEDG   80 (163)
T ss_pred             CEEEEEEEHH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEECCCHHHHHHCCCEEEEECCCHHHHHEEECCCCC
T ss_conf             8899983679-899999999977996999979788779999839955399999986199999925871454022026313


Q ss_pred             --CCCCCCCEEEEEEEEECC
Q ss_conf             --104766269983111112
Q gi|254780506|r  221 --DWIKTGSLVIDVGINRIN  238 (306)
Q Consensus       221 --~~vk~gavvIDvGi~~~~  238 (306)
T Consensus        81 l~~~~~~g~iiid~sT~~p~  100 (163)
T pfam03446        81 LLPGLKPGDIIIDGSTISPD  100 (163)
T ss_pred             HHHHCCCCCEEEECCCCCHH
T ss_conf             32313589889867989999