HHsearch alignment for GI: 254780506 and conserved domain: pfam03721

>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=94.99  E-value=0.046  Score=35.18  Aligned_cols=30  Identities=23%  Similarity=0.217  Sum_probs=26.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCEEECC
Q ss_conf             1289961644203468999986204533124
Q gi|254780506|r  162 QHAVVIGRSNLFGKPMGQLLLSRNATVTMAH  192 (306)
Q Consensus       162 k~vvVvGrs~~VG~Pla~lL~~~~atVti~h  192 (306)
T Consensus         1 MkI~ViGlGy-VGl~~a~~la~~G~~V~g~D   30 (185)
T pfam03721         1 MRIAVIGLGY-VGLPTAVCLAEIGHDVVGVD   30 (185)
T ss_pred             CEEEEECCCH-HHHHHHHHHHHCCCEEEEEE
T ss_conf             9799989787-48999999994899399997