BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780506|ref|YP_003064919.1| methylenetetrahydrofolate
dehydrogenase/cyclohydrolase protein [Candidatus Liberibacter
asiaticus str. psy62]
         (306 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780506|ref|YP_003064919.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040183|gb|ACT56979.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 306

 Score =  618 bits (1593), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC
Sbjct: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD
Sbjct: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL
Sbjct: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP
Sbjct: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS 300
           QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS
Sbjct: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS 300

Query: 301 IAKKTI 306
           IAKKTI
Sbjct: 301 IAKKTI 306


>gi|315122297|ref|YP_004062786.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495699|gb|ADR52298.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 306

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 238/306 (77%), Positives = 275/306 (89%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MGSLIDGK +AS LT KIAESV  L+++TG+QVGLAV+LVGNDPAS SYVSAK  MAK C
Sbjct: 1   MGSLIDGKSIASALTKKIAESVTLLRQKTGIQVGLAVILVGNDPASSSYVSAKKSMAKSC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQYNF +DISQ +L+  +L LN+DD+IHGIL+QLPLPST+S++ +IQSI PEKDVD
Sbjct: 61  GFHSVQYNFSIDISQDELKKTILELNQDDAIHGILLQLPLPSTLSDRFLIQSIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH+VNAGK+MIGDFTTGL+ CTPAGAILLIE+FKG DLSGQHAVVIGRSNLFGKPMGQL
Sbjct: 121 GLHIVNAGKLMIGDFTTGLISCTPAGAILLIEKFKGSDLSGQHAVVIGRSNLFGKPMGQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+RNATVTMAHSKTKNLPEICR ADILVVAVG+P MV+ DWIKTGSL+IDVGINRIN  
Sbjct: 181 LLARNATVTMAHSKTKNLPEICRMADILVVAVGQPYMVKADWIKTGSLIIDVGINRINCS 240

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS 300
           ++GK++LVGDVA EC+S+ GAITPVPGGVGPMTIAMLMANTVIAAYR  G++ P+FDA  
Sbjct: 241 KVGKSILVGDVAVECQSIAGAITPVPGGVGPMTIAMLMANTVIAAYRFAGLEIPQFDAHL 300

Query: 301 IAKKTI 306
           + KK++
Sbjct: 301 LEKKSV 306


>gi|222084900|ref|YP_002543429.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Agrobacterium radiobacter K84]
 gi|221722348|gb|ACM25504.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Agrobacterium radiobacter K84]
          Length = 299

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 235/299 (78%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ + + +  + + L+++TG + GLAVV+VG+DPAS SYV++K+RMAK C
Sbjct: 1   MTTVIDGKQVAASVIEAVKTATSALERDTGTKAGLAVVIVGDDPASHSYVTSKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+Q+  P + +Q +L   V SLN+D SIHGILVQLPLP  ++ + IIQSI PEKDVD
Sbjct: 61  GFKSIQHTLPAETTQEELAKLVQSLNEDPSIHGILVQLPLPKHLNSEPIIQSIRPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGK+  GD  TGL+ CTPAGA+LL+ +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLHVVNAGKLATGDLATGLISCTPAGAMLLVRRIHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT AHS+TK+LP I RTADILV AVG+P+MV+ DWIK G+ VIDVG+NRI +P
Sbjct: 181 LLNANATVTTAHSRTKDLPTIARTADILVAAVGQPQMVKADWIKPGATVIDVGVNRIAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAAYR+ G  +PKF
Sbjct: 241 ERGEGKTRLVGDVAFTEASDVAAVITPVPGGVGPMTIAMLMANTVIAAYRAAGKSAPKF 299


>gi|150395517|ref|YP_001325984.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Sinorhizobium medicae WSM419]
 gi|190359408|sp|A6U669|FOLD1_SINMW RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|150027032|gb|ABR59149.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium medicae
           WSM419]
          Length = 299

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 232/299 (77%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ + + +  + + L++ETGV+ GLAVV+VG+DPAS +YVSAK+RMAK C
Sbjct: 1   MTTVIDGKDVAASVIETVKTATSTLERETGVRAGLAVVIVGDDPASHTYVSAKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + SQ +L   V  LN D +IHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFLSVQHTLPEETSQEELAALVAQLNADAAIHGILVQLPLPKHLRSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGK+  GD   GLV CTPAGA++ + +  G DLSG  AVVIGRSNLFGKPMG L
Sbjct: 121 GLHVVNAGKLATGDLEGGLVSCTPAGAMVFVRRTYGDDLSGLSAVVIGRSNLFGKPMGAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT AHS+TKNLPE+CR ADILV AVGRP MV+ DW+K G++VIDVGINR+ +P
Sbjct: 181 LLAANATVTTAHSRTKNLPEVCRNADILVAAVGRPEMVKADWVKPGAMVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA  EC  +   ITPVPGGVGPMTIAMLMANT+IAA+R  G + PKF
Sbjct: 241 ERGEGKTKLVGDVAFKECAELASVITPVPGGVGPMTIAMLMANTIIAAHRKAGRRPPKF 299


>gi|227820889|ref|YP_002824859.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Sinorhizobium fredii NGR234]
 gi|227339888|gb|ACP24106.1| bifunctional protein FolD2; includes:
           Methylenetetrahydrofolatedehydrogenase ;
           Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium
           fredii NGR234]
          Length = 299

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 228/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ + + +  +   L+ ETGV+ GLAVV+VG+DPAS +YVSAK+RMAK C
Sbjct: 1   MTTVIDGKAVAASVIETVKSATQTLETETGVRAGLAVVIVGDDPASHAYVSAKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + SQ +L   V  LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFLSVQHTLPGETSQEELAALVAELNADPSIHGILVQLPLPKHLQSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGKV  GD   GLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM  L
Sbjct: 121 GLHVVNAGKVATGDLDGGLVSCTPAGAMVFVRRTHGGDLSGLNAVVIGRSNLFGKPMSAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT AHS+TK+L  +CR ADILV AVGRP MV+ DW+K G+LVIDVGINR+ +P
Sbjct: 181 LLAANATVTTAHSRTKDLAAVCRNADILVAAVGRPEMVKADWVKPGALVIDVGINRVAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   G+T LVGDVA +EC  V   ITPVPGGVGPMTIAMLMANT+IAAYR  G   PKF
Sbjct: 241 ERGEGRTKLVGDVAFEECAKVASVITPVPGGVGPMTIAMLMANTIIAAYRKAGQNPPKF 299


>gi|222081892|ref|YP_002541257.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Agrobacterium radiobacter K84]
 gi|221726571|gb|ACM29660.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Agrobacterium radiobacter K84]
          Length = 304

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/297 (62%), Positives = 233/297 (78%), Gaps = 3/297 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK VA+ + + +  + + L+++TG + GLAVV+VG+DPAS SYV++K+ MAK CGF
Sbjct: 8   TVIDGKQVAASVIEAVKTATSALERDTGTKAGLAVVIVGDDPASHSYVTSKSWMAKECGF 67

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+Q+  P + +Q +L   V SLN+D SIHGILVQLPLP  ++ + IIQSI PEKDVDGL
Sbjct: 68  KSIQHTLPAETTQEELAKLVQSLNEDPSIHGILVQLPLPKHLNSEPIIQSIRPEKDVDGL 127

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HVVNAGK+  GD  TGL+ CTPAGA+LL+ +  G DLSG +AVVIGRSNLFGKPM QLLL
Sbjct: 128 HVVNAGKLATGDLATGLISCTPAGAMLLVRRIHGEDLSGLNAVVIGRSNLFGKPMAQLLL 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT AHS+TK+LP + RTADILV AVG+P+MV+ DW+K G+ VIDVG+NRI +P+ 
Sbjct: 188 NANATVTTAHSRTKDLPTVARTADILVAAVGQPQMVKADWVKPGATVIDVGVNRIAAPER 247

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
             GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAAYR+ G  +PKF
Sbjct: 248 GEGKTRLVGDVAFTEASDVAAVITPVPGGVGPMTIAMLMANTVIAAYRAAGKSAPKF 304


>gi|163758052|ref|ZP_02165140.1| probable bifunctional protein : methylenetetrahydrofolate
           dehydrogenase ; methenyltetrahydrofolate cyclohydrolase
           [Hoeflea phototrophica DFL-43]
 gi|162284341|gb|EDQ34624.1| probable bifunctional protein : methylenetetrahydrofolate
           dehydrogenase ; methenyltetrahydrofolate cyclohydrolase
           [Hoeflea phototrophica DFL-43]
          Length = 299

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 230/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ + +++  + A L+ +TGV+ GLAVV+VGNDPAS  YVS+K+RMAK C
Sbjct: 1   MATVIDGKAVAAGVVEQVTAASAALEAQTGVRPGLAVVIVGNDPASHVYVSSKSRMAKQC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P   SQ +LE  V +LN+D  IHGILVQLPLP  ++   +IQSI PEKDVD
Sbjct: 61  GFKSVQHTLPETTSQAELEALVETLNQDPEIHGILVQLPLPDGLNSDPVIQSIRPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGK+M GD   GL+ CTPAGA+L + Q  G DLSG +AVVIGRSNLFGKPM  L
Sbjct: 121 GLHVVNAGKLMTGDLEGGLISCTPAGAMLFVRQTHGPDLSGLNAVVIGRSNLFGKPMSAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT AHS+TK+L  +CR ADILV AVGRP+MV+  W+K G+ VIDVGINRI++P
Sbjct: 181 LLAANATVTTAHSRTKDLASVCRNADILVAAVGRPQMVKAGWVKPGATVIDVGINRIDAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA DEC  V   ITPVPGGVGPMTIAMLMANTV AA R+ G+K P F
Sbjct: 241 ERGEGKTRLVGDVAFDECAEVASTITPVPGGVGPMTIAMLMANTVTAAMRAHGIKPPSF 299


>gi|222082166|ref|YP_002541531.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Agrobacterium radiobacter K84]
 gi|221726845|gb|ACM29934.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Agrobacterium radiobacter K84]
          Length = 304

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 232/297 (78%), Gaps = 3/297 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK VA+ + + +  + + L+ + GV+ GLAVV+VG+DPAS SYV++K+ MAK CGF
Sbjct: 8   TVIDGKQVAASVIEAVKTATSALETDAGVKAGLAVVIVGDDPASHSYVTSKSWMAKECGF 67

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+Q+  P + +Q +L   V SLN+D SIHGILVQLPLP  ++ + IIQSI PEKDVDGL
Sbjct: 68  KSIQHTLPAETTQEELAKLVQSLNEDPSIHGILVQLPLPKHLNSEPIIQSIRPEKDVDGL 127

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HVVNAGK+  GD  TGL+ CTPAGA+LL+ +  G DLSG +AVVIGRSNLFGKPM QLLL
Sbjct: 128 HVVNAGKLATGDLATGLISCTPAGAMLLVRRIHGEDLSGLNAVVIGRSNLFGKPMAQLLL 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT AHS+TK+LP + RTADILV AVG+P+MV+ DWIK G+ VIDVG+NRI +P+ 
Sbjct: 188 NANATVTTAHSRTKDLPTVARTADILVAAVGQPQMVKADWIKPGATVIDVGVNRIAAPER 247

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
             GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAAYR+ G  +PKF
Sbjct: 248 GEGKTRLVGDVAFTEASDVAAVITPVPGGVGPMTIAMLMANTVIAAYRAAGKSAPKF 304


>gi|15964446|ref|NP_384799.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           [Sinorhizobium meliloti 1021]
 gi|307311588|ref|ZP_07591229.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           BL225C]
 gi|81635081|sp|Q92RY3|FOLD2_RHIME RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|15073623|emb|CAC45265.1| Probable bifunctional protein : methylenetetrahydrofolate
           dehydrogenase ; methenyltetrahydrofolate cyclohydrolase
           [Sinorhizobium meliloti 1021]
 gi|306899605|gb|EFN30234.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           BL225C]
          Length = 299

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 230/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ + + +  + + L+ ETGV+ GLAVV+VG+DPAS +YVSAK+RMAK C
Sbjct: 1   MTTVIDGKNVAASVIETVKSATSALESETGVRAGLAVVIVGDDPASHTYVSAKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + SQ +L   V  LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFLSVQHTLPEETSQEELAALVAELNADPSIHGILVQLPLPKHLRSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGK+  GD   GLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM  L
Sbjct: 121 GLHVVNAGKLATGDLEGGLVSCTPAGAMVFVRRTYGDDLSGLNAVVIGRSNLFGKPMSAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT AHS+TK+L  +CR ADILV AVGRP MV+ DW+K G++V+DVGINR+ +P
Sbjct: 181 LLAANATVTTAHSRTKDLAAVCRNADILVAAVGRPEMVKADWVKPGAMVVDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   G+T LVGDVA DEC  V G ITPVPGGVGPMTIAMLMANT+IAA R  G K PKF
Sbjct: 241 ERGEGRTKLVGDVAFDECAKVAGVITPVPGGVGPMTIAMLMANTIIAACRMAGRKPPKF 299


>gi|241203139|ref|YP_002974235.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857029|gb|ACS54696.1| Methenyltetrahydrofolate cyclohydrolase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 299

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 229/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAVV+VG+DPAS +YV +K RMAK C
Sbjct: 1   MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P +  Q DL   V SLN D SIHGILVQLPLP  +  ++IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETKQEDLAALVASLNADPSIHGILVQLPLPKPLDSEAIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADWVKPGATVIDVGINRVAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA +E  +V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 ERGEGKTRLVGDVAFEEVSAVASTITPVPGGVGPMTIAMLMANTVIAAHRTAGQTPPQF 299


>gi|307318943|ref|ZP_07598374.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           AK83]
 gi|306895357|gb|EFN26112.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           AK83]
          Length = 299

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 229/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ + + +  +   L+ ETGV+ GLAVV+VG+DPAS +YVSAK+RMAK C
Sbjct: 1   MTTVIDGKDVAASVIETVKSATGALESETGVRAGLAVVIVGDDPASHTYVSAKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + SQ +L   V  LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFLSVQHTLPEETSQEELAALVAELNADPSIHGILVQLPLPKHLRSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHVVNAGK+  GD   GLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM  L
Sbjct: 121 GLHVVNAGKLATGDLEGGLVSCTPAGAMVFVRRTYGDDLSGLNAVVIGRSNLFGKPMSAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT AHS+TK+L  +CR ADILV AVGRP MV+ DW+K G++V+DVGINR+ +P
Sbjct: 181 LLAANATVTTAHSRTKDLAAVCRNADILVAAVGRPEMVKADWVKPGAMVVDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   G+T LVGDVA DEC  V G ITPVPGGVGPMTIAMLMANT+IAA R  G K PKF
Sbjct: 241 ERGEGRTKLVGDVAFDECAKVAGVITPVPGGVGPMTIAMLMANTIIAACRMAGRKPPKF 299


>gi|209547961|ref|YP_002279878.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533717|gb|ACI53652.1| Methenyltetrahydrofolate cyclohydrolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 299

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 229/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAVV+VG+DPAS +YV +K RMAK C
Sbjct: 1   MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + SQ +L   V +LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETSQEELAALVATLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL + NAGK+ IGD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSIANAGKLAIGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGATVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA DE  +V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 ERGEGKTRLVGDVAFDEVFAVASTITPVPGGVGPMTIAMLMANTVIAAHRAAGQTPPQF 299


>gi|325291977|ref|YP_004277841.1| methylenetetrahydrofolate dehydrogenase [Agrobacterium sp. H13-3]
 gi|325059830|gb|ADY63521.1| methylenetetrahydrofolate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 299

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 231/299 (77%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK  A+ +T+ + +S   L+ E GV+ GLAVV+VGNDPAS +YV++K++ AK C
Sbjct: 1   MAVVIDGKAKAASVTEAVRKSAETLEAEQGVKPGLAVVIVGNDPASHAYVNSKSKTAKQC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF+SVQ+  P + +Q  L   V  LN D SIHGILVQLPLP   +   IIQSI+PEKDVD
Sbjct: 61  GFNSVQHTLPEETTQDQLLKLVGELNADPSIHGILVQLPLPKHFNADEIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL V+NAGK+  GD  TGL+ CTPAGA+LL+    G DLSG +AVVIGRSNLFGKPMGQL
Sbjct: 121 GLSVLNAGKLATGDLATGLISCTPAGAMLLVRSIHGEDLSGLNAVVIGRSNLFGKPMGQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVTMAHS+TK+L  +C+TADILV AVGR  MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLNANATVTMAHSRTKDLATVCKTADILVAAVGRAAMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GK+ LVGDVA DE  +V  AITPVPGGVGPMTIAMLMANTVIAAYR+LG  +PKF
Sbjct: 241 EKGEGKSKLVGDVAYDEASAVAAAITPVPGGVGPMTIAMLMANTVIAAYRALGKTAPKF 299


>gi|159184377|ref|NP_353615.2| methylenetetrahydrofolate dehydrogenase [Agrobacterium tumefaciens
           str. C58]
 gi|81496525|sp|Q8UHU0|FOLD_AGRT5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|159139690|gb|AAK86400.2| methylenetetrahydrofolate dehydrogenase [Agrobacterium tumefaciens
           str. C58]
          Length = 299

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 232/299 (77%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK  A+ +T+ + +S   L+ E GV+ GLAVV+VGNDPAS +YV++K++MAK C
Sbjct: 1   MAVVIDGKAKAASVTEAVRKSAEALEAEKGVKPGLAVVIVGNDPASHAYVNSKSKMAKQC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF+S+Q+  P + +Q  L   V  LN D SIHGILVQLPLP   +   IIQSI+PEKDVD
Sbjct: 61  GFNSIQHTLPEETTQAALLKLVGELNTDASIHGILVQLPLPKHFNSDEIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL V+NAGK+  GD  TGL+ CTPAGA+LL+    G DLSG +AVVIGRSNLFGKPMGQL
Sbjct: 121 GLSVLNAGKLATGDLATGLISCTPAGAMLLVRGIHGDDLSGLNAVVIGRSNLFGKPMGQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVTMAHS+TK+L  +C+TADILV AVGR  MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLNANATVTMAHSRTKDLVTVCKTADILVAAVGRAAMVKGDWVKPGATVIDVGINRIAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GK+ LVGDVA DE  +V  AITPVPGGVGPMTIAMLMANTVIAA+R+LG  +PKF
Sbjct: 241 EKGEGKSKLVGDVAFDEASAVAAAITPVPGGVGPMTIAMLMANTVIAAHRALGKTAPKF 299


>gi|218460543|ref|ZP_03500634.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Rhizobium etli Kim 5]
          Length = 299

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 225/299 (75%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAV++VG+DPAS +YV +K RMAK C
Sbjct: 1   MATVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVIIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P +  Q +L   V SLN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETRQEELAALVASLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVTMAHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTMAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGATVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
               GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 DKGEGKTRLVGDVAFREVSEVASTITPVPGGVGPMTIAMLMANTVIAAHRAAGQTPPQF 299


>gi|86356345|ref|YP_468237.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Rhizobium etli CFN 42]
 gi|119369591|sp|Q2KCC6|FOLD1_RHIEC RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|86280447|gb|ABC89510.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Rhizobium etli CFN 42]
          Length = 299

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 228/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAV++VG+DPAS +YV +K+RMAK C
Sbjct: 1   MATVIDGKNVAASVIQTVKSATAALEKASGVTTGLAVIIVGDDPASHAYVGSKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + +Q +L   V +LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETTQEELAGLVATLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGATVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA  E   +   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 EKGEGKTRLVGDVAFREVSEIASTITPVPGGVGPMTIAMLMANTVIAAHRAAGQTPPQF 299


>gi|209546028|ref|YP_002277918.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209538885|gb|ACI58818.1| Methenyltetrahydrofolate cyclohydrolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 299

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/299 (62%), Positives = 226/299 (75%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA+ +   +  + A L+K +GV  GLAVV+VG+DPAS +YV +K RMAK C
Sbjct: 1   MVEVIDGKNVAASVIQTVKSATAALEKSSGVTAGLAVVIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + SQ +L   V +LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETSQEELAALVATLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL + NAGK+ IGD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSIANAGKLAIGDLRTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW++ G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADWVRPGATVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   PKF
Sbjct: 241 ERGEGKTRLVGDVAFAEVSEVASTITPVPGGVGPMTIAMLMANTVIAAHRTAGQTPPKF 299


>gi|190890397|ref|YP_001976939.1| folD1 [Rhizobium etli CIAT 652]
 gi|190695676|gb|ACE89761.1| folD1 [Rhizobium etli CIAT 652]
          Length = 299

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 227/299 (75%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAV++VG+DPAS +YV +K RMAK C
Sbjct: 1   MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVIIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  PV+ SQ +L   V +LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPVETSQEELAALVATLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVTMAHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTMAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGATVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
               GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 DKGEGKTRLVGDVAFAEVCDVASTITPVPGGVGPMTIAMLMANTVIAAHRAAGQTPPQF 299


>gi|86360690|ref|YP_472578.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Rhizobium etli CFN 42]
 gi|119369606|sp|Q2JZV0|FOLD2_RHIEC RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|86284792|gb|ABC93851.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
           [Rhizobium etli CFN 42]
          Length = 299

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 228/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK++A+ +   +  + A L+  +GV  GLAV++VG+DPAS +YV +K+RMAK C
Sbjct: 1   MVEVIDGKLIAASVIQTVKSATAALEMVSGVTTGLAVIIVGDDPASHAYVGSKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + +Q +L   V +LN D SIHGILVQLPLP  +  + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETTQEELAGLVATLNADPSIHGILVQLPLPKPLDSEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGATVIDVGINRVPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA  E   + G ITPVPGGVGPMTIAMLMANTVIAA+R+ G   PKF
Sbjct: 241 EKGEGKTRLVGDVAFREVSEIAGTITPVPGGVGPMTIAMLMANTVIAAHRAAGQVPPKF 299


>gi|116250515|ref|YP_766353.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|119370029|sp|Q1MLB6|FOLD_RHIL3 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|115255163|emb|CAK06237.1| putative folate-dependent dehydrogenase/hydrolase/synthetase
           protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 299

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 229/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAVV+VG+DPAS +YV +K RMAK C
Sbjct: 1   MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P D  Q DL   V +LN D SIHGILVQLPLP  +  ++IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPADTKQEDLAALVAALNADPSIHGILVQLPLPKPLDSEAIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADWVKPGATVIDVGINRVAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA +E  +V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 ETGEGKTRLVGDVAFEEVSAVASTITPVPGGVGPMTIAMLMANTVIAAHRTAGQTPPQF 299


>gi|75407262|sp|Q93E15|FOLD_RHILT RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|16151908|gb|AAL14906.1|AF372655_2 FolD [Rhizobium leguminosarum bv. trifolii]
          Length = 299

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/299 (63%), Positives = 229/299 (76%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAVV+VG+DPAS +YV +K RMAK C
Sbjct: 1   MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P D  Q DL   V +LN D SIHGILVQLPLP  +  ++IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPADTKQEDLAALVAALNADPSIHGILVQLPLPKPLDSEAIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADWVKPGATVIDVGINRVAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDVA +E  +V   ITPVPGGVGPMTIAMLMANTVIAA+R+ G   P+F
Sbjct: 241 ERGEGKTRLVGDVAFEEVSAVASTITPVPGGVGPMTIAMLMANTVIAAHRTAGQTPPQF 299


>gi|15963834|ref|NP_384187.1| bifunctional methylenetetrahydrofolate dehydrogenase/
           methenyltetrahydrofolate cyclohydrolase [Sinorhizobium
           meliloti 1021]
 gi|307309535|ref|ZP_07589190.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           BL225C]
 gi|307320367|ref|ZP_07599784.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           AK83]
 gi|81635398|sp|Q92T88|FOLD1_RHIME RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|15073009|emb|CAC41468.1| Probable bifunctional protein : methylenetetrahydrofolate
           dehydrogenase ; methenyltetrahydrofolate cyclohydrolase
           [Sinorhizobium meliloti 1021]
 gi|306893933|gb|EFN24702.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           AK83]
 gi|306899995|gb|EFN30616.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium meliloti
           BL225C]
          Length = 306

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 227/295 (76%), Gaps = 3/295 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   I ++ A L+++TG + GL+V++VG+DPAS +YV AK+RMAK C
Sbjct: 1   MTTIIDGKAVAASINGAIKDANAELQEQTGRKTGLSVIIVGDDPASHAYVGAKSRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P + +Q +L   V  LN DD IHGILVQLPLP  +   +IIQSI PEKDVD
Sbjct: 61  GFFSVQHTLPKETTQQELAGLVHQLNADDGIHGILVQLPLPEHLDADAIIQSIRPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLHV NAGK+  GD  +GL+ CTPAGA++ + +  G DLSG +A+VIGRSNLFGKPM QL
Sbjct: 121 GLHVANAGKLATGDLESGLISCTPAGAMVFVRRVHGRDLSGLNALVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+T +L  ICR ADI++ AVGRP MV+ +W+KTG+ VIDVGINR+ +P
Sbjct: 181 LLNANATVTIAHSRTSDLASICRNADIVIAAVGRPEMVKANWLKTGATVIDVGINRVPAP 240

Query: 241 QLG--KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           + G  +T LVGDVA  EC     AITPVPGGVGPMTIAMLMAN+VIAA+R+ G+K
Sbjct: 241 EKGENRTRLVGDVAFAECAPFASAITPVPGGVGPMTIAMLMANSVIAAHRASGLK 295


>gi|326410931|gb|ADZ67995.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella melitensis
           M28]
 gi|326554222|gb|ADZ88861.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella melitensis
           M5-90]
          Length = 313

 Score =  348 bits (893), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 15  MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 74

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 75  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 134

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 135 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 194

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 195 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 254

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 255 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 313


>gi|254699994|ref|ZP_05161822.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella suis bv. 5 str. 513]
          Length = 326

 Score =  348 bits (893), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 218/303 (71%), Gaps = 3/303 (0%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 15  MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 74

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 75  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 134

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+ +IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 135 GFHFINVGKLGTGEVETAFVPCTPAGAMFMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 194

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 195 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 254

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFD 297
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK+P  D
Sbjct: 255 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKNPFSD 314

Query: 298 AQS 300
           A  
Sbjct: 315 ADE 317


>gi|261750477|ref|ZP_05994186.1| bifunctional protein folD [Brucella suis bv. 5 str. 513]
 gi|261740230|gb|EEY28156.1| bifunctional protein folD [Brucella suis bv. 5 str. 513]
          Length = 312

 Score =  348 bits (893), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 218/303 (71%), Gaps = 3/303 (0%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+ +IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMFMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFD 297
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK+P  D
Sbjct: 241 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKNPFSD 300

Query: 298 AQS 300
           A  
Sbjct: 301 ADE 303


>gi|306845998|ref|ZP_07478565.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. BO1]
 gi|306273633|gb|EFM55478.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. BO1]
          Length = 299

 Score =  348 bits (892), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLATNATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGEGKTRLVGDVNFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|17988855|ref|NP_541488.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           melitensis bv. 1 str. 16M]
 gi|225629255|ref|ZP_03787288.1| Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Brucella ceti str. Cudo]
 gi|237816935|ref|ZP_04595927.1| Methylenetetrahydrofolate dehydrogenase [Brucella abortus str. 2308
           A]
 gi|17984679|gb|AAL53752.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|225615751|gb|EEH12800.1| Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Brucella ceti str. Cudo]
 gi|237787748|gb|EEP61964.1| Methylenetetrahydrofolate dehydrogenase [Brucella abortus str. 2308
           A]
          Length = 319

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 21  MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 80

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 81  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 140

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 141 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 200

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 201 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 260

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 261 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 319


>gi|254712555|ref|ZP_05174366.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella ceti M644/93/1]
 gi|254715627|ref|ZP_05177438.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella ceti M13/05/1]
 gi|261217376|ref|ZP_05931657.1| methylenetetrahydrofolate dehydrogenase [Brucella ceti M13/05/1]
 gi|261320249|ref|ZP_05959446.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922465|gb|EEX89033.1| methylenetetrahydrofolate dehydrogenase [Brucella ceti M13/05/1]
 gi|261292939|gb|EEX96435.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 299

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGDGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|23500516|ref|NP_699956.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           suis 1330]
 gi|62317382|ref|YP_223235.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           abortus bv. 1 str. 9-941]
 gi|83269360|ref|YP_418651.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           melitensis biovar Abortus 2308]
 gi|148558327|ref|YP_001257728.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           ovis ATCC 25840]
 gi|161620839|ref|YP_001594725.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/methenyl
           tetrahydrofolate cyclohydrolase FolD [Brucella canis
           ATCC 23365]
 gi|163844908|ref|YP_001622563.1| hypothetical protein BSUIS_B0773 [Brucella suis ATCC 23445]
 gi|189022636|ref|YP_001932377.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella abortus
           S19]
 gi|225686548|ref|YP_002734520.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           melitensis ATCC 23457]
 gi|254695806|ref|ZP_05157634.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella abortus bv. 3 str. Tulya]
 gi|254698664|ref|ZP_05160492.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254703115|ref|ZP_05164943.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella suis bv. 3 str. 686]
 gi|254705740|ref|ZP_05167568.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella pinnipedialis M163/99/10]
 gi|254710973|ref|ZP_05172784.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella pinnipedialis B2/94]
 gi|254732111|ref|ZP_05190689.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella abortus bv. 4 str. 292]
 gi|256029355|ref|ZP_05442969.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella pinnipedialis M292/94/1]
 gi|256043656|ref|ZP_05446581.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059043|ref|ZP_05449252.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella neotomae 5K33]
 gi|256111307|ref|ZP_05452333.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella melitensis bv. 3 str. Ether]
 gi|256157547|ref|ZP_05455465.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella ceti M490/95/1]
 gi|256253478|ref|ZP_05459014.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella ceti B1/94]
 gi|256262315|ref|ZP_05464847.1| folD [Brucella melitensis bv. 2 str. 63/9]
 gi|260167557|ref|ZP_05754368.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Brucella
           sp. F5/99]
 gi|260544620|ref|ZP_05820441.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella abortus
           NCTC 8038]
 gi|260564846|ref|ZP_05835331.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260567955|ref|ZP_05838424.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella suis bv. 4
           str. 40]
 gi|260759897|ref|ZP_05872245.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 4
           str. 292]
 gi|260763135|ref|ZP_05875467.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|261216226|ref|ZP_05930507.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 3
           str. Tulya]
 gi|261220605|ref|ZP_05934886.1| folD [Brucella ceti B1/94]
 gi|261313161|ref|ZP_05952358.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318553|ref|ZP_05957750.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322988|ref|ZP_05962185.1| folD [Brucella neotomae 5K33]
 gi|261753735|ref|ZP_05997444.1| bifunctional protein folD [Brucella suis bv. 3 str. 686]
 gi|261756977|ref|ZP_06000686.1| bifunctional protein folD [Brucella sp. F5/99]
 gi|265986354|ref|ZP_06098911.1| folD [Brucella pinnipedialis M292/94/1]
 gi|265990076|ref|ZP_06102633.1| folD [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992813|ref|ZP_06105370.1| folD [Brucella melitensis bv. 3 str. Ether]
 gi|265996048|ref|ZP_06108605.1| folD [Brucella ceti M490/95/1]
 gi|294853445|ref|ZP_06794117.1| folD protein [Brucella sp. NVSL 07-0026]
 gi|75495697|sp|Q578R0|FOLD_BRUAB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|81751163|sp|Q8FVP6|FOLD_BRUSU RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119369625|sp|Q2YL33|FOLD_BRUA2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119369626|sp|Q8YCL8|FOLD_BRUME RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158705718|sp|A5VV73|FOLD_BRUO2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|189044521|sp|A9MC67|FOLD_BRUC2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|189044522|sp|A9WZ75|FOLD_BRUSI RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|226704323|sp|B2SAP4|FOLD_BRUA1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|254789391|sp|C0RLT3|FOLD_BRUMB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|23464147|gb|AAN33961.1| FolD bifunctional protein [Brucella suis 1330]
 gi|62197575|gb|AAX75874.1| FolD bifunctional protein [Brucella abortus bv. 1 str. 9-941]
 gi|82939634|emb|CAJ12623.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella melitensis
           biovar Abortus 2308]
 gi|148369612|gb|ABQ62484.1| FolD bifunctional protein [Brucella ovis ATCC 25840]
 gi|161337650|gb|ABX63954.1| Bifunctional protein folD [Brucella canis ATCC 23365]
 gi|163675631|gb|ABY39741.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021210|gb|ACD73931.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella abortus
           S19]
 gi|225642653|gb|ACO02566.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella melitensis
           ATCC 23457]
 gi|260097891|gb|EEW81765.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella abortus
           NCTC 8038]
 gi|260152489|gb|EEW87582.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260154620|gb|EEW89701.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella suis bv. 4
           str. 40]
 gi|260670215|gb|EEX57155.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 4
           str. 292]
 gi|260673556|gb|EEX60377.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260917833|gb|EEX84694.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 3
           str. Tulya]
 gi|260919189|gb|EEX85842.1| folD [Brucella ceti B1/94]
 gi|261297776|gb|EEY01273.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298968|gb|EEY02465.1| folD [Brucella neotomae 5K33]
 gi|261302187|gb|EEY05684.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261736961|gb|EEY24957.1| bifunctional protein folD [Brucella sp. F5/99]
 gi|261743488|gb|EEY31414.1| bifunctional protein folD [Brucella suis bv. 3 str. 686]
 gi|262550345|gb|EEZ06506.1| folD [Brucella ceti M490/95/1]
 gi|262763683|gb|EEZ09715.1| folD [Brucella melitensis bv. 3 str. Ether]
 gi|263000745|gb|EEZ13435.1| folD [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092042|gb|EEZ16339.1| folD [Brucella melitensis bv. 2 str. 63/9]
 gi|264658551|gb|EEZ28812.1| folD [Brucella pinnipedialis M292/94/1]
 gi|294819100|gb|EFG36100.1| folD protein [Brucella sp. NVSL 07-0026]
          Length = 299

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|306841688|ref|ZP_07474375.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. BO2]
 gi|306288218|gb|EFM59602.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. BO2]
          Length = 314

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 16  MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 75

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 76  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 135

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 136 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 195

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ +W+K G+ VIDVGINRI +P
Sbjct: 196 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGEWVKPGATVIDVGINRIPAP 255

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 256 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 314


>gi|256015545|ref|YP_003105554.1| FolD bifunctional protein [Brucella microti CCM 4915]
 gi|255998205|gb|ACU49892.1| FolD bifunctional protein [Brucella microti CCM 4915]
          Length = 299

 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +A+VIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAMVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|256256068|ref|ZP_05461604.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella abortus bv. 9 str. C68]
 gi|260882287|ref|ZP_05893901.1| folD [Brucella abortus bv. 9 str. C68]
 gi|297249422|ref|ZP_06933123.1| bifunctional protein folD [Brucella abortus bv. 5 str. B3196]
 gi|260871815|gb|EEX78884.1| folD [Brucella abortus bv. 9 str. C68]
 gi|297173291|gb|EFH32655.1| bifunctional protein folD [Brucella abortus bv. 5 str. B3196]
          Length = 299

 Score =  345 bits (886), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R A+ C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|254720110|ref|ZP_05181921.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. 83/13]
 gi|265985115|ref|ZP_06097850.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella sp. 83/13]
 gi|306839052|ref|ZP_07471872.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. NF 2653]
 gi|264663707|gb|EEZ33968.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Brucella sp. 83/13]
 gi|306405875|gb|EFM62134.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella sp. NF 2653]
          Length = 299

 Score =  345 bits (886), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 217/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G +LSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRNLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I R ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|254690883|ref|ZP_05154137.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Brucella abortus bv. 6 str. 870]
 gi|260756465|ref|ZP_05868813.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 6
           str. 870]
 gi|260676573|gb|EEX63394.1| methenyltetrahydrofolate cyclohydrolase [Brucella abortus bv. 6
           str. 870]
          Length = 299

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 216/299 (72%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TGV  G+AVV+VG DPAS  YV++K+R A+ C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDPASQVYVASKSRKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L N +  LN D +IHGILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPGHIDSGRVIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I   ADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIAHNADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA RS GMK P F
Sbjct: 241 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRSAGMKKPVF 299


>gi|222147603|ref|YP_002548560.1| methylenetetrahydrofolate dehydrogenase /cyclohydrolase
           [Agrobacterium vitis S4]
 gi|221734591|gb|ACM35554.1| methylenetetrahydrofolate dehydrogenase /cyclohydrolase
           [Agrobacterium vitis S4]
          Length = 263

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 171/263 (65%), Positives = 206/263 (78%), Gaps = 3/263 (1%)

Query: 37  VVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILV 96
           +V+VG+DPAS  YVS+K +MAK CGF+SVQY  P + SQ +L   V +LN D SIHGILV
Sbjct: 1   MVIVGDDPASHVYVSSKGKMAKECGFNSVQYKLPEETSQQELLALVQTLNGDSSIHGILV 60

Query: 97  QLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKG 156
           QLPLP  +  + +IQSI+PEKDVDGLHVVNAGK+  GD  TG++ CTPAG++LL+ Q  G
Sbjct: 61  QLPLPKHIDSELVIQSILPEKDVDGLHVVNAGKLATGDLETGMISCTPAGSMLLVRQIHG 120

Query: 157 CDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPR 216
            DLSG +A+VIGRSNLFGKPM QLLL+ NATVT+AHS+++N+  + R ADILV AVGR  
Sbjct: 121 TDLSGLNALVIGRSNLFGKPMAQLLLNANATVTIAHSRSRNVSVLARQADILVAAVGRAE 180

Query: 217 MVQVDWIKTGSLVIDVGINRINSPQL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMT 273
           MV+ DWIK G+ VIDVG+NR+ +P+   GKT LVGDVA  EC     AITPVPGGVGPMT
Sbjct: 181 MVKSDWIKDGATVIDVGVNRVPAPEKGEGKTKLVGDVAYGECAVKAAAITPVPGGVGPMT 240

Query: 274 IAMLMANTVIAAYRSLGMKSPKF 296
           IAMLMANTVIAAYRS G + PKF
Sbjct: 241 IAMLMANTVIAAYRSAGKQPPKF 263


>gi|239834330|ref|ZP_04682658.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Ochrobactrum
           intermedium LMG 3301]
 gi|239822393|gb|EEQ93962.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Ochrobactrum
           intermedium LMG 3301]
          Length = 305

 Score =  342 bits (877), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 175/299 (58%), Positives = 219/299 (73%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TG+  G+AVV+VG DPAS  YV++K+R AK C
Sbjct: 7   MAQLIDGKKLAEDVVSTVKTETEKLVAATGIVPGIAVVIVGEDPASQVYVASKSRKAKEC 66

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L + + SLN D +IHGILVQLPLP  +    +IQ+I P+KDVD
Sbjct: 67  GFHSVQHDLPETASERELLDLIESLNNDPAIHGILVQLPLPGHIDSGRVIQTISPDKDVD 126

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 127 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLSGLNAVVIGRSNIVGKPMFNL 186

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I RTADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 187 LLAANATVTVAHSRTKDLPAIARTADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 246

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ +A R+ G+K P F
Sbjct: 247 ERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAMLMANTLTSACRTAGVKKPVF 305


>gi|153011279|ref|YP_001372493.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Ochrobactrum
           anthropi ATCC 49188]
 gi|166988397|sp|A6X610|FOLD_OCHA4 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|151563167|gb|ABS16664.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Ochrobactrum
           anthropi ATCC 49188]
          Length = 299

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 219/299 (73%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +   +      L   TG+  G+AVV+VG DPAS  YV++K++ AK C
Sbjct: 1   MAQLIDGKKLAEDVVSTVKTETEKLVAATGIVPGIAVVIVGEDPASQVYVASKSKKAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P   S+ +L + + SLN D +IHGILVQLPLP  +    +IQ+I P+KDVD
Sbjct: 61  GFHSVQHDLPETASEQELLDLIESLNNDPAIHGILVQLPLPKHIDSGRVIQTISPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAGA+++IE+  G DLSG +AVVIGRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGEVETAFVPCTPAGAMIMIERIHGRDLSGLNAVVIGRSNIVGKPMFNL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP I RTADILV AVGRP+MV+ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANATVTVAHSRTKDLPAIARTADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   G+T LVGDV   E + V GAITPVPGGVGPMTIAMLMANT+ AA R+ G+K P F
Sbjct: 241 ERGEGRTRLVGDVDFVEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACRTAGVKKPVF 299


>gi|110632514|ref|YP_672722.1| methenyltetrahydrofolate cyclohydrolase [Mesorhizobium sp. BNC1]
 gi|119369809|sp|Q11M18|FOLD_MESSB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|110283498|gb|ABG61557.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Chelativorans sp. BNC1]
          Length = 298

 Score =  338 bits (868), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 176/299 (58%), Positives = 216/299 (72%), Gaps = 4/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA+ + +K+      LK   GV  GLAVV+VG DPAS  YV++K R A  C
Sbjct: 1   MVQIIDGKAVAATILEKVTRETQDLKA-NGVTPGLAVVIVGEDPASQVYVASKGRKATEC 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ++ P + S+ +L + V +LN+D +IHGILVQLPLP  +  + II +I PEKDVD
Sbjct: 60  GFHSVQHSLPENTSEEELVSLVEALNRDPAIHGILVQLPLPKQIDSERIIHTIAPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H++N G +  G  T  LVPCTPAGA+LLIE  +G DLSG  AVVIGRSN+ GKPM  L
Sbjct: 120 GFHILNVGMLGTGAVTKALVPCTPAGAMLLIEGVRGKDLSGLSAVVIGRSNIVGKPMANL 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+T +LP  CR ADILV AVGRP MV+ DWIK G+ VIDVG++RI +P
Sbjct: 180 LLAANATVTIAHSRTADLPAACRGADILVAAVGRPEMVKGDWIKPGATVIDVGVSRIPAP 239

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GK  LVGDVA  E + V GAITPVPGGVGPMTIAMLMANT+ AA ++ G   P F
Sbjct: 240 EKGEGKMKLVGDVAYAEAEKVAGAITPVPGGVGPMTIAMLMANTLAAASKASGRDLPAF 298


>gi|260463529|ref|ZP_05811728.1| Methenyltetrahydrofolate cyclohydrolase [Mesorhizobium
           opportunistum WSM2075]
 gi|259030620|gb|EEW31897.1| Methenyltetrahydrofolate cyclohydrolase [Mesorhizobium
           opportunistum WSM2075]
          Length = 299

 Score =  338 bits (866), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 214/299 (71%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA  +   +    A L  +   + GLAVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAEVIDGKSVAEDVVRTVKALTAELVAKGKAKPGLAVVIVGEDPASQVYVASKSRTAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS+Q+  P D SQ  L   +  LN D +I+GILVQLPLP  +    +IQ+I PEKDVD
Sbjct: 61  GFHSLQHTLPADTSQDALLKIIGELNADPAINGILVQLPLPGHIDAGKVIQAIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAG++LLIE+ +G DLSG +AVV+GRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGELDTAFVPCTPAGSMLLIERVRGKDLSGLNAVVVGRSNIVGKPMANL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ N TVT+AHS+TK+LP + RTADILV AVGRP M++ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANCTVTIAHSRTKDLPALARTADILVAAVGRPEMIRGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GK+ LVGDVA  E     GAITPVPGGVGPMTIAMLMANT+ +AY + G+K P F
Sbjct: 241 EKGEGKSRLVGDVAYAEAAKEAGAITPVPGGVGPMTIAMLMANTLASAYLAAGLKRPSF 299


>gi|114707020|ref|ZP_01439919.1| methylenetetrahydrofolate dehydrogenase [Fulvimarina pelagi
           HTCC2506]
 gi|114537570|gb|EAU40695.1| methylenetetrahydrofolate dehydrogenase [Fulvimarina pelagi
           HTCC2506]
          Length = 300

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 216/300 (72%), Gaps = 8/300 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           +DGK  +  + +++ E    LK ETG+Q GLAVV+VG+DPAS  YV +K + A+ CGF S
Sbjct: 1   MDGKGRSKSILEEVTEKTKALKAETGMQPGLAVVIVGSDPASQVYVGSKAKRAEECGFKS 60

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
           V++  P + S+ DL   V  LNKDD+IHGILVQLPLP  + +  +IQ+I P+KDVDG H+
Sbjct: 61  VKHELPAETSEADLLKIVDDLNKDDTIHGILVQLPLPKQIDDGKVIQAIDPDKDVDGFHL 120

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           VN G++  G      VPCTPAG +++I    G DLSG +AV++GRSN+ GKPM QLLL+ 
Sbjct: 121 VNVGRIATGAADEAFVPCTPAGCMVMIRDMLGEDLSGLNAVIVGRSNIVGKPMAQLLLAA 180

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG- 243
           NATVT+AHS+TKNL  +C  ADILV AVGRP MV  D++K G++V+DVGINR+++P+ G 
Sbjct: 181 NATVTIAHSRTKNLAAVCANADILVAAVGRPEMVTGDYVKEGAVVVDVGINRVDAPEKGM 240

Query: 244 ------KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
                 KT LVGDVA DE      AITPVPGGVGPMTI MLMANT+ +AYR+ G ++PKF
Sbjct: 241 KEDGSPKTRLVGDVAYDEAAKKAKAITPVPGGVGPMTIGMLMANTLRSAYRAAGKEAPKF 300


>gi|13475440|ref|NP_107004.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Mesorhizobium loti MAFF303099]
 gi|81777449|sp|Q989A7|FOLD1_RHILO RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|14026192|dbj|BAB52790.1| methylenetetrahydrofolate dehydrogenase [Mesorhizobium loti
           MAFF303099]
          Length = 299

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 167/299 (55%), Positives = 215/299 (71%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA  +   +    A L  +   + GLAVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAEVIDGKSVAEDVVRTVKALTAELVAKGKAKPGLAVVIVGEDPASQVYVASKSRTAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS+Q+  P + S+  L   +  LN D +++GILVQLPLP+ +    IIQ+I P+KDVD
Sbjct: 61  GFHSLQHTLPAETSEEALLKIIADLNADPAVNGILVQLPLPAHIDAGKIIQAIAPQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAG++LLI++ +G DLSG +AVV+GRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGELDTAFVPCTPAGSMLLIQRVRGKDLSGLNAVVVGRSNIVGKPMANL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ N TVT+AHS+TK+LP + RTADILV AVGRP M++ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANCTVTIAHSRTKDLPALARTADILVAAVGRPEMIKGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GK+ LVGDVA  E     GAITPVPGGVGPMTIAMLMANT+ +AY + G+K P F
Sbjct: 241 EKGEGKSRLVGDVAYAEAARQAGAITPVPGGVGPMTIAMLMANTLASAYLAAGLKRPTF 299


>gi|254474024|ref|ZP_05087417.1| bifunctional protein FolD 1 [Pseudovibrio sp. JE062]
 gi|211956913|gb|EEA92120.1| bifunctional protein FolD 1 [Pseudovibrio sp. JE062]
          Length = 308

 Score =  331 bits (849), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 167/300 (55%), Positives = 222/300 (74%), Gaps = 5/300 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A+ +TD+I    A L+ ETGV+ GLAVV+VG DPAS  YV  K R AK CGF+
Sbjct: 6   IIDGKAIAASVTDEITARAARLESETGVKPGLAVVIVGEDPASQVYVRNKGRTAKACGFN 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+ +  P D+S+ +L   V SLN+DD++HGILVQLPLP  ++E  ++  I PEKDVDG H
Sbjct: 66  SITHTLPADVSEEELLALVTSLNEDDAVHGILVQLPLPKHINENKVLDLIKPEKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +  G+    LVPCTPAG++LL ++  G DLSG+ AV++GRSN+ GKP+ QLLL 
Sbjct: 126 PINVGLLGSGNTDRALVPCTPAGSVLLAKKALGDDLSGKTAVIVGRSNIVGKPIAQLLLQ 185

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TK+LP++ R+ADI++ AVGRP+M++ DW+K G+ VIDVGINRI +P+  
Sbjct: 186 EHCTVTIAHSRTKDLPDVVRSADIVIAAVGRPQMIKGDWLKPGATVIDVGINRIPAPEKG 245

Query: 243 -GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM--KSPKFDA 298
            GKT LVGDVA DE      AITPVP GVGPMTIAMLM+NT+ AA R +G+  + P F+A
Sbjct: 246 EGKTRLVGDVAFDEALGHTAAITPVPRGVGPMTIAMLMSNTLTAARRLMGLSEEPPLFEA 305


>gi|319782121|ref|YP_004141597.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317168009|gb|ADV11547.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 299

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 213/299 (71%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA  +   +    A L  +   + GLAVV+VG DPAS  YV++K+R AK C
Sbjct: 1   MAEVIDGKSVAGDVVGTVKTLTAELVAKGKAKPGLAVVIVGEDPASQVYVASKSRTAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSVQ+  P + S+  L   +  LN D +I+GILVQLPLP+ +    IIQ+I PEKDVD
Sbjct: 61  GFHSVQHTLPAETSEEALLKIIGDLNADPAINGILVQLPLPAHIDAGKIIQTIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G+  T  VPCTPAG++LLIE+ +G DLSG +AVV+GRSN+ GKPM  L
Sbjct: 121 GFHFINVGKLGTGELETAFVPCTPAGSMLLIERVRGKDLSGLNAVVVGRSNIVGKPMANL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ N TVT+AHS+T++LP + RTADILV AVGRP M++ DW+K G+ VIDVGINRI +P
Sbjct: 181 LLAANCTVTIAHSRTRDLPALARTADILVAAVGRPEMIRGDWVKPGATVIDVGINRIPAP 240

Query: 241 QL--GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GK+ LVGDV   E      AITPVPGGVGPMTIAMLMANT+ +AY + G+K P F
Sbjct: 241 EKGEGKSRLVGDVAYAEAARAASAITPVPGGVGPMTIAMLMANTLASAYLAAGLKRPSF 299


>gi|90420646|ref|ZP_01228552.1| FolD bifunctional protein, methylenetetrahydrofolate
           dehydrogenase/cyclohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334937|gb|EAS48698.1| FolD bifunctional protein, methylenetetrahydrofolate
           dehydrogenase/cyclohydrolase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 306

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 212/300 (70%), Gaps = 8/300 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ + +++  + + L  ETG+Q GLAVV+VG DPAS  YV +K + A  CGF S
Sbjct: 7   IDGKARAARIIEEVTAATSSLTAETGLQPGLAVVIVGEDPASQVYVGSKAKRAVECGFKS 66

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
           V++    D S+  L + +  LN D  IHGILVQLPLP  + E  +IQ+I  +KDVDG H+
Sbjct: 67  VKHVLDADTSEAALLDLIAELNADPDIHGILVQLPLPPQIDEGKVIQAIDADKDVDGFHL 126

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           VN G++  G      VPCTPAG+++LI    G DLSG +AV++GRSN+ GKPM QLLL+ 
Sbjct: 127 VNVGRLSTGAIDEAFVPCTPAGSMILIRDVLGDDLSGLNAVIVGRSNIVGKPMAQLLLAA 186

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG- 243
           NATVT+AHS+TK+LP +CR ADILV AVGRP M+  D++K G++VIDVGINRI++P+ G 
Sbjct: 187 NATVTIAHSRTKDLPALCRNADILVAAVGRPEMIGADYVKEGAVVIDVGINRIDAPEKGN 246

Query: 244 ------KTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
                 KT LVGDVA E  S    AITPVPGGVGPMTIAMLMANT++AA R+ G   P+F
Sbjct: 247 NPDGSVKTRLVGDVAFEAASQKAAAITPVPGGVGPMTIAMLMANTLVAACRAAGRTPPRF 306


>gi|218514915|ref|ZP_03511755.1| folD1 [Rhizobium etli 8C-3]
          Length = 264

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/245 (66%), Positives = 188/245 (76%), Gaps = 3/245 (1%)

Query: 49  YVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQS 108
           YV +K RMAK CGF SVQ+    + SQ +L   V +LN D SIHGILVQLPLP  +  + 
Sbjct: 1   YVGSKGRMAKECGFKSVQHTLQAETSQEELAALVATLNADPSIHGILVQLPLPKPLDSEP 60

Query: 109 IIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIG 168
           IIQSI+PEKDVDGL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIG
Sbjct: 61  IIQSILPEKDVDGLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIG 120

Query: 169 RSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSL 228
           RSNLFGKPM QLLL+ NATVTMAHS+TKNL E+CR ADILV AVGRP MV+ DW+K G+ 
Sbjct: 121 RSNLFGKPMAQLLLNANATVTMAHSRTKNLAEVCRNADILVAAVGRPEMVKADWVKPGAT 180

Query: 229 VIDVGINRINSPQL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           VIDVGINR+ +P    GKT LVGDVA  E   V   ITPVPGGVGPMTIAMLMANTVIAA
Sbjct: 181 VIDVGINRVPAPDKGEGKTRLVGDVAFAEVCDVASTITPVPGGVGPMTIAMLMANTVIAA 240

Query: 286 YRSLG 290
           +R+ G
Sbjct: 241 HRAAG 245


>gi|307946617|ref|ZP_07661952.1| bifunctional protein FolD 1 [Roseibium sp. TrichSKD4]
 gi|307770281|gb|EFO29507.1| bifunctional protein FolD 1 [Roseibium sp. TrichSKD4]
          Length = 340

 Score =  321 bits (823), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 165/297 (55%), Positives = 213/297 (71%), Gaps = 5/297 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA  + ++I      L +  G + GLAVV+VG+DPAS  YV  K + A+ CGFH
Sbjct: 43  VIDGKAVAESVREEITRRSQDLLENHGTRPGLAVVIVGHDPASQVYVRNKQKTAEACGFH 102

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV+++ P D S+ DL   V  LN D +IHGILVQLPLP  + E  ++  I PEKDVDG H
Sbjct: 103 SVKHDMPEDTSEDDLLAMVQKLNDDAAIHGILVQLPLPGHIDESKVLNLIKPEKDVDGFH 162

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +  G+ ++ LVPCTPAG+++LI++  G +LSG+ AV++GRSN+ GKPM  LLL 
Sbjct: 163 PINVGLLTAGEQSSALVPCTPAGSLVLIKRALGKNLSGKTAVIVGRSNIVGKPMASLLLQ 222

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + T+T+AHS+TK+L E+ R ADI+V AVGRP MV+ DWIK G+ VIDVGINR+ +P+  
Sbjct: 223 ESCTITIAHSRTKDLSEVVRAADIVVAAVGRPEMVKGDWIKPGATVIDVGINRVPAPEKG 282

Query: 243 -GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFD 297
            GKT LVGDVA +E     GAITPVPGGVGPMTIAMLMANTV AA R LG+  P+ D
Sbjct: 283 EGKTRLVGDVAYEEAAEHAGAITPVPGGVGPMTIAMLMANTVTAARRQLGL--PEAD 337


>gi|328544412|ref|YP_004304521.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [polymorphum
           gilvum SL003B-26A1]
 gi|326414154|gb|ADZ71217.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Polymorphum
           gilvum SL003B-26A1]
          Length = 303

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 166/298 (55%), Positives = 211/298 (70%), Gaps = 5/298 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK +A+ +  +I    A L +ETG + GLAVVLVG DPAS  YV  K + A+ CGFH
Sbjct: 6   LIDGKAIAASVRAEITARAARLVRETGRRPGLAVVLVGEDPASEVYVRNKDKAAEACGFH 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV++  P   SQ +L   V  LN D  IHGILVQLPLP  +   ++++ I P+KDVDG H
Sbjct: 66  SVKHTLPATTSQAELVALVARLNDDADIHGILVQLPLPDHIDASTVLRLIRPDKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G +  G+  + LVPCTPAG+++L+++     L+G  AVVIGRSN+ GKPM  LLL+
Sbjct: 126 PVNVGLLTAGERASALVPCTPAGSLVLLKRTLPGPLAGLEAVVIGRSNIVGKPMASLLLA 185

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
            + TVT+AHS+T++LP + R ADI+V AVGRP+MV+ DWIK G+ VIDVGINRI +P   
Sbjct: 186 ESCTVTIAHSRTRDLPAVVRRADIVVAAVGRPQMVRGDWIKPGTTVIDVGINRIPAPDRG 245

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM--KSPKF 296
            G T LVGDVA DE ++  GAITPVPGGVGPMTIAMLMANT+ AA R LG+  + P F
Sbjct: 246 AGATRLVGDVAFDEARTRAGAITPVPGGVGPMTIAMLMANTLTAARRQLGLAEEPPLF 303


>gi|118590309|ref|ZP_01547712.1| methylenetetrahydrofolate dehydrogenase [Stappia aggregata IAM
           12614]
 gi|118437281|gb|EAV43919.1| methylenetetrahydrofolate dehydrogenase [Stappia aggregata IAM
           12614]
          Length = 303

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/291 (55%), Positives = 207/291 (71%), Gaps = 3/291 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  +  +I    A L + +G + GLAVVLVG DPAS  YV  K R A+ CGFH
Sbjct: 6   IIDGKAIAESVRQEITNRAAKLLETSGKRPGLAVVLVGEDPASQVYVRNKDRAAEACGFH 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV++    D S+ D+   V  LN D  IHGILVQLPLP  + E  +++ I PEKDVDG H
Sbjct: 66  SVKHTLAADTSEADVLALVDQLNNDADIHGILVQLPLPDHIDESKVLRLIRPEKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +  G+  + LVPCTPAG+++L+++  G  LSG +AVV+GRSN+ GKPM  LLL 
Sbjct: 126 PINVGLLTAGELDSALVPCTPAGSLILLKRTLGGTLSGLNAVVVGRSNIVGKPMASLLLQ 185

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+T++LP++ R+ADI+V AVGRP M++ DWIK G+ VIDVGINRI +P+L 
Sbjct: 186 ESCTVTIAHSRTRDLPDVVRSADIVVAAVGRPEMIKGDWIKPGATVIDVGINRIPAPELG 245

Query: 243 -GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            GK  LVGDVA  E   V GAITPVPGGVGPMTIAMLM NT+ AA R LG+
Sbjct: 246 EGKARLVGDVAFSEAVDVAGAITPVPGGVGPMTIAMLMVNTLTAARRLLGL 296


>gi|254504027|ref|ZP_05116178.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Labrenzia alexandrii DFL-11]
 gi|222440098|gb|EEE46777.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Labrenzia alexandrii DFL-11]
          Length = 303

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/291 (55%), Positives = 207/291 (71%), Gaps = 3/291 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  +  +I E  A L  ETG + GLAV+LVG DPAS  YV  K R A+ CGFH
Sbjct: 6   IIDGKAIAESVRGEITERAAKLLSETGKRPGLAVILVGEDPASQVYVRNKDRAAEACGFH 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV++  P D S+  +   V  LN D  IHGILVQLPLP  + E  +++ I PEKDVDG H
Sbjct: 66  SVKHTMPADSSEDAVLGMVDQLNNDPDIHGILVQLPLPGHIDESKVLRLIKPEKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +  G+  + LVPCTPAG+++L+++  G  LSG++AVV+GRSN+ GKPM  LLL 
Sbjct: 126 PINVGLLTAGERDSALVPCTPAGSLVLLKRTLGDTLSGKNAVVVGRSNIVGKPMASLLLQ 185

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TK LP++ R ADI+V AVGRP MV+ DWIK G+ V+DVGINRI +P+  
Sbjct: 186 ESCTVTIAHSRTKALPDVVRAADIVVAAVGRPEMVKGDWIKPGATVVDVGINRIPAPEKG 245

Query: 243 -GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            GK+ LVGDVA +E     GAITPVPGGVGPMTIAMLM NT+ AA R +G+
Sbjct: 246 EGKSRLVGDVAFEEAAEHAGAITPVPGGVGPMTIAMLMVNTLTAARRLMGL 296


>gi|288959534|ref|YP_003449875.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Azospirillum sp.
           B510]
 gi|288911842|dbj|BAI73331.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Azospirillum sp.
           B510]
          Length = 310

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 162/280 (57%), Positives = 196/280 (70%), Gaps = 2/280 (0%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ L  ++AE VA LK   GV  GLAVVLVG DPAS  YV +K R     G +
Sbjct: 15  IIDGKAFAAGLRARVAEGVAALKASHGVTPGLAVVLVGEDPASQVYVRSKERALVELGMN 74

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  ++ P D+++ DL   +  LN D ++HGILVQLPLP  +  Q ++  IVPEKD DG H
Sbjct: 75  SFDHHEPADMAEADLLALIDRLNADPAVHGILVQLPLPRHIDTQKVLARIVPEKDADGFH 134

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG +  G     +VPCTP G++LLI    G DL G+ A+V+GRSN+ GKPM QLLL 
Sbjct: 135 VVNAGLLATGQ-PGAIVPCTPLGSLLLIRDTLGRDLKGKRALVLGRSNIVGKPMAQLLLQ 193

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVTMAHS+T +LPE CR ADILV AVGRP MV+ DWIK G+ VIDVGINR+ + + G
Sbjct: 194 ADCTVTMAHSRTADLPEECRRADILVAAVGRPEMVRGDWIKPGATVIDVGINRVAAAEPG 253

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           KT LVGDVA DE   V GAITPVPGGVGPMTIA LM NT+
Sbjct: 254 KTRLVGDVAFDEAVKVAGAITPVPGGVGPMTIACLMLNTL 293


>gi|217978041|ref|YP_002362188.1| Methenyltetrahydrofolate cyclohydrolase [Methylocella silvestris
           BL2]
 gi|217503417|gb|ACK50826.1| Methenyltetrahydrofolate cyclohydrolase [Methylocella silvestris
           BL2]
          Length = 318

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 207/297 (69%), Gaps = 10/297 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  +  +  +I E V  L    G+Q GLAV+LVG DPAS  YV AK + AK CGFH
Sbjct: 23  LIDGKRGSEEVLAEITEQVRGLD---GLQPGLAVILVGADPASQVYVGAKGKAAKACGFH 79

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SVQ++ P + ++ ++   +  LN D  IHGIL+QLPLP+      II+SI PEKDVDGLH
Sbjct: 80  SVQHDLPAESTEAEILAVIQKLNADPKIHGILLQLPLPNGADATRIIESIAPEKDVDGLH 139

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGC---DLSGQHAVVIGRSNLFGKPMGQL 180
            +N+G + IGD    L+PCTPAG+++L+++        L G  AVV+GRSNL GKP+ QL
Sbjct: 140 PINSGLLAIGDIERALIPCTPAGSMILLQKAAAALNFKLQGAEAVVVGRSNLVGKPIAQL 199

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI--- 237
           LL++NATVT+AHS+T++LP + R AD+L+ AVGRP M++ DWIK G++VIDVGINR+   
Sbjct: 200 LLAQNATVTIAHSRTRDLPAVVRRADVLIAAVGRPEMIKGDWIKPGAIVIDVGINRVPAT 259

Query: 238 NSPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
           +     KT LVGDVA  E      AITPVPGGVGPMTIAMLM+NT+ AA R  G KS
Sbjct: 260 DPAAKSKTRLVGDVAFAESLDTAAAITPVPGGVGPMTIAMLMSNTLKAALRISGRKS 316


>gi|227819895|ref|YP_002823866.1| methylenetetrahydrofolate dehydrogenase [Sinorhizobium fredii
           NGR234]
 gi|227338894|gb|ACP23113.1| putative methylenetetrahydrofolate dehydrogenase [Sinorhizobium
           fredii NGR234]
          Length = 319

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/303 (53%), Positives = 208/303 (68%), Gaps = 5/303 (1%)

Query: 4   LIDGKVVASVLTDKI-AESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           LI G+ VA  + D++ A +VA      G+  GLAV++VG+DPAS  YV++K R A+ CGF
Sbjct: 19  LISGREVAESIIDQVKAHTVAL--SANGITPGLAVIIVGSDPASQVYVASKGRKAEECGF 76

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+++  P D+ +  L   + SLN D SIHGILVQLPLP  V    +IQ+I P+KD+DG 
Sbjct: 77  LSIKHELPHDVPERRLLELIDSLNADPSIHGILVQLPLPRHVDSGKVIQAISPQKDIDGF 136

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+  G   T  VPCTPAG ++L+E+  G DLSG  AVV+GRSN+ GKPM  LLL
Sbjct: 137 HFINVGKLGTGALETAFVPCTPAGCMILVERIHGKDLSGLSAVVVGRSNIVGKPMANLLL 196

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS-PQ 241
           + NATVT+AHS+T NL  +CR ADIL+ AVGRP M++ DWIK G+ VIDVGINRI S   
Sbjct: 197 AANATVTIAHSRTANLEVLCRQADILIAAVGRPEMIRSDWIKPGATVIDVGINRIASRDD 256

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS 300
            GKT LVGDV  D      GA+TPVPGGVGPMTIAMLMANT+ AA  +    +P F +  
Sbjct: 257 GGKTRLVGDVDFDGAVERAGAVTPVPGGVGPMTIAMLMANTLRAACHANDEPAPHFGSGG 316

Query: 301 IAK 303
           + +
Sbjct: 317 VLR 319


>gi|75440426|sp|Q6W210|FOLD_RHISN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|36958740|gb|AAQ87208.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium
           fredii NGR234]
          Length = 307

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/303 (53%), Positives = 208/303 (68%), Gaps = 5/303 (1%)

Query: 4   LIDGKVVASVLTDKI-AESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           LI G+ VA  + D++ A +VA      G+  GLAV++VG+DPAS  YV++K R A+ CGF
Sbjct: 7   LISGREVAESIIDQVKAHTVAL--SANGITPGLAVIIVGSDPASQVYVASKGRKAEECGF 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+++  P D+ +  L   + SLN D SIHGILVQLPLP  V    +IQ+I P+KD+DG 
Sbjct: 65  LSIKHELPHDVPERRLLELIDSLNADPSIHGILVQLPLPRHVDSGKVIQAISPQKDIDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+  G   T  VPCTPAG ++L+E+  G DLSG  AVV+GRSN+ GKPM  LLL
Sbjct: 125 HFINVGKLGTGALETAFVPCTPAGCMILVERIHGKDLSGLSAVVVGRSNIVGKPMANLLL 184

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS-PQ 241
           + NATVT+AHS+T NL  +CR ADIL+ AVGRP M++ DWIK G+ VIDVGINRI S   
Sbjct: 185 AANATVTIAHSRTANLEVLCRQADILIAAVGRPEMIRSDWIKPGATVIDVGINRIASRDD 244

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS 300
            GKT LVGDV  D      GA+TPVPGGVGPMTIAMLMANT+ AA  +    +P F +  
Sbjct: 245 GGKTRLVGDVDFDGAVERAGAVTPVPGGVGPMTIAMLMANTLRAACHANDEPAPHFGSGG 304

Query: 301 IAK 303
           + +
Sbjct: 305 VLR 307


>gi|163733529|ref|ZP_02140972.1| FolD bifunctional protein [Roseobacter litoralis Och 149]
 gi|161393317|gb|EDQ17643.1| FolD bifunctional protein [Roseobacter litoralis Och 149]
          Length = 300

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 162/296 (54%), Positives = 205/296 (69%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK  A+ +  ++AE V  LK + G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TLIDGKAFAARVRAQVAEHVTRLKADHGITPGLAVVLVGEDPASQVYVRSKGKQTTEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++   VD S+ DL   V  LNKD  IHGILVQLPLP  + E  +I SI PEKDVDG 
Sbjct: 64  KSVEHKLDVDTSEADLLAIVDQLNKDPEIHGILVQLPLPKHLDEDLVINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVV+GRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLSGMDAVVVGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TK+L ++ R ADI+V AVGRP MV  DWIK G+ VIDVGINR+++P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLADVVRRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRLDAPEK 240

Query: 242 -LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  D C +V GAITPVPGGVGPMTIA L+ANTV A  R+ G++ P+
Sbjct: 241 GEGKTRLVGDVDFDSCAAVAGAITPVPGGVGPMTIACLLANTVTACCRANGLEEPE 296


>gi|319406721|emb|CBI80354.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella sp.
           1-1C]
          Length = 299

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 151/299 (50%), Positives = 212/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L     +Q G+AV++VG+DPAS  YVS+K++ A+ C
Sbjct: 1   MDNIIDGKKLAEDILVKVKNETKKLYNNYKIQPGIAVIIVGDDPASQIYVSSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SV++  P +  + +L   + +LN D  IHGILVQLPLP+ ++  +I Q+I  EKDVD
Sbjct: 61  GFLSVKHVMPKETKEKELLQLIETLNSDPKIHGILVQLPLPTHINTNNITQTIAVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+    F   ++PCTPAG +++I+Q  G DLSG  AV++GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLAANVFEDTIIPCTPAGILMMIQQKCGKDLSGLDAVIVGRSNIVGKPMASL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L E+CR+ADILVVAVGRPR+++ +WIK G+++IDVGINRI + 
Sbjct: 181 LTAVNATVTIAHSRTRDLDEVCRSADILVVAVGRPRLIKKEWIKKGAVIIDVGINRIKTS 240

Query: 241 QLG--KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +    K  +VGDV  +E + +  AITPVPGGVGPMTIAMLM NT+ AA R+  +  P+F
Sbjct: 241 EKNTMKPYIVGDVDFEEVREIATAITPVPGGVGPMTIAMLMVNTLKAANRAHKLPVPEF 299


>gi|319403713|emb|CBI77298.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 299

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 151/299 (50%), Positives = 212/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L     +Q G+AV++VG+DPAS  YVS+K++ A+ C
Sbjct: 1   MDNIIDGKKLAEDILVKVKNETEKLYNNYKIQPGIAVIIVGDDPASQIYVSSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SV++  P +  + +L   + +LN D  IHGILVQLPLP+ ++  +I Q+I  EKDVD
Sbjct: 61  GFLSVKHVMPKETKEKELLQLIETLNSDPKIHGILVQLPLPTHINTNNITQTIAVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+    F   +VPCTPAG +++I+Q  G DLSG  AV++GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLAANIFEDTIVPCTPAGILMMIQQKCGKDLSGLDAVIVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L E+CR+ADILVVAVGRPR+++ +W+K G+++IDVGINRI + 
Sbjct: 181 LTAVNATVTIAHSRTRDLDEVCRSADILVVAVGRPRLIKKEWVKKGAVIIDVGINRIETS 240

Query: 241 QLG--KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +    K  +VGDV  +E + +  AITPVPGGVGPMTIAMLM NT+ AA R+  +  P+F
Sbjct: 241 EKNTMKPYIVGDVDFEEVREIATAITPVPGGVGPMTIAMLMVNTLKAAARAHKLPVPEF 299


>gi|110679383|ref|YP_682390.1| FolD bifunctional protein [Roseobacter denitrificans OCh 114]
 gi|119369593|sp|Q167Y9|FOLD1_ROSDO RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|109455499|gb|ABG31704.1| FolD bifunctional protein [Roseobacter denitrificans OCh 114]
          Length = 300

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 203/296 (68%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK  A+ +  ++AE V  LK + G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TLIDGKAFAARVRAQVAEHVTRLKADHGITPGLAVVLVGQDPASQVYVRSKGKQTTEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++    D S+ DL   V  LNKD  IHGILVQLPLP  + E  +I SI PEKDVDG 
Sbjct: 64  KSVEHKLDADTSETDLLAVVDQLNKDPDIHGILVQLPLPGHLDEDLVINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  L G  AVV+GRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLLGMDAVVVGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TK+L ++ R ADI+V AVGRP MV  DWIK G+ VIDVGINR+++P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLADVVRRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRLDAPEK 240

Query: 242 -LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  D C +V GAITPVPGGVGPMTIA L+ANTV A  R+ G++ P+
Sbjct: 241 GEGKTRLVGDVDFDSCAAVAGAITPVPGGVGPMTIACLLANTVTACCRANGLEEPE 296


>gi|182677798|ref|YP_001831944.1| methenyltetrahydrofolate cyclohydrolase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633681|gb|ACB94455.1| Methenyltetrahydrofolate cyclohydrolase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 320

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 206/297 (69%), Gaps = 10/297 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  +  +   IAE    L    G++ GLAV+LVG DPAS  YV +K   A  CGFH
Sbjct: 25  LIDGKRASERMLASIAEKAQILIN-GGIKPGLAVILVGEDPASQVYVKSKGHTAVACGFH 83

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SVQ++ PV  ++ ++ + +  LN D +IHGIL+QLPLP       II+SI P KDVDGLH
Sbjct: 84  SVQHDLPVSTTEEEILDLIARLNADPTIHGILMQLPLPGGADPTRIIESIAPSKDVDGLH 143

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFK---GCDLSGQHAVVIGRSNLFGKPMGQL 180
            +NAG + +G+F   L+PCTPAG + L++Q     G DL+G  AVV+GRSNL GKP+ QL
Sbjct: 144 PLNAGLLAVGNFHRALIPCTPAGCVHLLDQTAAELGVDLAGAEAVVVGRSNLVGKPIAQL 203

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+RNATVT+AHSK+++LP I   AD+LV AVGRP M++ +WIK G++V+DVGINR+ + 
Sbjct: 204 LLARNATVTLAHSKSRDLPAIISRADLLVAAVGRPEMIRGNWIKPGAIVLDVGINRLPAE 263

Query: 241 QLG-----KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            L      K+ LVGDVA +E  +   AITPVPGGVGPMTIAMLMANT+ AA    G+
Sbjct: 264 GLTASGKPKSRLVGDVAREEALTRAAAITPVPGGVGPMTIAMLMANTLRAAEAYAGL 320


>gi|121601732|ref|YP_988619.1| folD bifunctional protein [Bartonella bacilliformis KC583]
 gi|158705714|sp|A1URL6|FOLD_BARBK RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|120613909|gb|ABM44510.1| folD bifunctional protein [Bartonella bacilliformis KC583]
          Length = 299

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 157/299 (52%), Positives = 212/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      LK    +Q G+AV++VG+DPAS  YV++K++ A+ C
Sbjct: 1   MDNIIDGKKLAENVIAKVKNETEKLKNSHNIQPGIAVIIVGDDPASQVYVASKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++  P ++ + +L   +  LN D  IHGILVQLPLP+ ++     Q+I  EKDVD
Sbjct: 61  GFFSMKHVLPKEVEESELLQLIEILNSDPKIHGILVQLPLPAHINTDRATQAIAVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+        ++PCTPAGA+++IEQ  G DLSG +AV++GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLAANAIKDAIIPCTPAGAMMMIEQQCGQDLSGLNAVIVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L EICR ADIL+ AVGRP+M++  W+K G++VIDVGINRI +P
Sbjct: 181 LTAANATVTLAHSRTRDLDEICRRADILIAAVGRPQMIKKHWVKKGAIVIDVGINRIAAP 240

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGDV  +E K    AITPVPGGVGPMTIAMLM NT+ AA RSL +  PKF
Sbjct: 241 EKGPGKTRLVGDVDFEEVKGKTLAITPVPGGVGPMTIAMLMVNTLKAAARSLKLPVPKF 299


>gi|83950080|ref|ZP_00958813.1| folD bifunctional protein [Roseovarius nubinhibens ISM]
 gi|83837979|gb|EAP77275.1| folD bifunctional protein [Roseovarius nubinhibens ISM]
          Length = 296

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 202/293 (68%), Gaps = 6/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +K+A  VA LK+E G+  GLAVVLVG DPAS  YV +K +     G +
Sbjct: 5   IIDGKAFAATIREKVAGHVARLKEEHGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++    D S+ DL   + +LNKDDS+HGILVQLPLP  + E  +I SI PEKDVDG H
Sbjct: 65  SFEHKLDADTSEADLLALIDTLNKDDSVHGILVQLPLPKHLDEDLVINSISPEKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G+++++    G  LSG +AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGSLMMLRDHHGS-LSGMNAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+TK+L E+ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + G
Sbjct: 182 DSCTVTIAHSRTKDLAEVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIE--RDG 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           K VLVGDV     K V GAITPVPGGVGPMTIA L+ANTV A  RS  +  P+
Sbjct: 240 KNVLVGDVDFASAKEVAGAITPVPGGVGPMTIACLLANTVTACCRSNDLSEPE 292


>gi|126728394|ref|ZP_01744210.1| folD bifunctional protein [Sagittula stellata E-37]
 gi|126711359|gb|EBA10409.1| folD bifunctional protein [Sagittula stellata E-37]
          Length = 300

 Score =  301 bits (770), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 199/296 (67%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK  A+ +  K+AE VA LK + G+  GLAVVLVG DPAS  YV +K +M    G 
Sbjct: 4   TLIDGKAFAATVRGKVAEHVARLKNDHGITPGLAVVLVGEDPASQVYVRSKGKMTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HS +Y       + DL   +  LN D  +HGILVQLPLP  + E  +I SI P KDVDG 
Sbjct: 64  HSYEYKLDAATEEADLLALIDKLNNDPEVHGILVQLPLPKHLDEDLVINSIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHG-SLSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LP++ + ADI+V AVGRP MV  DWIK G+ VIDVGINRI++P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLPDVVKRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRIDAPEK 240

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGD   D C  V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 GEGKTRLVGDCHFDSCAEVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|167645678|ref|YP_001683341.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Caulobacter sp. K31]
 gi|190359425|sp|B0T3F7|FOLD_CAUSK RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|167348108|gb|ABZ70843.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Caulobacter sp.
           K31]
          Length = 298

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 203/294 (69%), Gaps = 9/294 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ L +++A  VA LK E G+  GLAVVLVG DPAS  YV  K       G H
Sbjct: 6   IIDGKAFAARLREQVAAEVAVLKAEHGLTPGLAVVLVGEDPASQVYVRNKGEQTLAAGMH 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P + SQ +L + V  LN D +IHG+LVQ P+P  +S+ +I+ +I P+KDVDGL 
Sbjct: 66  SETHRLPANASQAELLSLVDRLNDDPAIHGVLVQFPVPDHLSQAAIVAAISPDKDVDGLT 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++  G     L  CTPAG ++L+    G DL+G+ AVVIGRSNL GKPM QLLL+
Sbjct: 126 VVNAGRLASG--LPALTSCTPAGCMVLLRDVVG-DLTGKRAVVIGRSNLMGKPMAQLLLA 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS---- 239
            + TVT+AHS++++LP ICR ADILV AVGR  MV+ DWIK G+ VIDVGI+R  S    
Sbjct: 183 ADCTVTIAHSRSRDLPAICREADILVAAVGRAEMVRGDWIKPGATVIDVGISRFPSRDPV 242

Query: 240 -PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
               GKT LVGDVA DE K V GAITPVPGGVGPMTIAML+ANTV AA R  G+
Sbjct: 243 AAAAGKTRLVGDVAFDEAKEVAGAITPVPGGVGPMTIAMLLANTVSAAKRLNGI 296


>gi|49475193|ref|YP_033234.1| methylenetetrahydrofolate dehydrogenase [Bartonella henselae str.
           Houston-1]
 gi|81648147|sp|Q6G4F1|FOLD_BARHE RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|49237998|emb|CAF27203.1| Methylenetetrahydrofolate dehydrogenase [Bartonella henselae str.
           Houston-1]
          Length = 299

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 212/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L+    +Q G+AV++VGNDPAS  YV++K++ A+ C
Sbjct: 1   MNNIIDGKKLAEKIIMKVKAETTKLRNNYKIQPGIAVIIVGNDPASQVYVTSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++    +  + +L + + +LN D  IHGILVQLPLP  ++   I Q+I  +KDVD
Sbjct: 61  GFFSIKHMISKETQEKELLHLIATLNSDPQIHGILVQLPLPDHINTNRITQAIAFQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+        ++PCTPAGA+++IEQ  G DLSG  AVV+GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLAANALEDAIIPCTPAGAMMMIEQQCGQDLSGLDAVVVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L ++CR+ADILV A+GRP+M++ DW+K G+++IDVGINRI +P
Sbjct: 181 LTAANATVTIAHSRTRDLDDVCRSADILVTAIGRPQMIKKDWVKNGAIIIDVGINRIAAP 240

Query: 241 Q--LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +  +GKT LVGDV  +E K    AITPVPGGVGPMTIAMLM NT+ AA R   +  PKF
Sbjct: 241 EKGVGKTRLVGDVDFEEIKEKAAAITPVPGGVGPMTIAMLMVNTLKAAARLHNLPIPKF 299


>gi|85710124|ref|ZP_01041189.1| Probable tetrahydrofolate dehydrogenase/cyclohydrolase
           [Erythrobacter sp. NAP1]
 gi|85688834|gb|EAQ28838.1| Probable tetrahydrofolate dehydrogenase/cyclohydrolase
           [Erythrobacter sp. NAP1]
          Length = 297

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 201/294 (68%), Gaps = 7/294 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ L +++ E      +  G + GLAVVLVG+DPAS  YV +K +        S
Sbjct: 6   IDGKAFAARLRERVGERALEFAEAAGRKPGLAVVLVGDDPASQVYVGSKGKATVAANMLS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            +Y  P D S+  L   V  LN DD + GILVQLPLP  + EQSII  I P+KDVDG HV
Sbjct: 66  FEYRLPADASEEQLMKLVDDLNNDDRVDGILVQLPLPDHLDEQSIIAEISPDKDVDGFHV 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           +NAG++ +G   +G VPCTP G ++L+    G DLSG  AVVIGRSN+ GKPM QLLL  
Sbjct: 126 INAGRLSVG--QSGFVPCTPLGCMMLLTDRLG-DLSGLEAVVIGRSNIVGKPMAQLLLDA 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           NATVT+AHS+TK+L  + + ADI+V AVGRP+M+  DW+K G+ VIDVGINR+  P+ GK
Sbjct: 183 NATVTIAHSRTKDLASVVKRADIVVAAVGRPQMITKDWLKDGATVIDVGINRL-PPEPGK 241

Query: 245 T--VLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
               LVGDVA DE   V  AITPVPGGVGPMTIA+L+ NT +AAYR+ G++ P+
Sbjct: 242 EKGKLVGDVAYDEASEVASAITPVPGGVGPMTIAVLLRNTAVAAYRNAGLEVPE 295


>gi|260430288|ref|ZP_05784262.1| bifunctional protein FolD 2 [Citreicella sp. SE45]
 gi|260418760|gb|EEX12016.1| bifunctional protein FolD 2 [Citreicella sp. SE45]
          Length = 300

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 159/296 (53%), Positives = 202/296 (68%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGKV A+ + +++A  VA LK + G+  GLAVVLVG DPAS  YV  K R     G 
Sbjct: 4   TIIDGKVFAATVREQVAAHVARLKADHGITPGLAVVLVGEDPASQVYVRNKGRQTVEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P + S+ DL   V  LN D ++HGILVQLPLP  ++  ++I +I P KDVDG 
Sbjct: 64  QSFEHKLPAETSEADLLALVERLNADPAVHGILVQLPLPDHMNSDAVINAISPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDQLG-SLSGLDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TKNL E+ R ADI+V AVGRP+MV  DWIK G+ VIDVGINRI++P+ 
Sbjct: 181 GESCTVTIAHSRTKNLAEVVRRADIVVAAVGRPQMVPGDWIKPGATVIDVGINRIDAPEK 240

Query: 242 -LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGD   D C  V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 GEGKTRLVGDCDYDSCAEVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|254475250|ref|ZP_05088636.1| bifunctional protein FolD [Ruegeria sp. R11]
 gi|214029493|gb|EEB70328.1| bifunctional protein FolD [Ruegeria sp. R11]
          Length = 296

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 160/294 (54%), Positives = 201/294 (68%), Gaps = 6/294 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +K+A  VA LK+E  +  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   NIIDGKAFAATVREKVAGHVARLKEEHDITPGLAVVLVGEDPASQVYVRSKGKQTVEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ DL   V  LNKD ++HGILVQLPLP  ++E  II SI PEKDVDG 
Sbjct: 64  NSFEHKLDADTSEADLLAVVDQLNKDPAVHGILVQLPLPGHLNEDLIINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LP++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + 
Sbjct: 181 GDSCTVTIAHSRTKDLPDVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIE--RD 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK VLVGDV    C    GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 239 GKNVLVGDVDFASCAERAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 292


>gi|298290474|ref|YP_003692413.1| methenyltetrahydrofolate cyclohydrolase [Starkeya novella DSM 506]
 gi|296926985|gb|ADH87794.1| Methenyltetrahydrofolate cyclohydrolase [Starkeya novella DSM 506]
          Length = 290

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 198/288 (68%), Gaps = 5/288 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A  L  ++A  V      TGV  GLAVVLVG DPAS  YV  K +     G  
Sbjct: 6   IIDGKAFAEKLRKRVASEVTAFHAATGVTPGLAVVLVGEDPASSVYVRNKGKQTVEAGMA 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   +Q +L   + +LN +  +HGILVQLPLP  +  Q+++ +I P KDVDG H
Sbjct: 66  SIEHKLPASTTQAELLALIATLNTEKEVHGILVQLPLPGHIDAQAVLSTIDPAKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ +G     LVPCTP G ++L++   G  L+G  AVV+GRSN+ GKP+ QLLL 
Sbjct: 126 VVNAGRLAVG--IDALVPCTPLGCVMLLKDALG-SLAGLEAVVVGRSNIVGKPLAQLLLR 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+T++LPE+CR ADIL+ AVGRP M++ DWIK G+ VIDVGINRI  P  G
Sbjct: 183 EDCTVTIAHSRTRDLPEVCRRADILIGAVGRPEMIRGDWIKPGATVIDVGINRITGPN-G 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  LVGDVA +E + + GAITPVPGGVGPMTIA L+ANT+ AA R +G
Sbjct: 242 KHRLVGDVAFEEAQGIAGAITPVPGGVGPMTIACLLANTLTAAKRQVG 289


>gi|99082196|ref|YP_614350.1| methenyltetrahydrofolate cyclohydrolase [Ruegeria sp. TM1040]
 gi|119370048|sp|Q1GE28|FOLD_SILST RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|99038476|gb|ABF65088.1| Methenyltetrahydrofolate cyclohydrolase [Ruegeria sp. TM1040]
          Length = 300

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 200/296 (67%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK  A+ +  ++ E V  LK+E G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   EIIDGKAFAAKVRGQVTEHVTRLKEEHGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ DL   +  LNKD  +HGILVQLPLP  + E  +I SI PEKDVDG 
Sbjct: 64  NSYEHKLDADTSEADLLALIDQLNKDSEVHGILVQLPLPKHLDEDLVINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLSGLDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TK+LPE+ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI++P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLPEVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIDAPEK 240

Query: 242 -LGKTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  E  +   GAITPVPGGVGPMTIA L+ANTV A  R+  +  P+
Sbjct: 241 GEGKTRLVGDVHYESAAARAGAITPVPGGVGPMTIACLLANTVTACCRANNLSEPE 296


>gi|110681351|ref|YP_684358.1| FolD bifunctional protein [Roseobacter denitrificans OCh 114]
 gi|119369608|sp|Q160C1|FOLD2_ROSDO RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|109457467|gb|ABG33672.1| FolD bifunctional protein [Roseobacter denitrificans OCh 114]
          Length = 300

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 204/295 (69%), Gaps = 6/295 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++AE V  +K++ G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TIIDGKAFAAKVRAQVAEHVTRIKQDHGITPGLAVVLVGEDPASQVYVRSKGKQTVEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ DL   V  LNKD ++HGILVQLPLP  + E  II SI P KDVDG 
Sbjct: 64  NSYEHKLDADTSEADLLAVVDKLNKDPNVHGILVQLPLPKHLDEDLIINSIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++ +  G  LSG +AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLREHHG-SLSGMNAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + + TVT+AHS+TK+LP++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI++P+ 
Sbjct: 181 NDSCTVTIAHSRTKDLPDVVRGADIVVAAVGRPEMVPGDWIKPGATVIDVGINRIDAPEK 240

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
             GKT LVGD   D C    GAITPVPGGVGPMTIA L+ANTV +  R+ G++ P
Sbjct: 241 GEGKTRLVGDCHYDSCAETAGAITPVPGGVGPMTIACLLANTVTSCCRANGLEEP 295


>gi|87201312|ref|YP_498569.1| methenyltetrahydrofolate cyclohydrolase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|119370014|sp|Q2G338|FOLD_NOVAD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|87136993|gb|ABD27735.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 297

 Score =  298 bits (762), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 153/290 (52%), Positives = 199/290 (68%), Gaps = 4/290 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ L  ++ +     +   G + GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   AVIDGKAFAATLRGRVGDLATAFEARAGRKAGLAVVLVGEDPASQVYVRSKGKSTLEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D ++ DL   V  LN D ++ GILVQLPLP  + EQ +I +I P+KDVDG 
Sbjct: 64  ASFEHKLPADTAEADLLAVVEQLNADPAVDGILVQLPLPRHMDEQKVIAAINPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV+NAG++ +G    G VPCTP G ++L++   G DLSG  AVVIGRSN+ GKPM QLL+
Sbjct: 124 HVINAGRLAVG--QPGFVPCTPLGCLMLLKDRLG-DLSGLDAVVIGRSNIVGKPMAQLLI 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + + TVT+AHS+TKNLPE+ R ADI+V AVGRP MV+ DWIK G+ VIDVGINR+   + 
Sbjct: 181 AESCTVTVAHSRTKNLPEVVRRADIVVAAVGRPEMVKGDWIKPGATVIDVGINRVPGKEE 240

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           GKT LVGDV       V  AITPVPGGVGPMTIA+L+ N ++AAYR+ G+
Sbjct: 241 GKTRLVGDVDYASAAEVASAITPVPGGVGPMTIAVLLRNALVAAYRNAGI 290


>gi|326385767|ref|ZP_08207396.1| methenyltetrahydrofolate cyclohydrolase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209746|gb|EGD60534.1| methenyltetrahydrofolate cyclohydrolase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 305

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 155/292 (53%), Positives = 204/292 (69%), Gaps = 4/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ L  +IA      +   G + GLAVVLVG DPAS  YV +K +     G  
Sbjct: 13  LIDGKAFAAGLRGRIATLAGEFEARAGRKAGLAVVLVGMDPASQVYVRSKGKATVEAGMA 72

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++    D S+ DL   + +LN D ++ GILVQLPLP+ + EQ +I +I P+KDVDG H
Sbjct: 73  SFEHKLEADTSEADLLALIETLNADPAVDGILVQLPLPAHLDEQKVIATISPDKDVDGFH 132

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V+NAG++ +G    G VPCTP G ++L++   G +LSG  AVVIGRSN+ GKPM QLLL+
Sbjct: 133 VINAGRLSVGQ--PGFVPCTPLGCLMLLKDRLG-NLSGLDAVVIGRSNIVGKPMAQLLLA 189

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+T+NLPE+ R ADI+V AVGRP +V+ DWIK G+ VIDVGINR+++ + G
Sbjct: 190 ESCTVTVAHSRTRNLPEVVRRADIVVAAVGRPELVKGDWIKPGATVIDVGINRVDAAEPG 249

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           KT LVGDV     K+V GAITPVPGGVGPMTIA+L+ N ++AAY + G+  P
Sbjct: 250 KTRLVGDVDFAGAKAVAGAITPVPGGVGPMTIAVLLRNALVAAYANAGIDLP 301


>gi|163742226|ref|ZP_02149614.1| folD bifunctional protein [Phaeobacter gallaeciensis 2.10]
 gi|161384556|gb|EDQ08937.1| folD bifunctional protein [Phaeobacter gallaeciensis 2.10]
          Length = 300

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 202/296 (68%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +K+A  VA LK+E  +  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   NIIDGKAFAATVREKVAGHVARLKEEHDIIPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ DL   V +LN D S+HGILVQLPLP  ++E  II SI PEKDVDG 
Sbjct: 64  NSFEHKMDADTSEADLLAVVDTLNNDPSVHGILVQLPLPGHLNEDLIINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TK+LP++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI +P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLPDVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIPAPEK 240

Query: 242 -LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GK  LVGDV    C    GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 GEGKMKLVGDVDYASCAERAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|94496542|ref|ZP_01303118.1| Methenyltetrahydrofolate cyclohydrolase [Sphingomonas sp. SKA58]
 gi|94423902|gb|EAT08927.1| Methenyltetrahydrofolate cyclohydrolase [Sphingomonas sp. SKA58]
          Length = 298

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 156/296 (52%), Positives = 207/296 (69%), Gaps = 5/296 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +G +IDGK  A+ L ++IA++V    ++ G + GLAVVLVG DPAS  YV +K +M    
Sbjct: 3   IGKIIDGKAFAASLRERIAQAVPVFVEQAGRKPGLAVVLVGEDPASSVYVRSKGKMTVAV 62

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S ++  P  I Q DL + +  LN+D+ + GILVQLPLP  + E ++I +I P KDVD
Sbjct: 63  GMDSFEFKRPATIGQDDLLDLIEELNQDERVDGILVQLPLPDHIDEAAVIAAIDPAKDVD 122

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G HVVNAG++  G     LVPCTP G I+L++   G DLSG+ AVVIGRSN+ GKPM QL
Sbjct: 123 GFHVVNAGRLATG--QEALVPCTPMGCIMLLKDELG-DLSGKEAVVIGRSNIVGKPMAQL 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI-NS 239
           LL+ NATVT+AHS+T +L  +   ADI+V AVGRP M++ +WIK G+ VIDVGINR+ + 
Sbjct: 180 LLAENATVTIAHSRTHDLASVVHRADIVVAAVGRPEMIKGEWIKPGATVIDVGINRVPDD 239

Query: 240 PQLGKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
              GK+ +VGDVA  E  + VGAITPVPGGVGPMTIA+L+ NT++AA+   G+  P
Sbjct: 240 EDTGKSRIVGDVATAEALAHVGAITPVPGGVGPMTIAVLLRNTLVAAHARAGLAKP 295


>gi|209966141|ref|YP_002299056.1| FolD bifunctional protein [Rhodospirillum centenum SW]
 gi|226704392|sp|B6IVC0|FOLD_RHOCS RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|209959607|gb|ACJ00244.1| FolD bifunctional protein [Rhodospirillum centenum SW]
          Length = 304

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 202/297 (68%), Gaps = 9/297 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ L  +I  +V  L+    +  GLAVVLVG +PAS  YV  K    +  G H
Sbjct: 6   IIDGKAFAADLRGRIGAAVEHLRTAYALVPGLAVVLVGENPASQLYVKNKGEQTREAGMH 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV +  PVD +Q  L   +  LN D SIHGILVQLPLP  +   +++ +I P+KDVDG H
Sbjct: 66  SVTHRLPVDTTQEQLLRLIGQLNADPSIHGILVQLPLPPQIDPAAVLAAIDPDKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ +G    GLVPCTP G ++L++   G DL G +AVV+GRSN+ GKPM  LLL 
Sbjct: 126 VVNAGRLAVG--LPGLVPCTPLGCLMLLKDVVG-DLRGLNAVVVGRSNIVGKPMANLLLQ 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
            NATVT+AHS T +LPE+CR ADIL+ AVGRP M++  WIK G++VIDVGINR+ +    
Sbjct: 183 ANATVTVAHSHTVDLPEVCRGADILIAAVGRPEMIRGSWIKEGAIVIDVGINRVPARDPA 242

Query: 242 ---LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
               GKT +VGDVA +E K + GAITPVPGGVGPMTIA L+ NT+ AA RS G+  P
Sbjct: 243 AAAAGKTRVVGDVAFEEAKGIAGAITPVPGGVGPMTIACLLLNTLTAACRSKGITPP 299


>gi|302383392|ref|YP_003819215.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194020|gb|ADL01592.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 307

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 163/303 (53%), Positives = 204/303 (67%), Gaps = 13/303 (4%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ L D+I  + A L  + G+  GLAVV+VG DPAS  YV  K       G  
Sbjct: 10  IIDGKAFAASLVDRITTATAALIADHGITPGLAVVIVGEDPASQIYVRNKGETTARAGMR 69

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +      SQ +L   V +LN D  IHGILVQLPLPS +   +++ +I P+KDVDG H
Sbjct: 70  SETHRLTDTTSQDELLALVQTLNDDPGIHGILVQLPLPSQIDSSAVLGAIDPDKDVDGFH 129

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ +G    GLVPCTP G+ LL++   G DLSG HAV++GRSN+ GKPM QLLL+
Sbjct: 130 VVNAGRLAVG--LPGLVPCTPLGSTLLLKDRLG-DLSGLHAVIVGRSNIVGKPMAQLLLA 186

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            N TVT+AHS++++LP +CRTADILV AVGRP  ++ DWIK G+ VIDVGINR+  P L 
Sbjct: 187 ENCTVTVAHSRSRDLPALCRTADILVAAVGRPETIRGDWIKPGATVIDVGINRV--PALD 244

Query: 243 ------GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
                 GKT +VGDVA  E   V GAITPVPGGVGPMTIA L+ANT +AA R+ G+    
Sbjct: 245 PARAAEGKTRVVGDVAFAEALDVAGAITPVPGGVGPMTIASLLANTYVAACRAHGIVRSA 304

Query: 296 FDA 298
            DA
Sbjct: 305 LDA 307


>gi|114765722|ref|ZP_01444820.1| folD bifunctional protein [Pelagibaca bermudensis HTCC2601]
 gi|114541939|gb|EAU44974.1| folD bifunctional protein [Roseovarius sp. HTCC2601]
          Length = 300

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/295 (53%), Positives = 200/295 (67%), Gaps = 6/295 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +++A  VA LK E G+  GLAVVLVG DPAS  YV  K +    CG  
Sbjct: 5   IIDGKAFAATVREQVAAHVARLKDEHGITPGLAVVLVGEDPASQVYVRNKGKQTVECGMQ 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++     +S+ +L   V  LN D ++HGILVQLPLP  ++  ++I +I P KDVDG H
Sbjct: 65  SFEHKLDASVSEAELLALVEKLNADPAVHGILVQLPLPDHMNSDAVINAIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDQLG-SLSGLDAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TK+LPE+ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI +P+  
Sbjct: 182 ESCTVTIAHSRTKDLPEVVRRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRIPAPEKG 241

Query: 243 -GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            GKT LVGD A E C  V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 242 EGKTRLVGDCAYESCAEVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|319408119|emb|CBI81772.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella
           schoenbuchensis R1]
          Length = 299

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 213/299 (71%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  + +K+ +    L     +Q G+AV++VG+DPAS  YV++K++ A+ C
Sbjct: 1   MDNIIDGKKLAENIINKVKKETKKLHNNHKIQPGIAVIIVGDDPASQVYVTSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++  P D  + +L   + +LN D  IHGILVQLPLP+ ++   I Q+I  +KDVD
Sbjct: 61  GFLSIKHTIPQDTKEEELLQLIETLNSDPKIHGILVQLPLPAHINTNKITQAIAVQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+        ++PCTPAG +++IEQ  G DLSG  AV++GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLAANILEDTIIPCTPAGVMMIIEQQCGRDLSGLDAVIVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L++ NATVT+AHS+T++L E+CR+ADILVVAVGRP +++ DW+K G++VIDVGINRI + 
Sbjct: 181 LMAANATVTIAHSRTRDLDEVCRSADILVVAVGRPHIIKKDWVKQGAIVIDVGINRIEAS 240

Query: 241 QLG--KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           + G  KT LVGDV  +E K    AITPVPGGVGPMTIAMLM NT+ AA ++  +  PKF
Sbjct: 241 EKGTNKTRLVGDVDFEEVKEKAAAITPVPGGVGPMTIAMLMVNTLKAAAQAHKLPIPKF 299


>gi|119387627|ref|YP_918661.1| methenyltetrahydrofolate cyclohydrolase [Paracoccus denitrificans
           PD1222]
 gi|190359410|sp|A1BBS1|FOLD2_PARDP RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119378202|gb|ABL72965.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Paracoccus
           denitrificans PD1222]
          Length = 302

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 156/296 (52%), Positives = 205/296 (69%), Gaps = 6/296 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G++IDGK  AS +  ++A +VA L+   GV  GLAVVLVG DPAS  YV  K    +  G
Sbjct: 7   GTIIDGKAFASGVRGRVASAVAGLEAAHGVVPGLAVVLVGEDPASQVYVRNKGIQTREAG 66

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S ++  P + +Q +L   +  LN D ++HGILVQLPLP  +  +++I +I P+KDVDG
Sbjct: 67  MASFEHKLPAETAQAELMALIERLNADPAVHGILVQLPLPRHMDAEAVINAIDPKKDVDG 126

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            HV+N G  ++G     +VPCTP G ++L+    G DLSG +AVV+GRSN+ GKPM QLL
Sbjct: 127 FHVLNVG--LLGTGQKAMVPCTPLGCLMLLRDTLG-DLSGLNAVVVGRSNIVGKPMAQLL 183

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L+ + TVT+AHS+T++L  +CRTADILV AVGRPRM++ DWIK G+ VIDVGINRI   +
Sbjct: 184 LNESCTVTIAHSRTRDLAGLCRTADILVAAVGRPRMIRGDWIKPGATVIDVGINRIE--E 241

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
            G++ LVGDV  D    V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P F
Sbjct: 242 AGRSRLVGDVDFDSAAPVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPDF 297


>gi|260428837|ref|ZP_05782814.1| bifunctional protein FolD 2 [Citreicella sp. SE45]
 gi|260419460|gb|EEX12713.1| bifunctional protein FolD 2 [Citreicella sp. SE45]
          Length = 300

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/295 (53%), Positives = 199/295 (67%), Gaps = 6/295 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A  + +K+A  VA LK + G+  GLAVVLVG DPAS  YV  K R     G  
Sbjct: 5   IIDGKAFAEQVREKVAAHVARLKVDHGITPGLAVVLVGEDPASQVYVRNKGRQTLEAGMQ 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P + S+ DL   V  LN D ++HGILVQLPLP  ++  ++I +I P KDVDG H
Sbjct: 65  SFEHKLPAETSEADLLALVERLNADPAVHGILVQLPLPDHMNSDAVINAISPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDQLG-SLSGLDAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TKNL E+ R ADI+V AVGRP+MV  DWIK G+ VIDVGINRI++P+  
Sbjct: 182 ESCTVTIAHSRTKNLAEVVRRADIVVAAVGRPQMVPGDWIKPGATVIDVGINRIDAPEKG 241

Query: 243 -GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            GKT LVGD   D C  V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 242 EGKTRLVGDCDYDSCAEVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|154251825|ref|YP_001412649.1| methenyltetrahydrofolate cyclohydrolase [Parvibaculum
           lavamentivorans DS-1]
 gi|171769580|sp|A7HSV9|FOLD_PARL1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|154155775|gb|ABS62992.1| Methenyltetrahydrofolate cyclohydrolase [Parvibaculum
           lavamentivorans DS-1]
          Length = 298

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 156/296 (52%), Positives = 208/296 (70%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK++A+ L  ++A  VA LKK+  +  GLAVVLVGNDPAS  YV  K       G 
Sbjct: 4   TIIDGKIIATELRARVAVEVARLKKDHSLTPGLAVVLVGNDPASEVYVRNKGIATTEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++  P + S+ D+   V  LN D ++HG LVQ P+P+ +S+Q++I +I P KD DGL
Sbjct: 64  NSFEFKLPAETSEADVLAKVRELNADPAVHGFLVQFPVPNHISQQAVIDAIDPVKDADGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +NAG++  G     +VP TP G +++ ++  G DLSG+HAV+IGRSNL GKP+ QLLL
Sbjct: 124 HPLNAGRLASG--LPAMVPATPEGCVIMAKR-AGGDLSGKHAVIIGRSNLVGKPVAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TVT+AHS++++LP I R ADILV AVGRP MV+ DW+K G++VIDVGINR+ +P+ 
Sbjct: 181 KENCTVTIAHSRSRDLPSIARQADILVAAVGRPGMVRGDWVKPGAVVIDVGINRVPAPEK 240

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  DE   V GAITPVPGGVG MT+A L+ NTVIAA R  G+  P+
Sbjct: 241 GEGKTRLVGDVLFDEAAEVAGAITPVPGGVGLMTVACLLRNTVIAACRQNGIALPQ 296


>gi|86138010|ref|ZP_01056586.1| folD bifunctional protein [Roseobacter sp. MED193]
 gi|85825602|gb|EAQ45801.1| folD bifunctional protein [Roseobacter sp. MED193]
          Length = 300

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 200/296 (67%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +K+A  VA LK+E  +  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   NIIDGKAFAATVREKVAGHVARLKEENDITPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D SQ DL   +  LN D ++HGILVQLPLP  ++E  II SI PEKDVDG 
Sbjct: 64  NSYEHKMDADTSQEDLLAVITKLNNDPAVHGILVQLPLPGHLNEDLIINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKAMVPCTPLGCLMMLRDYHG-SLSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TK+L E+ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI +P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLAEVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIPAPEK 240

Query: 242 -LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             G+  LVGDV    C    GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 GEGRMKLVGDVDFASCSERAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|163738357|ref|ZP_02145772.1| Methenyltetrahydrofolate cyclohydrolase [Phaeobacter gallaeciensis
           BS107]
 gi|161388278|gb|EDQ12632.1| Methenyltetrahydrofolate cyclohydrolase [Phaeobacter gallaeciensis
           BS107]
          Length = 300

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/296 (53%), Positives = 201/296 (67%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +K+A  VA LK+E  +  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   NIIDGKAFAATVREKVAGHVARLKEEHDITPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ +L   V  LN D S+HGILVQLPLP  ++E  II SI PEKDVDG 
Sbjct: 64  NSFEHKMDADTSEANLLAVVDKLNNDPSVHGILVQLPLPDHLNEDLIINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+TK+LP++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI +P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLPDVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIPAPEK 240

Query: 242 -LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GK  LVGDV    C    GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 GEGKMKLVGDVDYASCAERAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|259417995|ref|ZP_05741914.1| bifunctional protein FolD [Silicibacter sp. TrichCH4B]
 gi|259346901|gb|EEW58715.1| bifunctional protein FolD [Silicibacter sp. TrichCH4B]
          Length = 300

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 158/295 (53%), Positives = 200/295 (67%), Gaps = 6/295 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++AE V  LK+E G+  GLAVVLVG DPAS  YV +K +     G +
Sbjct: 5   IIDGKAFAAKVRGQVAEHVTRLKEEHGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++    D S+ DL   +  LN D S+HGILVQLPLP  + E  +I SI PEKDVDG H
Sbjct: 65  SYEHKLDADTSEADLLALIGQLNNDASVHGILVQLPLPKHLDEDLVINSIAPEKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHG-SLSGMDAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TK+LP++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI++P+  
Sbjct: 182 DSCTVTIAHSRTKDLPDVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIDAPEKG 241

Query: 243 -GKTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            GKT LVGDV  E  +   GAITPVPGGVGPMTIA L+ANTV A  R+  +  P+
Sbjct: 242 EGKTRLVGDVHYESAAARAGAITPVPGGVGPMTIACLLANTVTACCRANNLAEPE 296


>gi|163745833|ref|ZP_02153192.1| FolD bifunctional protein [Oceanibulbus indolifex HEL-45]
 gi|161380578|gb|EDQ04988.1| FolD bifunctional protein [Oceanibulbus indolifex HEL-45]
          Length = 296

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 201/294 (68%), Gaps = 6/294 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +K+A  VA L+ + G+  GLAVVLVG DPAS  YV +K +M +  G 
Sbjct: 4   TIIDGKAFAATVREKVAGHVARLEADHGITPGLAVVLVGEDPASQVYVRSKGKMTREVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++  P  + Q  L   +  LN D  IHGILVQLPLP  + EQ ++ S+ P KDVDG 
Sbjct: 64  KSVEHKLPATVEQQALLELIDRLNNDPEIHGILVQLPLPDHLDEQRVVNSVSPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++ +  G DLSG +AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLREQHG-DLSGMNAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T++LP++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + 
Sbjct: 181 GDSCTVTIAHSRTRDLPDVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIEVGE- 239

Query: 243 GKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            KT LVGDV  E  S   GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 240 -KTKLVGDVDFESASQRAGAITPVPGGVGPMTIACLLANTVTACCRANGLDEPE 292


>gi|240850042|ref|YP_002971435.1| methylenetetrahydrofolate dehydrogenase [Bartonella grahamii
           as4aup]
 gi|240267165|gb|ACS50753.1| methylenetetrahydrofolate dehydrogenase [Bartonella grahamii
           as4aup]
          Length = 299

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 152/299 (50%), Positives = 210/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L+    +Q  +AV++VG+DPAS  YV++K + A+ C
Sbjct: 1   MNNIIDGKKLAEEIIAKVKAETIKLRHHYNIQPSIAVIIVGDDPASQVYVTSKNKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++    +  + +L   + +LN D  IHGILVQLPLP+ ++   I Q++  +KDVD
Sbjct: 61  GFLSIKHVVSKETQEKELLQLIATLNSDPKIHGILVQLPLPAHMNTNRITQAVAFQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+        ++PCTPAGA+++IE+  G DLSG  AVV+GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLAANALEDAIIPCTPAGAMMMIERHCGQDLSGLDAVVVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L ++CR+ADILV AVGRP+M++ DWIK G++VIDVGINR+ +P
Sbjct: 181 LTAANATVTIAHSRTRDLDDVCRSADILVAAVGRPQMIKKDWIKNGAIVIDVGINRVAAP 240

Query: 241 Q--LGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +  +GKT LVGDV  E  K    AITPVPGGVGPMTIAMLM NT+ AA RS  +  PKF
Sbjct: 241 EKGIGKTRLVGDVDFENVKEKAAAITPVPGGVGPMTIAMLMVNTLKAAARSHNLPIPKF 299


>gi|119385341|ref|YP_916397.1| methenyltetrahydrofolate cyclohydrolase [Paracoccus denitrificans
           PD1222]
 gi|190359403|sp|A1B5A7|FOLD1_PARDP RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119375108|gb|ABL70701.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Paracoccus
           denitrificans PD1222]
          Length = 298

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/294 (52%), Positives = 203/294 (69%), Gaps = 6/294 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  AS +  ++A +VA L+   GV  GLAVVLVG DPAS  YV  K    +  G  
Sbjct: 5   IIDGKAFASGVRGRVASAVAGLEAAHGVVPGLAVVLVGEDPASQVYVRNKGIQTREAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P + +Q +L   +  LN D ++HGILVQLPLP  +  +++I +I P+KDVDG H
Sbjct: 65  SFEHKLPAETAQAELMALIERLNADPAVHGILVQLPLPRHMDAEAVINAIDPKKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V+N G  ++G     +VPCTP G ++L+    G DLSG +AVV+GRSN+ GKPM QLLL+
Sbjct: 125 VLNVG--LLGTGQKAMVPCTPLGCLMLLRDTLG-DLSGLNAVVVGRSNIVGKPMAQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+T++L  +CRTADILV AVGRPRM++ DWIK G+ VIDVGINRI   + G
Sbjct: 182 ESCTVTIAHSRTRDLAGLCRTADILVAAVGRPRMIRGDWIKPGATVIDVGINRIE--EAG 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           ++ LVGDV  D    V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P F
Sbjct: 240 RSRLVGDVDFDSAAPVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPDF 293


>gi|150397296|ref|YP_001327763.1| methenyltetrahydrofolate cyclohydrolase [Sinorhizobium medicae
           WSM419]
 gi|190359415|sp|A6UB98|FOLD2_SINMW RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|150028811|gb|ABR60928.1| Methenyltetrahydrofolate cyclohydrolase [Sinorhizobium medicae
           WSM419]
          Length = 297

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 199/286 (69%), Gaps = 4/286 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ L D I   V  L++ETG   GLAVVLVG DPAS  YV +K R     G 
Sbjct: 10  AIIDGKRFAAGLLDDITARVKKLEEETGQVPGLAVVLVGEDPASRVYVGSKHRQTLAAGI 69

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P + +Q +L   +  LN D ++HGILVQLPLP+ +   ++IQ I P KDVDG 
Sbjct: 70  ASFKYELPAETTQEELMALIDRLNVDPAVHGILVQLPLPAHLDANAVIQEINPNKDVDGF 129

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ NAG++  G      VPCTP G +LL++   G +LSG HAVV+G+SN+ G+PM QLLL
Sbjct: 130 HISNAGRLATGQ--PAFVPCTPLGCLLLLKDRLGANLSGLHAVVLGKSNIVGRPMVQLLL 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + + TVT+AHS+T+N PE+CR ADIL+VAVGRP +V+ DWIK G++VIDVGINR+ +   
Sbjct: 188 AESCTVTIAHSRTRNAPELCREADILIVAVGRPGLVRGDWIKPGAVVIDVGINRVEAE-- 245

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK+ +VGDVA E     GAITPVPGGVGPMTIA L++NT+ A  R 
Sbjct: 246 GKSRIVGDVAFEEAGHAGAITPVPGGVGPMTIACLLSNTLTAFCRQ 291


>gi|149185026|ref|ZP_01863343.1| folD bifunctional protein [Erythrobacter sp. SD-21]
 gi|148831137|gb|EDL49571.1| folD bifunctional protein [Erythrobacter sp. SD-21]
          Length = 297

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/294 (52%), Positives = 202/294 (68%), Gaps = 7/294 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A++L +++    A  + + G + GLAVVLVG DPAS  YV +K +     G  S
Sbjct: 6   IDGKAFAALLRERVGALAAQFETKAGRKAGLAVVLVGEDPASQVYVRSKHKATVAAGMES 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P D S+ DL   V  LN DD++ GILVQLPLP  + +Q++I SI P+KDVDG HV
Sbjct: 66  FEHRLPADTSEPDLLALVEQLNSDDAVDGILVQLPLPEHLDDQAVIASISPDKDVDGFHV 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            NAG++ +G   +G VPCTP G ++L+    G DLSG  AVVIGRSN+ GKPM QLLL  
Sbjct: 126 TNAGRLAVG--QSGFVPCTPLGCMMLLTDRLG-DLSGLEAVVIGRSNIVGKPMAQLLLGA 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG- 243
           NATVT+AHS+TK+LP + + ADI+V AVGR  MV+ +W+K G+ VIDVGINR+  P  G 
Sbjct: 183 NATVTIAHSRTKDLPSVVKRADIVVAAVGRAEMVKAEWLKDGATVIDVGINRL-PPAEGE 241

Query: 244 -KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            K  LVGDV     + V  AITPVPGGVGPMTIA+L+ NT++AAYR+ G+  P+
Sbjct: 242 QKGRLVGDVDYAGAEGVAAAITPVPGGVGPMTIAVLLRNTLVAAYRNAGLDVPE 295


>gi|197105496|ref|YP_002130873.1| FolD bifunctional protein [Phenylobacterium zucineum HLK1]
 gi|226704384|sp|B4RE11|FOLD_PHEZH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|196478916|gb|ACG78444.1| FolD bifunctional protein [Phenylobacterium zucineum HLK1]
          Length = 297

 Score =  292 bits (748), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 205/296 (69%), Gaps = 9/296 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGKV+A  L  ++A+ VA L+ +  +Q GLAVVLVG DPAS  YV +K   +   G 
Sbjct: 4   KIIDGKVLAERLRGQVADEVARLRADYRLQPGLAVVLVGEDPASQVYVRSKGEHSLAVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV +  P D  Q +L   V  LN D  IHGILVQLPLP  + E+++I +I P+KDVDGL
Sbjct: 64  HSVTHRLPADTRQDELLRLVAELNADPLIHGILVQLPLPKHLDEKAVIAAISPDKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HVVNAG++  G     LVPCTP G ++++ +  G DL+G+ AVV+GRS L GKP+ QLLL
Sbjct: 124 HVVNAGRLASG--LPALVPCTPLGCLIMLRETLG-DLTGKRAVVVGRSLLVGKPVAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI--NSP 240
             + TVT+AHS+T +LP +CR ADILV AVGRPRM++ DWIK G+ VIDVGINR+  + P
Sbjct: 181 QADCTVTIAHSRTVDLPAVCREADILVAAVGRPRMIRGDWIKPGATVIDVGINRVPFDDP 240

Query: 241 Q---LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           +    GKT LVGDV   E   V GA+TPVPGGVG MT+A L+ NTV AA R  G++
Sbjct: 241 EKAAQGKTKLVGDVHYKEALQVAGAVTPVPGGVGLMTVACLLQNTVTAAKRLAGIE 296


>gi|163867833|ref|YP_001609037.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bartonella tribocorum CIP 105476]
 gi|189044520|sp|A9IQD2|FOLD_BART1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|161017484|emb|CAK01042.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella
           tribocorum CIP 105476]
          Length = 299

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 209/299 (69%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L+    +Q G+AV++VG+DPAS  YV++K + A+ C
Sbjct: 1   MNNIIDGKKLAEEIIVKVKAETIKLRNNYNIQPGIAVIIVGDDPASQVYVASKNKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++    +  + +L   + +LN D  IHGILVQLPLP+ ++   I Q++  +KDVD
Sbjct: 61  GFLSIKHVVSKETQEKELLQLIATLNSDPKIHGILVQLPLPAHINTNRITQAVAFQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN GK+        ++PCTPAGA+++IEQ  G DLSG  AVV+GRSN+ GKPM  L
Sbjct: 121 GFHYVNVGKLAANALEDAIIPCTPAGAMMMIEQHCGRDLSGLDAVVVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L ++CR+ADILV AVGRP+M++ DWIK  ++VIDVGINRI +P
Sbjct: 181 LTAANATVTIAHSRTRDLDDVCRSADILVAAVGRPQMIKKDWIKKDAIVIDVGINRIPAP 240

Query: 241 Q--LGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +  +GKT L+GDV  E  K    AITPVPGGVGPMTIAMLM NT+ AA R   +  PKF
Sbjct: 241 EKGVGKTHLIGDVDFENVKEKAAAITPVPGGVGPMTIAMLMVNTLKAAARLHNLPIPKF 299


>gi|126737236|ref|ZP_01752971.1| folD bifunctional protein [Roseobacter sp. SK209-2-6]
 gi|126721821|gb|EBA18524.1| folD bifunctional protein [Roseobacter sp. SK209-2-6]
          Length = 296

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/294 (53%), Positives = 198/294 (67%), Gaps = 6/294 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +K+A  VA LK+E  +  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   NIIDGKAFAATVREKVAGHVARLKEEHDITPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ DL   V  LN D ++HGILVQLPLP  ++E  II SI PEKDVDG 
Sbjct: 64  NSFEHKLDADTSEADLLAVVDKLNNDPTVHGILVQLPLPGHLNEDLIINSIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHGS-LSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LPE+ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + 
Sbjct: 181 GDSCTVTIAHSRTKDLPEVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIE--RD 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK  LVGDV         GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 239 GKNKLVGDVDFASAAERAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 292


>gi|83954499|ref|ZP_00963210.1| folD bifunctional protein [Sulfitobacter sp. NAS-14.1]
 gi|83840783|gb|EAP79954.1| folD bifunctional protein [Sulfitobacter sp. NAS-14.1]
          Length = 300

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 204/296 (68%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++A+ V  LK + G+  GLAVVLVG DPAS  YV +K +M K  G 
Sbjct: 4   TIIDGKAFAAQVRGQVAQHVTRLKDDHGITPGLAVVLVGADPASEVYVKSKGKMTKEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++      S+ +L   + +LNKDD+IHGILVQLPLP  ++E  +I +I P KDVDG 
Sbjct: 64  KSVEHRLTDTTSEAELLALIDTLNKDDTIHGILVQLPLPDHLNEDLVIGAIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHGT-LSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + + TVT+AHS+TK+L  + R ADI++ AVGRP MV  DWIK G+ +IDVGINR+++P+ 
Sbjct: 181 NDSCTVTIAHSRTKDLAAVVRRADIVIAAVGRPEMVPGDWIKPGATIIDVGINRLDAPER 240

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  D C  V GAITPVPGGVGPMTIA L+ANTV A  R+  +  P+
Sbjct: 241 GEGKTRLVGDVDFDSCAKVAGAITPVPGGVGPMTIACLLANTVTACCRAHELPEPE 296


>gi|254487959|ref|ZP_05101164.1| FolD bifunctional protein [Roseobacter sp. GAI101]
 gi|214044828|gb|EEB85466.1| FolD bifunctional protein [Roseobacter sp. GAI101]
          Length = 300

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 153/296 (51%), Positives = 203/296 (68%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + +++ E V+ LK + G+  GLAVVLVG DPAS  YV +K +M    G 
Sbjct: 4   TIIDGKAFAARVREQVGEHVSRLKADHGITPGLAVVLVGADPASEVYVRSKGKMTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+++    D  + DL   +  LN D +IHGILVQLPLP  ++E  +I +I P KDVDG 
Sbjct: 64  KSLEHRLEADTEEADLLALIAQLNADPAIHGILVQLPLPKHLNEDLVINAIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++ +  G  LSG  AV+IGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLREHHG-SLSGMDAVIIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
           + + TVT+AHS+TK+L E+ R ADI+V AVGRP MV  DWIK G+ +IDVGINR+++P+ 
Sbjct: 181 NDSCTVTIAHSRTKDLAEVVRRADIVVAAVGRPEMVPGDWIKPGATIIDVGINRLDAPEK 240

Query: 242 -LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV    C  V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 GEGKTRLVGDVDFASCVDVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 296


>gi|163795293|ref|ZP_02189260.1| FolD bifunctional protein [alpha proteobacterium BAL199]
 gi|159179279|gb|EDP63810.1| FolD bifunctional protein [alpha proteobacterium BAL199]
          Length = 298

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 160/298 (53%), Positives = 206/298 (69%), Gaps = 6/298 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G +IDGK  A+ L  ++ ++V  L +E G++ GLAVVLVG+DPAS  YV  K       G
Sbjct: 4   GGIIDGKAFAAGLRSRVGQAVDGLIREHGLKPGLAVVLVGDDPASRVYVRNKAAQTVEAG 63

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +S+++  P D +Q  L   +  LN D+++ GILVQLPLP  +  Q+++ +I P KDVDG
Sbjct: 64  MNSIEHRLPDDTTQETLLALIGELNADEAVDGILVQLPLPGQIDAQAVLDAIDPAKDVDG 123

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            HV+NAG++  G     LVPCTP G +LL++   G DLSG HAVV+GRSN+ GKPM QLL
Sbjct: 124 FHVINAGRLATG--GAALVPCTPLGCLLLLKDRLG-DLSGLHAVVVGRSNIVGKPMAQLL 180

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  N TVT+AHS+T++LP +CR ADILV AVGRP MV+ DW+K G+ VIDVGINR+ +P 
Sbjct: 181 LGANCTVTVAHSRTRDLPAMCRQADILVAAVGRPEMVRGDWVKPGATVIDVGINRVPAPD 240

Query: 242 L--GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
              GKT LVGDV   E  +V GAITPVPGGVGPMTIA+L+ NTV AA R  G+  P  
Sbjct: 241 KGEGKTRLVGDVAFAEAAAVAGAITPVPGGVGPMTIAVLLRNTVEAACRRRGIAVPTL 298


>gi|295690042|ref|YP_003593735.1| methenyltetrahydrofolate cyclohydrolase [Caulobacter segnis ATCC
           21756]
 gi|295431945|gb|ADG11117.1| Methenyltetrahydrofolate cyclohydrolase [Caulobacter segnis ATCC
           21756]
          Length = 297

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 161/294 (54%), Positives = 199/294 (67%), Gaps = 9/294 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ L  KIAE VA LK + GV  GLAVVLVG DPAS  YV  K    +  G +
Sbjct: 6   LIDGKAFAADLRAKIAEDVAELKAKHGVTPGLAVVLVGEDPASQVYVRNKGEQTEAAGMY 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P D SQ +L   V  LN D  IHG+LVQ P+P  +S+  ++ ++ P+KDVDGL 
Sbjct: 66  SETHRLPADTSQDELLAVVAKLNADPKIHGVLVQFPVPPHISQMDVVAALSPDKDVDGLT 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V NAG++  G     L PCTP G ++L++   G DLSG++AVVIGRSNL GKPM Q+LL+
Sbjct: 126 VTNAGRLASG--LPALTPCTPLGCMMLLKDTLG-DLSGKNAVVIGRSNLMGKPMAQMLLA 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
            + TVT+AHS++K+LP I R ADI+V AVGR  MV+ DW+K G+ VIDVGI R  +    
Sbjct: 183 ADCTVTIAHSRSKDLPGIVRQADIVVAAVGRAEMVKADWVKPGATVIDVGITRYPARDPA 242

Query: 242 ---LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
               GKT LVGDVA DE K V GAITPVPGGVGPMTIA L+ANT+ AA R  G+
Sbjct: 243 AAAAGKTRLVGDVAFDEVKEVAGAITPVPGGVGPMTIACLLANTLTAAKRLSGI 296


>gi|296282235|ref|ZP_06860233.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Citromicrobium bathyomarinum JL354]
          Length = 297

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 201/296 (67%), Gaps = 7/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDGK  A+ L   + E  A   ++ G + GLAVVLVG DPAS  YV +K +       
Sbjct: 4   QLIDGKAFAANLRQTVGEHAATFAEKAGRKAGLAVVLVGEDPASDVYVRSKGKATVAANM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++    D ++  L   V  LN D ++ GILVQLPLP  + EQ++I +I P KDVDG 
Sbjct: 64  ESFEHRLAADTTEDVLIALVEQLNDDPAVDGILVQLPLPGELDEQAVIAAIDPGKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV +AG++M+G    G VPCTP G ++++    G DLSG +AVVIGRSN+ GKPM QLLL
Sbjct: 124 HVESAGRLMVG--QQGFVPCTPLGCMMMLRDRLG-DLSGMNAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+AHS+T +LPE+ R ADI+V AVGRP MV+ DW+K G+ VIDVGINR+ +P  
Sbjct: 181 DANATVTIAHSRTSDLPEVVRRADIVVAAVGRPEMVKADWLKPGATVIDVGINRL-APAE 239

Query: 243 G--KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           G  K  LVGDV  E  K V GAITPVPGGVGPMTIA+L+ NT++AAYR  G++ P+
Sbjct: 240 GEAKGRLVGDVDFEGAKEVAGAITPVPGGVGPMTIAVLLRNTLVAAYRHEGLELPE 295


>gi|158423930|ref|YP_001525222.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Azorhizobium caulinodans ORS 571]
 gi|172047955|sp|A8I5P5|FOLD_AZOC5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158330819|dbj|BAF88304.1| methenyltetrahydrofolate cyclohydrolase [Azorhizobium caulinodans
           ORS 571]
          Length = 290

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 197/288 (68%), Gaps = 5/288 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ L  +IAE VA L ++  ++ GLAVVLVG DPAS  YV  K       G  S
Sbjct: 7   IDGKAFAAGLRARIAEEVAVLVRDHDLKPGLAVVLVGEDPASQVYVRNKAAQTAEAGMAS 66

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            +Y  P D ++ DL   V  LN D +++GILVQLPLP+ +    ++ +I P KDVDG HV
Sbjct: 67  FEYKLPADTAEADLLALVEKLNADPAVNGILVQLPLPAHLDSMKVLAAIDPAKDVDGFHV 126

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           VNAG++ +G     LVPCTP G ++L++   G +LSG +AVV+GRSN+ GKP  QLLL  
Sbjct: 127 VNAGRLAVG--LDALVPCTPLGCVMLLKHHLG-NLSGLNAVVVGRSNIVGKPAAQLLLRE 183

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+T++LP +CR ADILV AVGRP MV+ DWIK G+ VIDVGINR+     GK
Sbjct: 184 DCTVTIAHSRTRDLPGMCRQADILVAAVGRPEMVRGDWIKPGATVIDVGINRVPKAD-GK 242

Query: 245 TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           T LVGDVA +E   V G ITPVPGGVGPMTIA L+ NT+ AA R  G+
Sbjct: 243 TRLVGDVAYEEALGVAGLITPVPGGVGPMTIACLLQNTLTAARRQKGL 290


>gi|83943926|ref|ZP_00956383.1| folD bifunctional protein [Sulfitobacter sp. EE-36]
 gi|83845173|gb|EAP83053.1| folD bifunctional protein [Sulfitobacter sp. EE-36]
          Length = 300

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 203/296 (68%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++A+ V  LK + G+  GLAVVLVG DPAS  YV +K +M K  G 
Sbjct: 4   TIIDGKAFAAQVRGQVAQHVTRLKDDHGITPGLAVVLVGADPASEVYVKSKGKMTKEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++      S+ +L   + +LN DD+IHGILVQLPLP  ++E  +I +I P KDVDG 
Sbjct: 64  KSVEHRLADTTSEAELLALIDTLNNDDTIHGILVQLPLPDHLNEDLVISAIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHGT-LSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + + TVT+AHS+TK+L  + R ADI++ AVGRP MV  DWIK G+ +IDVGINR+++P+ 
Sbjct: 181 NDSCTVTIAHSRTKDLAAVVRRADIVIAAVGRPEMVPGDWIKPGATIIDVGINRLDAPER 240

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  D C  V GAITPVPGGVGPMTIA L+ANTV A  R+  +  P+
Sbjct: 241 GEGKTRLVGDVDFDSCAKVAGAITPVPGGVGPMTIACLLANTVTACCRAHDLPEPE 296


>gi|319405181|emb|CBI78786.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella sp.
           AR 15-3]
          Length = 299

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 151/299 (50%), Positives = 211/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L     +Q G+AV++VG+DPAS  YVS+K++ A+ C
Sbjct: 1   MDNIIDGKKLAEDILVKVKNETKKLYDNHKIQPGIAVIIVGDDPASQIYVSSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++ F  +  + DL   + +LN D  IHGILVQLPLP+ +   +++Q+I  +KDVD
Sbjct: 61  GFFSIKHVFSKETQEKDLLQLIETLNSDPKIHGILVQLPLPAHIHTNNVMQNIAFQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+    F   +VPCTPAG +++I+Q  G DLSG  AV++GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLTANVFEDTIVPCTPAGIMMMIQQKCGKDLSGLDAVIVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L EICR+ADILVVAVG P+M++ +W+K G+++IDVGINRI + 
Sbjct: 181 LTAANATVTIAHSRTRDLDEICRSADILVVAVGHPKMIKKEWVKKGAIIIDVGINRIATS 240

Query: 241 QLGKTV--LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +  KT   +VGDV  +E K    AITPVPGGVGPMTIAMLM NT+ AA R+  +  P+F
Sbjct: 241 KTDKTTTYIVGDVDFEEVKEKAAAITPVPGGVGPMTIAMLMVNTLKAAARAHKLPVPEF 299


>gi|254466355|ref|ZP_05079766.1| bifunctional protein FolD [Rhodobacterales bacterium Y4I]
 gi|206687263|gb|EDZ47745.1| bifunctional protein FolD [Rhodobacterales bacterium Y4I]
          Length = 305

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/301 (52%), Positives = 201/301 (66%), Gaps = 11/301 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++AE VA LK+E G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TVIDGKAFAAKVRGQVAEHVARLKEEHGITPGLAVVLVGEDPASQVYVRSKGKSTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++      S+ DL   +  LN D S+HGILVQLPLP  + E  +I +I PEKDVDG 
Sbjct: 64  NSFEHKLDAGTSEADLLALIGQLNNDPSVHGILVQLPLPKHLDEDLVINAIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++ +  G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLREHHGS-LSGLDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LPE+ R ADI+V AVGRP MV  +WIK G+ VIDVGINRI++P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLPEVVRRADIVVAAVGRPEMVPGEWIKEGATVIDVGINRIDAPEK 240

Query: 243 G-------KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           G       KT LVGDV         GAITPVPGGVGPMTIA L+ANTV AA R+  +  P
Sbjct: 241 GTKEDGSVKTRLVGDVDYASAAERAGAITPVPGGVGPMTIACLLANTVTAACRANNLAEP 300

Query: 295 K 295
           +
Sbjct: 301 E 301


>gi|49473943|ref|YP_031985.1| methylenetetrahydrofolate dehydrogenase [Bartonella quintana str.
           Toulouse]
 gi|81647223|sp|Q6G0I9|FOLD_BARQU RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|49239446|emb|CAF25796.1| Methylenetetrahydrofolate dehydrogenase [Bartonella quintana str.
           Toulouse]
          Length = 299

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 150/290 (51%), Positives = 208/290 (71%), Gaps = 3/290 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L+    +Q G+AV++VG+DPAS  YV++K++ A+ C
Sbjct: 1   MNNIIDGKKLAEEIIVKVKAETIKLRNNYKIQPGIAVIIVGDDPASHVYVTSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++    + S+ +L   + +LN D  IHGILVQLPLP+ ++   + Q+I  +KDVD
Sbjct: 61  GFFSIKHMLSKETSEKELLQLIATLNSDPKIHGILVQLPLPAHINTNCVTQAIAFQKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+        ++PCTPAGA+++IEQ  G DLSG  AVV+GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLSCNTLEDAIIPCTPAGAMIMIEQQCGRDLSGLDAVVVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L + NATVT+AHS+T++L ++CR+ADILV AVGRP++++ DW+K G++VIDVGINRI +P
Sbjct: 181 LTAANATVTIAHSRTRDLDDVCRSADILVAAVGRPQIIKKDWVKNGAIVIDVGINRIAAP 240

Query: 241 Q--LGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +  +GKT LVGDV  E  K    AITPVPGGVGPMTIAMLM NT+ AA R
Sbjct: 241 EKGIGKTRLVGDVDFEAIKGKTAAITPVPGGVGPMTIAMLMVNTLNAAAR 290


>gi|154248007|ref|YP_001418965.1| methenyltetrahydrofolate cyclohydrolase [Xanthobacter autotrophicus
           Py2]
 gi|154162092|gb|ABS69308.1| Methenyltetrahydrofolate cyclohydrolase [Xanthobacter autotrophicus
           Py2]
          Length = 295

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/289 (53%), Positives = 196/289 (67%), Gaps = 5/289 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ L  +IAE VA L    G++ GLAVVLVG DPAS  YV  K       G  S
Sbjct: 11  IDGKAFAAGLRARIAEEVARLGAAHGLKPGLAVVLVGEDPASQVYVRNKAAQTLEAGMTS 70

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++   VD  + +L   +  LN D +++GILVQLPLP+ +    ++ +I P KDVDG HV
Sbjct: 71  FEHKLAVDTPETELLALIARLNADPAVNGILVQLPLPAQIDAMKVLSTIDPAKDVDGFHV 130

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           VNAG++ +G     LVPCTP G ++L++   G +LSG  AVV+GRSN+ GKP  QLLL  
Sbjct: 131 VNAGRLAVG--LDALVPCTPLGCVMLLKHHLG-NLSGLKAVVVGRSNIVGKPAAQLLLKE 187

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+T++LP  CRTADILV AVGRP MV+ DWIK G+ VIDVGINRI  P  GK
Sbjct: 188 DCTVTIAHSRTRDLPGECRTADILVAAVGRPEMVRGDWIKPGATVIDVGINRIPKPD-GK 246

Query: 245 TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           T LVGDVA  E + + G ITPVPGGVGPMTIA L+ NT+ AA R  G++
Sbjct: 247 TRLVGDVAYQEAQGIAGLITPVPGGVGPMTIACLLQNTLTAAKRQAGLE 295


>gi|254441034|ref|ZP_05054527.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Octadecabacter antarcticus 307]
 gi|198251112|gb|EDY75427.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Octadecabacter antarcticus 307]
          Length = 297

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 203/294 (69%), Gaps = 5/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +   + E VA LK + G+  GL+VVLVG+DPAS  YV +K +M    G 
Sbjct: 4   TVIDGKAFAAKVRGLVGEQVAMLKADHGITPGLSVVLVGDDPASQVYVKSKGKMTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++    D+S+ DL   V SLN D +IHGILVQLPLP  ++   +I SI P KDVDG 
Sbjct: 64  KSVEHRMDADVSETDLLAMVQSLNVDPTIHGILVQLPLPEHLNSDLVINSIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G+++++    G  LSG +AV+IGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKAMVPCTPLGSLMMLRDQLG-SLSGLNAVIIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+L ++ R ADI+V AVGR +MV  DWIK G+ VIDVGINRI+ P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLADVVRRADIVVAAVGRAQMVPGDWIKPGATVIDVGINRIDKPE- 239

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           G T LVGDV  D C +V GAITPVPGGVGPMTIA L+ANTV A  R+  +  P+
Sbjct: 240 GGTRLVGDVDYDSCAAVAGAITPVPGGVGPMTIACLLANTVTACCRANNLAEPE 293


>gi|255264266|ref|ZP_05343608.1| bifunctional protein FolD [Thalassiobium sp. R2A62]
 gi|255106601|gb|EET49275.1| bifunctional protein FolD [Thalassiobium sp. R2A62]
          Length = 296

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 155/294 (52%), Positives = 199/294 (67%), Gaps = 6/294 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ + + +A  V  +K E+GV  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TVIDGKAFAATVRENVAAHVTRIKDESGVTPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++   VD S+ DL   +  LN D+SIHGILVQLPLP+ ++E  +I SI P KDVDG 
Sbjct: 64  KSVEHKLDVDTSEADLLALIDQLNNDESIHGILVQLPLPAHLNEDLVINSIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG +AVVIGRSN+ GKPM  LLL
Sbjct: 124 HISNVG--LLGTGQKAMVPCTPLGCLMMLRDHHG-SLSGMNAVVIGRSNIVGKPMANLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LP++ R ADI+V AVGRP MV  DWI+ G+ VIDVGINRI   + 
Sbjct: 181 GDSCTVTIAHSRTKDLPDVVRAADIVVAAVGRPEMVPGDWIREGATVIDVGINRIE--RD 238

Query: 243 GKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK  LVGDV    C  V GAITPVPGGVGPMTIA L+ANT+ A  R+  +  P+
Sbjct: 239 GKNKLVGDVDYVSCSEVAGAITPVPGGVGPMTIACLLANTLTACCRANNLVEPE 292


>gi|254466218|ref|ZP_05079629.1| bifunctional protein FolD [Rhodobacterales bacterium Y4I]
 gi|206687126|gb|EDZ47608.1| bifunctional protein FolD [Rhodobacterales bacterium Y4I]
          Length = 305

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 156/301 (51%), Positives = 201/301 (66%), Gaps = 11/301 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++AE VA LK+E G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TVIDGKAFAAKVRGQVAEHVARLKEEHGITPGLAVVLVGEDPASQVYVRSKGKSTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++      S+ DL   +  LN D S+HGILVQLPLP  + E  +I +I PEKDVDG 
Sbjct: 64  NSFEHKLDAGTSEADLLALIGQLNNDPSVHGILVQLPLPKHLDEDLVINAIAPEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++ +  G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLREHHGS-LSGLDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T++LPE+ R ADI+V AVGRP MV  +WIK G+ VIDVGINRI++P+ 
Sbjct: 181 GDSCTVTIAHSRTRDLPEVVRRADIVVAAVGRPEMVPGEWIKEGATVIDVGINRIDAPEK 240

Query: 243 G-------KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           G       KT LVGDV         GAITPVPGGVGPMTIA L+ANTV AA R+  +  P
Sbjct: 241 GTKEDGSVKTRLVGDVDYASAAERAGAITPVPGGVGPMTIACLLANTVTAACRANNLAEP 300

Query: 295 K 295
           +
Sbjct: 301 E 301


>gi|126725983|ref|ZP_01741825.1| folD bifunctional protein [Rhodobacterales bacterium HTCC2150]
 gi|126705187|gb|EBA04278.1| folD bifunctional protein [Rhodobacterales bacterium HTCC2150]
          Length = 299

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 199/294 (67%), Gaps = 5/294 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGKV A+ + +K+   VA LK E G+  GLAVVLVG DPAS  YV +K +M    G +
Sbjct: 5   IIDGKVFAATVREKVGTHVARLKDEHGITPGLAVVLVGEDPASQVYVRSKGKMTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++   VD S+ DL   +  LN D ++HGIL QLPLP  ++E  +I SI P KDVDG H
Sbjct: 65  SYEHKLDVDTSEADLLALIDQLNNDPTVHGILCQLPLPKHLNEDLVINSIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G +  G  +  +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM  LLL 
Sbjct: 125 ISNVGMLSTGQKS--MVPCTPLGCLMMLRDHHG-SLSGMNAVVVGRSNIVGKPMANLLLR 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TK++  +CR+ADI+V AVGRP M+  DWI  G+ VIDVGINRI+ P+  
Sbjct: 182 DSCTVTIAHSRTKDIEALCRSADIVVAAVGRPEMITGDWIGEGATVIDVGINRIDHPEKE 241

Query: 243 GKTVLVGDVADECK-SVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GKT LVGDV  E      GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 242 GKTKLVGDVHFESAVEKAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 295


>gi|254453274|ref|ZP_05066711.1| FolD bifunctional protein [Octadecabacter antarcticus 238]
 gi|198267680|gb|EDY91950.1| FolD bifunctional protein [Octadecabacter antarcticus 238]
          Length = 297

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 202/294 (68%), Gaps = 5/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +   + E VA LK + G+  GLAVVLVG+DPAS  YV +K +M    G 
Sbjct: 4   TVIDGKAFAAKVRGLVGEHVAMLKADHGITPGLAVVLVGDDPASQVYVKSKGKMTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++    D+S+ DL   V  LN D +IHGILVQLPLP  ++   +I SI P KDVDG 
Sbjct: 64  KSVEHRMDADVSEADLLAMVQMLNDDPTIHGILVQLPLPDHLNSDLVINSINPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G+++++    G  LSG +AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKAMVPCTPLGSLMMLRDQLG-SLSGLNAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+L ++ R ADI+V AVGR +MV  DWIK G+ VIDVGINRI+ P+ 
Sbjct: 181 GDSCTVTIAHSRTKDLADVVRRADIVVAAVGRAQMVPGDWIKPGATVIDVGINRIDKPE- 239

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           G T LVGDV  D C +V GAITPVPGGVGPMTIA L+ANTV A  R+  +  P+
Sbjct: 240 GGTRLVGDVDYDSCAAVAGAITPVPGGVGPMTIACLLANTVTACCRANNLAEPE 293


>gi|86747235|ref|YP_483731.1| methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           HaA2]
 gi|119370032|sp|Q2J3Z0|FOLD_RHOP2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|86570263|gb|ABD04820.1| Methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           HaA2]
          Length = 295

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 151/293 (51%), Positives = 201/293 (68%), Gaps = 4/293 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK++++ L  ++A  V  +K + G+  GLAVVLVG+DPAS  YV +K +  +  G 
Sbjct: 4   TIIDGKIISAELRARVAAEVTRIKADHGITPGLAVVLVGSDPASEVYVRSKHKQTQEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D+ Q +L   +  LN D ++HGILVQLPLP  +   ++I +I P KDVDGL
Sbjct: 64  ASFEHRLPADVPQAELLALIGQLNADPAVHGILVQLPLPKGLDSNAVIDAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           + VNAG++  G F   L PCTP G I++ +Q     L G +A+VIGRSNL GKP+ QLLL
Sbjct: 124 NPVNAGRLASGLFA--LTPCTPLGCIIMAKQVH-ASLEGMNAIVIGRSNLVGKPLVQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+AHS++++LP +CR AD++  AVGRP MV+ DWIK G+ VIDVGINR  SP  
Sbjct: 181 NENATVTIAHSRSRDLPALCRQADLVFAAVGRPEMVKGDWIKPGATVIDVGINRTPSPDG 240

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           GK  LVGDVA  E K + GAITPVPGGVG MT+A L+ NTV AA    G+  P
Sbjct: 241 GKDKLVGDVAFAEAKDIAGAITPVPGGVGLMTVACLLVNTVRAASAIHGLPKP 293


>gi|149915628|ref|ZP_01904154.1| FolD bifunctional protein [Roseobacter sp. AzwK-3b]
 gi|149810520|gb|EDM70363.1| FolD bifunctional protein [Roseobacter sp. AzwK-3b]
          Length = 300

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 198/295 (67%), Gaps = 6/295 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +K+A  VA LK+E  +  GLAVVLVG DPAS  YV +K +     G +
Sbjct: 5   IIDGKAFAAKVREKVAGHVARLKEEHAITPGLAVVLVGEDPASQVYVRSKGKQTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++    D S+ DL   +  LN    +HGILVQLPLP  ++E  +I SI P KDVDG H
Sbjct: 65  SYEHKLDADTSEKDLLELIDKLNNAPEVHGILVQLPLPGHLNEDLVINSIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++  + G  LSG  AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDYHG-SLSGMDAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
            + TVT+AHS+TK++ ++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI++P   
Sbjct: 182 DSCTVTIAHSRTKDIQDVTRRADIVVAAVGRPEMVTGDWIKPGATVIDVGINRIDAPDKG 241

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            G+T LVGD   D C  V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 242 EGQTRLVGDCHFDSCAEVAGAITPVPGGVGPMTIACLLANTVTACCRANGLSEPE 296


>gi|186939594|dbj|BAG31002.1| putative 5,10-methylene tetrahydrofolate dehydrogenase [Aminobacter
           sp. AJ110403]
          Length = 297

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 153/285 (53%), Positives = 197/285 (69%), Gaps = 4/285 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ L + I   V  + ++TG   GLAVVLVG DPAS  YV +K R     G 
Sbjct: 10  AIIDGKQFAAGLLENIKLRVESVTQKTGKVPGLAVVLVGADPASAVYVGSKHRQTVAAGM 69

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P + +Q +L   +  LN D  +HGILVQLPLP+ +  Q++IQ I P KDVDG 
Sbjct: 70  RSFKYELPTETTQEELMALIDRLNVDPEVHGILVQLPLPAHLDTQAVIQEINPHKDVDGF 129

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ NAG++  G     LVPCTP G ++L++   G +LSG +AVV+G+SN+ GKPM QLLL
Sbjct: 130 HISNAGRLSTGQ--PALVPCTPLGCLMLLKDRLGSNLSGLNAVVVGKSNIVGKPMAQLLL 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + + TVT+AHS+TKN PE+CRTADILVVAVGRP +V+ DWIK G+ VIDVGINRI     
Sbjct: 188 AEDCTVTVAHSRTKNTPELCRTADILVVAVGRPGLVRGDWIKPGATVIDVGINRIEVD-- 245

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK+ +VGDVA +      AITPVPGGVGPMTIA L++NT+ A  R
Sbjct: 246 GKSRIVGDVAFDEAGHAAAITPVPGGVGPMTIACLLSNTLTAFCR 290


>gi|16125467|ref|NP_420031.1| FolD bifunctional protein [Caulobacter crescentus CB15]
 gi|13422543|gb|AAK23199.1| FolD bifunctional protein [Caulobacter crescentus CB15]
          Length = 344

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 196/294 (66%), Gaps = 9/294 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ L  KIAE VA LK E GV  GLAVVLVG DPAS  YV  K       G +
Sbjct: 53  LIDGKAFAADLRAKIAEEVAALKAEHGVTPGLAVVLVGEDPASQVYVRNKGEQTTAAGMY 112

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P   +Q +L   V  LN D  IHG+LVQ P+P  +S+  ++ ++ P+KDVDGL 
Sbjct: 113 SETHRLPETTTQDELLAVVAKLNADPKIHGVLVQFPVPPHISQMDVVAALSPDKDVDGLT 172

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V NAG++  G     L PCTP G ++LI    G DL G+ AVVIGRSNL GKPM Q+LL+
Sbjct: 173 VTNAGRLASG--LPALAPCTPTGCMMLIRDAIG-DLKGKTAVVIGRSNLMGKPMAQMLLA 229

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI--NSPQ 241
            + TVT+AHS++++LP I R ADI+V AVGR  MV+ DW+K G++VIDVGI R     P+
Sbjct: 230 ADCTVTIAHSRSQDLPSIVRQADIVVAAVGRAEMVKADWVKPGAVVIDVGITRFPARDPE 289

Query: 242 ---LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
               GKT LVGDVA DE + V GAITPVPGGVGPMTIA L+ANT+ AA R  G+
Sbjct: 290 AAAAGKTRLVGDVAFDEVREVAGAITPVPGGVGPMTIACLLANTLTAAKRLSGI 343


>gi|91975174|ref|YP_567833.1| methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           BisB5]
 gi|119370034|sp|Q13DA7|FOLD_RHOPS RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|91681630|gb|ABE37932.1| Methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           BisB5]
          Length = 295

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 200/292 (68%), Gaps = 4/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK++++ L  ++A  V  +K E G+  GLAVVLVG+DPAS  YV +K +  +  G  
Sbjct: 5   IIDGKIISADLRGRVAAEVTRIKAEHGITPGLAVVLVGSDPASEVYVRSKHKQTQEAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D++Q DL   +  LN D ++HGILVQLPLP  +   ++I +I P KDVDGL+
Sbjct: 65  SFEHRLPADVAQADLLALIGQLNADPAVHGILVQLPLPKGLDSNAVIDAIDPAKDVDGLN 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VNAG++  G F   L PCTP G I++ +Q     L G +A+VIGRSNL GKP+ QLLL+
Sbjct: 125 PVNAGRLASGLFA--LTPCTPLGCIIMAKQVH-ASLEGMNAIVIGRSNLVGKPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS++++LP +CR AD++  AVG+  MV+ DWIK G+ VIDVGINR  SP  G
Sbjct: 182 ENATVTIAHSRSRDLPALCRQADLVFAAVGKAEMVKGDWIKPGATVIDVGINRTPSPDGG 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  LVGDVA  E K V GAITPVPGGVG MT+A L+ NTV AA    G+  P
Sbjct: 242 KDKLVGDVAFHEAKDVAGAITPVPGGVGLMTVACLLVNTVRAASAIHGLPKP 293


>gi|304394445|ref|ZP_07376366.1| bifunctional protein FolD 2 [Ahrensia sp. R2A130]
 gi|303293355|gb|EFL87734.1| bifunctional protein FolD 2 [Ahrensia sp. R2A130]
          Length = 304

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 151/303 (49%), Positives = 199/303 (65%), Gaps = 11/303 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK  A+ +  ++AE V  +K +  +  GLAVVLVG DPAS  YV  K +    C
Sbjct: 1   MADIIDGKEFAAKVRAQVAEHVTAIKNDHNITPGLAVVLVGEDPASQVYVRNKGKQTLEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S ++   VD  Q  L   +  LN D ++HGIL QLPLP  + E+ ++ +I+PEKDVD
Sbjct: 61  GMASFEHKLDVDTDQTTLMAIIEKLNADPAVHGILCQLPLPKHLDEEEVLNAILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H+ N G +  G     +VPCTP G ++++ +  G  LSG +AVV+GRSN+ GKPM QL
Sbjct: 121 GFHISNVGLLATGQ--KAMVPCTPLGCLMMLREKHG-SLSGMNAVVVGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  + TVT+AHS+TK++  +C+TADILV AVGRP MV  DW+K G+ VIDVGINRI++P
Sbjct: 178 LLRDSCTVTIAHSRTKDIEALCKTADILVAAVGRPEMVTGDWVKPGATVIDVGINRIDAP 237

Query: 241 QLG-------KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           + G       KT LVGDV       V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+ 
Sbjct: 238 EKGTKEDGSVKTRLVGDVDFTSAGEVAGAITPVPGGVGPMTIACLLANTLTACCRANGLA 297

Query: 293 SPK 295
            P+
Sbjct: 298 EPQ 300


>gi|221234212|ref|YP_002516648.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Caulobacter crescentus NA1000]
 gi|119369634|sp|Q9A8Y0|FOLD_CAUCR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|254789392|sp|B8H4A3|FOLD_CAUCN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|220963384|gb|ACL94740.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase
           [Caulobacter crescentus NA1000]
          Length = 297

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 158/294 (53%), Positives = 195/294 (66%), Gaps = 9/294 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ L  KIAE VA LK E GV  GLAVVLVG DPAS  YV  K       G +
Sbjct: 6   LIDGKAFAADLRAKIAEEVAALKAEHGVTPGLAVVLVGEDPASQVYVRNKGEQTTAAGMY 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P   +Q +L   V  LN D  IHG+LVQ P+P  +S+  ++ ++ P+KDVDGL 
Sbjct: 66  SETHRLPETTTQDELLAVVAKLNADPKIHGVLVQFPVPPHISQMDVVAALSPDKDVDGLT 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V NAG++  G     L PCTP G ++LI    G DL G+ AVVIGRSNL GKPM Q+LL+
Sbjct: 126 VTNAGRLASG--LPALAPCTPTGCMMLIRDAIG-DLKGKTAVVIGRSNLMGKPMAQMLLA 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI-----N 238
            + TVT+AHS++++LP I R ADI+V AVGR  MV+ DW+K G++VIDVGI R       
Sbjct: 183 ADCTVTIAHSRSQDLPSIVRQADIVVAAVGRAEMVKADWVKPGAVVIDVGITRFPARDPE 242

Query: 239 SPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +   GKT LVGDVA DE + V GAITPVPGGVGPMTIA L+ANT+ AA R  G+
Sbjct: 243 AAAAGKTRLVGDVAFDEVREVAGAITPVPGGVGPMTIACLLANTLTAAKRLSGI 296


>gi|89068031|ref|ZP_01155448.1| folD bifunctional protein [Oceanicola granulosus HTCC2516]
 gi|89046270|gb|EAR52327.1| folD bifunctional protein [Oceanicola granulosus HTCC2516]
          Length = 296

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/297 (52%), Positives = 198/297 (66%), Gaps = 7/297 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK  A+ +  K+AE VA LK   G+  GLAVVLVG+DPAS  YV +K +M K  
Sbjct: 1   MSEILDGKAFAAEVRAKVAEQVARLKDAHGITPGLAVVLVGDDPASQVYVRSKGKMTKEV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S ++    D S+ DL   V  LN+D  +HGILVQLPLP+ V   ++I +I PEKDVD
Sbjct: 61  GMSSFEHRLAEDTSEADLLALVGQLNEDPEVHGILVQLPLPAHVDADAVINAIAPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H+ N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM  L
Sbjct: 121 GFHISNVG--LLGTGQKAMVPCTPLGCLMMLRAHHG-SLSGLDAVVIGRSNIVGKPMASL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  + TVT+AHS+TK+LPE+ R ADI+V AVGRP+MV   WIK G+ VIDVGINR+  P
Sbjct: 178 LLGESCTVTIAHSRTKDLPEVVRRADIVVAAVGRPQMVPGGWIKEGATVIDVGINRV--P 235

Query: 241 QLG-KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             G KT LVGDV         GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 236 GEGDKTRLVGDVDFASAAERAGAITPVPGGVGPMTIACLLANTLTACCRASGLPEPE 292


>gi|88706483|ref|ZP_01104187.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Congregibacter
           litoralis KT71]
 gi|88699195|gb|EAQ96310.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Congregibacter
           litoralis KT71]
          Length = 297

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/289 (52%), Positives = 197/289 (68%), Gaps = 4/289 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            S+IDGK  A  L D++A  V+ +  E     GLAVVLVG DPAS  YV  K +     G
Sbjct: 3   ASIIDGKAAAQALRDRLAIEVSRIDAEHSWVPGLAVVLVGEDPASQVYVRNKGKQTAEAG 62

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S ++  P   S+ +L + V SLN+DD+++GILVQLPLP  +  Q +I++I P KDVDG
Sbjct: 63  MRSFEHKLPASTSERELLDLVESLNRDDAVNGILVQLPLPEHIDAQLVIETIDPAKDVDG 122

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLI-EQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G +  GD  T LVPCTP G ++++ EQF    ++G +AVV+GRSN+ GKPM QL
Sbjct: 123 FHPMNTGALSNGD-PTALVPCTPLGCLMMLREQFPE-GIAGLNAVVVGRSNIVGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L++ + TVT+AHSKT++LP +CRTADILV AVGRP MV+ DW+K G++VIDVGINR+   
Sbjct: 181 LIAESCTVTVAHSKTRDLPALCRTADILVAAVGRPEMVRGDWVKEGAVVIDVGINRVQLE 240

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
              K  LVGDVA  E      AITPVPGGVGPMTIA L+ NTV+AA R 
Sbjct: 241 GQEKARLVGDVAFAEAAERAKAITPVPGGVGPMTIACLLRNTVVAACRQ 289


>gi|115522077|ref|YP_778988.1| methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           BisA53]
 gi|122298185|sp|Q07VM6|FOLD_RHOP5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|115516024|gb|ABJ04008.1| Methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           BisA53]
          Length = 295

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 199/292 (68%), Gaps = 4/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGKV+++ L  ++A  V  +K + G+  GLAVVLVG DPAS  YV +K +  +  G  
Sbjct: 5   IIDGKVISAELRARVAAEVTRIKTDHGITPGLAVVLVGADPASEVYVRSKHKQTQEAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D+ Q +L   +  LN D ++HGILVQLPLP  +   ++I +I P KDVDGL+
Sbjct: 65  SFEHRLPADVPQAELLALIAKLNADPTVHGILVQLPLPKGLDSNAVIDAIDPAKDVDGLN 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VNAG++  G F   L PCTP G I++ +Q     L G +A+V+GRSNL GKP+ QLLL+
Sbjct: 125 PVNAGRLASGLFA--LTPCTPLGCIIMAKQVH-ASLEGMNAIVVGRSNLVGKPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS++++LP +CR AD++  AVG+P M++ DWIK G+ VIDVGINR  SP  G
Sbjct: 182 ENATVTIAHSRSRDLPALCRQADLVFAAVGKPEMIRGDWIKPGATVIDVGINRTPSPDGG 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  LVGDVA  E K V GAITPVPGGVG MT+A L+ NTV AA    G+  P
Sbjct: 242 KDKLVGDVAFAEAKEVAGAITPVPGGVGLMTVACLLVNTVRAASAIHGLPKP 293


>gi|148555780|ref|YP_001263362.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Sphingomonas wittichii RW1]
 gi|190359418|sp|A5VAA8|FOLD3_SPHWW RecName: Full=Bifunctional protein FolD 3; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|148500970|gb|ABQ69224.1| Methenyltetrahydrofolate cyclohydrolase [Sphingomonas wittichii
           RW1]
          Length = 304

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 202/294 (68%), Gaps = 4/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK  A+ L  ++A +V   +   G   GLAVVLVG D AS  YV +K +     G 
Sbjct: 10  EIIDGKAYAAGLRARVATAVPAFRVAAGRAPGLAVVLVGEDAASQVYVRSKHKATVEAGM 69

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P   S+ +L   V  LN DD + GILVQLPLP  + E+ +I +I P+KDVDG 
Sbjct: 70  ESFEHRLPATASETELLALVERLNADDRVDGILVQLPLPPHIDEKKVIATIDPDKDVDGF 129

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HVVNAG++ +G+   G VPCTP G ++L++  +G DLSG  AVVIGRSN+ GKPM  LLL
Sbjct: 130 HVVNAGRLAVGE--AGYVPCTPLGCLMLLKDRRG-DLSGLEAVVIGRSNIVGKPMAALLL 186

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + N TVT+AHS+T++L E+ R ADI+V AVGRP MV+ DWI+ G+ VIDVGINR+   + 
Sbjct: 187 AENCTVTIAHSRTRDLAEVVRRADIVVAAVGRPEMVRGDWIRPGATVIDVGINRVPGAEP 246

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GKT LVGDV   E  +V GAITPVPGGVGPMTIA+L+ NT++AA+R  G+  P+
Sbjct: 247 GKTRLVGDVAFAEAAAVAGAITPVPGGVGPMTIAVLLRNTLVAAHRRAGVALPE 300


>gi|319898416|ref|YP_004158509.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella
           clarridgeiae 73]
 gi|319402380|emb|CBI75919.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bartonella
           clarridgeiae 73]
          Length = 299

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 210/299 (70%), Gaps = 3/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  +  K+      L K   +Q G+AV++VG+DPAS  YVS+K++ A+ C
Sbjct: 1   MDNIIDGKQLAEDILVKVKNETKKLHKNHTIQPGIAVIIVGDDPASQIYVSSKSKKAEEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S+++    +  + +L   + +LN D  IHGILVQLPLP+ ++  +I Q+I   KDVD
Sbjct: 61  GFLSIKHVMSKETQEKELLKLIETLNSDPKIHGILVQLPLPAHINTNNITQTIAVHKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+    F   ++PCTPAG +++I+Q  G DLSG  AV++GRSN+ GKPM  L
Sbjct: 121 GFHYINIGKLTANVFEDTIIPCTPAGVMMMIQQKCGKDLSGLDAVIVGRSNIVGKPMAAL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI--N 238
           L + NATVT+AHS+T++L E+CR+ADILVVAVGRP+M++  W+KTG++VIDVGINRI  +
Sbjct: 181 LTAANATVTIAHSRTRDLDEVCRSADILVVAVGRPKMIKKGWVKTGAIVIDVGINRIATS 240

Query: 239 SPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
                K+ +VGDV  +E +    AITPVPGGVGPMTIAMLM NT+ AA R+  +  P+F
Sbjct: 241 GKNTTKSHIVGDVDFEEVREKASAITPVPGGVGPMTIAMLMVNTLKAAARAHKLPVPEF 299


>gi|268609022|ref|ZP_06142749.1| methenyltetrahydrofolate cyclohydrolase [Ruminococcus flavefaciens
           FD-1]
          Length = 285

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/293 (51%), Positives = 202/293 (68%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK V++ +  ++A+  A L+ E G++VGLAVV+VGNDPAS  YV+ K +  +  
Sbjct: 1   MAQIIDGKAVSAAVKQEVADETAKLRDEKGLKVGLAVVIVGNDPASRVYVNNKKKACEAV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S +Y    + +Q  L + V  LN+DD ++GILVQLPLP  + E+++I +I P+KDVD
Sbjct: 61  GFQSYEYALDENTTQEQLLDLVNVLNRDDRVNGILVQLPLPKHIDEKAVINAISPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H +N GK+MIG+++   +PCTPAG + LIE   G D++G+  VVIGRSN+ GKP   L
Sbjct: 121 AFHPINVGKIMIGEYS--FLPCTPAGVMRLIES-TGTDITGKQCVVIGRSNIVGKPQAML 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +N TVT+ HSKTKNL EIC  ADILVVA+GR   V  D IK G++VIDVG+NR+ + 
Sbjct: 178 LLQKNGTVTICHSKTKNLKEICLGADILVVAIGRANFVTGDMIKEGAVVIDVGMNRLEN- 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  +     ITPVPGGVGPMTIAMLM NT+ AA +  G++
Sbjct: 237 --GK--LCGDVEFESAEKKASFITPVPGGVGPMTIAMLMKNTLTAAKQQAGIE 285


>gi|325680180|ref|ZP_08159745.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Ruminococcus albus 8]
 gi|324108129|gb|EGC02380.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Ruminococcus albus 8]
          Length = 283

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 203/292 (69%), Gaps = 10/292 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK V++ + ++I + V  LK + GV++GLAVV+VG+DPAS  YV  K +  +  
Sbjct: 1   MANIIDGKAVSAQVKEEIRQEVEALKAK-GVEIGLAVVIVGDDPASQVYVKNKEKACETV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF+S +Y  P + ++ +L   V  LNKDD + GILVQLPLP  + ++ II +I P+KDVD
Sbjct: 60  GFNSYKYALPAETTEEELLALVDKLNKDDKVDGILVQLPLPKHLDDKIIINNIRPDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H VN GK+MIGD++   +PCTPAG + LI+   G D++G+  VVIGRSN+ GKP   L
Sbjct: 120 AFHPVNVGKIMIGDYS--FLPCTPAGVMELIKS-TGTDVAGKECVVIGRSNIVGKPQAML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +N TVT+ HSKTKNL E+C  ADILV AVGR +MV  D+IK G++VIDVG+NR    
Sbjct: 177 LLHQNGTVTITHSKTKNLKEVCARADILVAAVGRAKMVTADYIKEGAVVIDVGMNR---D 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + GK  L GDV  ++CK   G ITPVPGGVGPMTIAMLM NT+ A     G+
Sbjct: 234 ENGK--LCGDVDFEDCKEKAGYITPVPGGVGPMTIAMLMKNTLTAGKEHHGI 283


>gi|84516645|ref|ZP_01004004.1| folD bifunctional protein [Loktanella vestfoldensis SKA53]
 gi|84509681|gb|EAQ06139.1| folD bifunctional protein [Loktanella vestfoldensis SKA53]
          Length = 297

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 196/293 (66%), Gaps = 5/293 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK  A+ L   IA+ VA L+   G+  GLAVVLVG DPAS  YV +K +M    G  
Sbjct: 5   VLDGKAFAAKLRITIADHVAALQAGHGIVPGLAVVLVGEDPASQVYVRSKGKMTVEVGMR 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P   S+ DL   +  LN D ++HGILVQLPLP  ++   +I SI P KDVDG H
Sbjct: 65  SFEHRLPDTTSEADLLGLIAQLNADPAVHGILVQLPLPGHLNSDLVINSIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++L+    G  L+G+HAVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKAMVPCTPLGCLMLLRDHHG-SLAGKHAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+T +LP + R ADI+V AVGR RMV  DWIK G+ VIDVGINRI +   G
Sbjct: 182 DSCTVTIAHSRTADLPAMVRQADIVVAAVGRARMVPGDWIKPGATVIDVGINRIVADD-G 240

Query: 244 KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            T LVGDV  D C +V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 241 STSLVGDVDYDSCAAVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 293


>gi|254418411|ref|ZP_05032135.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Brevundimonas sp. BAL3]
 gi|196184588|gb|EDX79564.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Brevundimonas sp. BAL3]
          Length = 307

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 156/302 (51%), Positives = 203/302 (67%), Gaps = 9/302 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK  +  L D++A + A L+   GV+ GLAVV+VG DPAS  YV  K       G 
Sbjct: 9   TLIDGKAFSVDLVDRVAAAAARLEASQGVKPGLAVVIVGEDPASQIYVRNKGETTLRAGM 68

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  +      +Q +L   +  LN D  IHG+LVQLPLP  +    ++ +I P+KDVDG 
Sbjct: 69  RSDTHRLDETTTQDELLALIARLNADAGIHGVLVQLPLPKHIDSSVVLDAIDPDKDVDGF 128

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HVVNAG++ +G    GLVPCTP G+++L++   G DL+G +AV++GRSN+ GKPM QLLL
Sbjct: 129 HVVNAGRLAVG--LPGLVPCTPLGSLMLLKDQLG-DLTGLNAVIVGRSNIVGKPMAQLLL 185

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ- 241
             + TVT+AHS+T++LP +CRTADILV AVGRP M++ DWIK G+ VIDVGINR+ S   
Sbjct: 186 GESCTVTIAHSRTRDLPALCRTADILVAAVGRPEMIKGDWIKPGATVIDVGINRVPSADP 245

Query: 242 ----LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
                GKT +VGDVA  E   + G ITPVPGGVGPMTIA L+ANT  AA RS+G++    
Sbjct: 246 VKAAEGKTRVVGDVAFKEAVEIAGRITPVPGGVGPMTIACLLANTYSAACRSIGVEPEPL 305

Query: 297 DA 298
           DA
Sbjct: 306 DA 307


>gi|254459935|ref|ZP_05073351.1| FolD bifunctional protein [Rhodobacterales bacterium HTCC2083]
 gi|206676524|gb|EDZ41011.1| FolD bifunctional protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 296

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 195/293 (66%), Gaps = 6/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++ E VA LK + G+  GLAVVLVG DPAS  YV +K +M    G  
Sbjct: 5   IIDGKAFAAKVRGQVGEHVAALKADHGITPGLAVVLVGEDPASQVYVRSKGKMTNEVGMK 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV++      S+ DL   +  LN D +IHGILVQLPLP  + E  +I SI P KDVDG H
Sbjct: 65  SVEHKLDEATSEADLLALIEQLNNDATIHGILVQLPLPKHLDEDLVINSINPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHG-SLSGMDAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+TK+LPE+   ADI+V AVGRP MV  +WIK G+ VIDVGINRI   + G
Sbjct: 182 DSCTVTIAHSRTKDLPEVVGRADIVVAAVGRPEMVPGEWIKKGATVIDVGINRIE--RDG 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           K  LVGDV    C +V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 240 KIKLVGDVDFASCSAVAGAITPVPGGVGPMTIACLLANTVTACCRANGLAEPE 292


>gi|85375133|ref|YP_459195.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Erythrobacter litoralis HTCC2594]
 gi|122543626|sp|Q2N7E3|FOLD_ERYLH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|84788216|gb|ABC64398.1| folD bifunctional protein [Erythrobacter litoralis HTCC2594]
          Length = 298

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 197/296 (66%), Gaps = 7/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK  A+ L +++       +   G + GLAVVLVG DPAS  YV  K +       
Sbjct: 4   EIIDGKAFAARLRERVGALAEKFEAAAGRKPGLAVVLVGEDPASEVYVRNKGKATLAANM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P D +  DL   V  LN D ++ GILVQLPLP  + EQSII +I P+KDVDG 
Sbjct: 64  ESFEYKLPADTTAQDLLALVKKLNGDPAVDGILVQLPLPDHLDEQSIIAAISPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV+NAG++ +G    G VPCTP G ++L+    G DLSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HVINAGRLSVG--QRGFVPCTPLGCMMLLADRLG-DLSGLEAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+AHS+T+NLPE+ + ADI+V AVGR  MV+ +W+K G+ VIDVGINR+  P+ 
Sbjct: 181 DANATVTIAHSRTRNLPEVVKRADIVVAAVGRAEMVKPEWLKDGATVIDVGINRL-PPEP 239

Query: 243 GKT--VLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK    LVGDV       V  AITPVPGGVGPMTIA+L+ NT++AA+R+ G+  P+
Sbjct: 240 GKERGRLVGDVDFGRASEVAAAITPVPGGVGPMTIAVLLRNTLVAAHRNEGIDLPE 295


>gi|159043834|ref|YP_001532628.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Dinoroseobacter shibae DFL 12]
 gi|190359426|sp|A8LIR3|FOLD_DINSH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|157911594|gb|ABV93027.1| NADP(+) dependent methylenetetrahydrofolate dehydrogenase
           [Dinoroseobacter shibae DFL 12]
          Length = 299

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 194/294 (65%), Gaps = 5/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK  A+ +  K+A +V  L+   G+  GLAVVLVG DPAS  YV+ K R     G 
Sbjct: 4   EIIDGKAFAAGVRAKVAHNVETLRDTHGITPGLAVVLVGEDPASEVYVANKHRQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  +  P   S+ DL   +  LN D ++HGIL Q P+P  ++E++++  I P KDVDGL
Sbjct: 64  ASFSHKLPAKTSEADLFALIDQLNADPAVHGILCQFPVPEHLNERAVVARIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
            VVNAG +  G+   GLV CTP G ++L+    G DLSG  AVVIGRSNLFGKPMGQLLL
Sbjct: 124 SVVNAGLLASGE--RGLVSCTPLGCLMLLRDRLG-DLSGLEAVVIGRSNLFGKPMGQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP-Q 241
             NATVTMAHS+T++L ++CR ADILV AVGR  MV+ DW+K G+ VIDVGI R   P  
Sbjct: 181 RENATVTMAHSRTRDLAQVCRRADILVAAVGRAEMVKADWVKPGATVIDVGITRQPHPDD 240

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
             KT L+GDV       V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P
Sbjct: 241 PDKTRLLGDVDFAAVAEVAGAITPVPGGVGPMTIACLLANTVTACCRAHGLPEP 294


>gi|254510067|ref|ZP_05122134.1| bifunctional protein FolD [Rhodobacteraceae bacterium KLH11]
 gi|221533778|gb|EEE36766.1| bifunctional protein FolD [Rhodobacteraceae bacterium KLH11]
          Length = 296

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 155/293 (52%), Positives = 198/293 (67%), Gaps = 6/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++A+ VA LK+E G+  GLAVVLVG DPAS  YV +K +M    G +
Sbjct: 5   VIDGKAFAAKVRAQVADQVAKLKEEHGITPGLAVVLVGEDPASQVYVRSKGKMTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++    D S+ DL   +  LN D +++GILVQLPLP  ++E  +I SI P KDVDG H
Sbjct: 65  SYEHKLDADTSEEDLLALIDKLNNDPAVNGILVQLPLPKHLNEDLVINSIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHGS-LSGMDAVVIGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+TK+LPE+ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + G
Sbjct: 182 DSCTVTIAHSRTKDLPEVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRIE--RDG 239

Query: 244 KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           K  LVGDV         GAITPVPGGVGPMTIA L+ANT+ AA R+ G+  P+
Sbjct: 240 KNKLVGDVDYASAAERAGAITPVPGGVGPMTIACLLANTLTAACRANGLAEPE 292


>gi|90421587|ref|YP_529957.1| methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           BisB18]
 gi|119370033|sp|Q21D98|FOLD_RHOPB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|90103601|gb|ABD85638.1| Methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           BisB18]
          Length = 295

 Score =  285 bits (728), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 151/292 (51%), Positives = 201/292 (68%), Gaps = 4/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +++ L  K+A+ VA + ++ GV  GLAVVLVG+DPAS  YV +K +  K  G  
Sbjct: 5   IIDGKTISAELRGKLADEVARVVRDHGVTPGLAVVLVGSDPASEVYVRSKHKQTKEAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D+ Q +L   +  LN D ++HGILVQLPLP  +   ++I ++ P KDVDGL+
Sbjct: 65  SFEHKLPADVPQAELLALIGQLNADPAVHGILVQLPLPKGLDSNAVIAAVDPAKDVDGLN 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VNAG++  G F   L PCTP G I++ +Q     L G +A+VIGRSNL GKP+ QLLL+
Sbjct: 125 PVNAGRLASGLFA--LTPCTPLGCIVMAKQVH-ASLEGMNAIVIGRSNLVGKPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS++++LP +CR AD++  AVG+P MV+ +WIK G+ VIDVGINR  SP  G
Sbjct: 182 ENATVTIAHSRSRDLPALCRQADLVFAAVGKPEMVRGNWIKPGATVIDVGINRTPSPDGG 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  LVGDVA  E K V GAITPVPGGVG MT+A L+ NT+ AA    G+  P
Sbjct: 242 KDKLVGDVAFAEAKEVAGAITPVPGGVGLMTVACLLVNTLRAACAIHGLPKP 293


>gi|126733586|ref|ZP_01749333.1| FolD bifunctional protein [Roseobacter sp. CCS2]
 gi|126716452|gb|EBA13316.1| FolD bifunctional protein [Roseobacter sp. CCS2]
          Length = 297

 Score =  284 bits (727), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 152/294 (51%), Positives = 201/294 (68%), Gaps = 5/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++A+ VA L++E G+  GLAVVLVG DPAS  YV +K +M    G 
Sbjct: 4   TVIDGKAFAAKVRGQVAKGVAKLQEEQGIIPGLAVVLVGEDPASQVYVRSKGKMTAEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+++   V  S+ DL   +  LN D ++HGILVQLPLP  +    +I SI P KDVDG 
Sbjct: 64  KSIEHKLDVQTSEADLLALIDQLNNDPAVHGILVQLPLPDHLDSDLVINSIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G+++++    G  LSG +AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGSLMMLRDHHG-SLSGMNAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T++L  + R ADI+V AVGRP+MV  +WIK G+ VIDVGINRI+ P  
Sbjct: 181 GDSCTVTIAHSRTQDLEAVVRQADIVVAAVGRPQMVTGNWIKPGATVIDVGINRIDKPD- 239

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           G T LVGD   E C +V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 240 GGTRLVGDCDYESCAAVAGAITPVPGGVGPMTIACLLANTLTACCRANGLAEPE 293


>gi|85706703|ref|ZP_01037795.1| folD bifunctional protein [Roseovarius sp. 217]
 gi|85668761|gb|EAQ23630.1| folD bifunctional protein [Roseovarius sp. 217]
          Length = 296

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 197/293 (67%), Gaps = 6/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  K+A  V  LK+  G+  GLAVVLVG DPAS  YV +K +     G +
Sbjct: 5   VIDGKAFAAEVRAKVASHVTRLKEANGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++   VD S+ DL   +  LNKD ++HGILVQLPLP  +    +I SI P KDVDG H
Sbjct: 65  SYEHKLDVDTSEADLLALIDQLNKDATVHGILVQLPLPKHLDSDLVINSIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  L+G  AVV+GRSN+ GKPM QLLL 
Sbjct: 125 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHG-SLAGMDAVVLGRSNIVGKPMAQLLLG 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+TK++ ++CR ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + G
Sbjct: 182 DSCTVTIAHSRTKDIADVCRRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRIE--RDG 239

Query: 244 KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           KTVLVGDV      +V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 240 KTVLVGDVDYASVAAVAGAITPVPGGVGPMTIACLLANTLTACCRANGLTEPE 292


>gi|75674678|ref|YP_317099.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Nitrobacter
           winogradskyi Nb-255]
 gi|119370013|sp|Q3SVE4|FOLD_NITWN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|74419548|gb|ABA03747.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Nitrobacter
           winogradskyi Nb-255]
          Length = 294

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 202/293 (68%), Gaps = 5/293 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           S+IDGKV+A+ L  ++A  V  +K++ G+  GLAVVLVGNDPAS  YV  K +  +  G 
Sbjct: 4   SIIDGKVIAADLRARVAGEVTRIKRDHGLTPGLAVVLVGNDPASEVYVRNKHKQTQAAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D++Q D+   +  LN D ++HGILVQLPLP  +  ++II +I P KDVDGL
Sbjct: 64  ASFEHMLPADVAQADVLALIAELNADPAVHGILVQLPLPKGLDTEAIIAAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  NAG++  G   + L PCTP G I+L +      L G  A+VIGRSNL G+P+ QLLL
Sbjct: 124 HPHNAGRLAGG--LSALSPCTPLGCIILTKSVH-ASLEGLDAIVIGRSNLVGRPLVQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+AHS+++NLPE+CR AD++  AVGR  MV+ DW+K G+ VIDVGI R+ + + 
Sbjct: 181 NENATVTIAHSRSRNLPELCRRADLVYAAVGRAEMVRGDWLKPGATVIDVGITRVPAAE- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           GKT L+GDVA DE   V GA+TPVPGGVG MT+A L+ NT+ AA    G+ +P
Sbjct: 240 GKTRLIGDVAFDEAMQVAGAVTPVPGGVGQMTVACLLVNTLRAACAIEGLSAP 292


>gi|56551810|ref|YP_162649.1| methenyltetrahydrofolate cyclohydrolase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|260752626|ref|YP_003225519.1| Methenyltetrahydrofolate cyclohydrolase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|81355143|sp|Q5NP22|FOLD_ZYMMO RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|56543384|gb|AAV89538.1| Methenyltetrahydrofolate cyclohydrolase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|258551989|gb|ACV74935.1| Methenyltetrahydrofolate cyclohydrolase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 297

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 196/288 (68%), Gaps = 9/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  +S L +KIAE V   KKE  V  GLAVVLVG DPAS  YV  K  M    G +
Sbjct: 6   IIDGKEFSSNLRNKIAEDVKAFKKERNVVPGLAVVLVGEDPASRIYVRKKEEMTTAVGMN 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+ Y    + SQ +L + + +LN D ++HGILVQLPLP  +   +I+++I P+KDVDG H
Sbjct: 66  SLSYRLDANASQQELLDLIETLNHDPAVHGILVQLPLPKHIDTPTILEAIDPDKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ IG  T  LVPCTPAG ++L+E   G  L G++A+VIGRS + G+PM QLLL+
Sbjct: 126 VVNAGRLAIG--TPSLVPCTPAGCMMLLEHSLG-SLKGKNALVIGRSTIVGRPMAQLLLA 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
            + TVT+AH  TKNL E+CR ADI+V AVG P  V+  W+K G++VIDVGINR+ +    
Sbjct: 183 ADCTVTVAHRHTKNLEELCRQADIVVAAVGIPHFVKASWLKPGAVVIDVGINRVPAEDEA 242

Query: 242 ---LGKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
               GKT +VGDV   E   V  AITPVPGGVGPMTIA L+ NTV AA
Sbjct: 243 AKAAGKTRIVGDVDFVEAAKVASAITPVPGGVGPMTIACLLNNTVQAA 290


>gi|241761869|ref|ZP_04759955.1| Methenyltetrahydrofolate cyclohydrolase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373783|gb|EER63343.1| Methenyltetrahydrofolate cyclohydrolase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 297

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 196/288 (68%), Gaps = 9/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  +S L +KIAE V   KKE  V  GLAVVLVG DPAS  YV  K  M    G +
Sbjct: 6   IIDGKEFSSNLRNKIAEDVKTFKKERNVVPGLAVVLVGEDPASRIYVRKKEEMTTAVGMN 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+ Y    + SQ +L + + +LN D ++HGILVQLPLP  +   +I+++I P+KDVDG H
Sbjct: 66  SLSYRLDANASQQELLDLIETLNHDPAVHGILVQLPLPKHIDTPTILEAIDPDKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ IG  T  LVPCTPAG ++L+E   G  L G++A+VIGRS + G+PM QLLL+
Sbjct: 126 VVNAGRLAIG--TPSLVPCTPAGCMMLLEHSLG-SLKGKNALVIGRSTIVGRPMAQLLLA 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
            + TVT+AH  TKNL E+CR ADI+V AVG P  V+  W+K G++VIDVGINR+ +    
Sbjct: 183 ADCTVTVAHRHTKNLEELCRQADIVVAAVGIPHFVKASWLKPGAVVIDVGINRVPAEDEA 242

Query: 242 ---LGKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
               GKT +VGDV   E   V  AITPVPGGVGPMTIA L+ NTV AA
Sbjct: 243 AKAAGKTRIVGDVDFVEAAKVASAITPVPGGVGPMTIACLLNNTVQAA 290


>gi|51892985|ref|YP_075676.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Symbiobacterium thermophilum IAM 14863]
 gi|81388733|sp|Q67NB1|FOLD_SYMTH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|51856674|dbj|BAD40832.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Symbiobacterium thermophilum IAM 14863]
          Length = 286

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 198/288 (68%), Gaps = 8/288 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA+ + +++A  VA LK E G+  GLAVVLVG+DPAS  Y + K R AK  G H
Sbjct: 5   VIDGKQVAAQVQEEVAREVAALKAE-GLTPGLAVVLVGDDPASKVYTANKERTAKELGMH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV Y+ P   +Q +L + V+ LN+D +IHGILVQ PLP  +   ++I+ I P KDVDG H
Sbjct: 64  SVLYHLPATTTQQELADLVMQLNRDPAIHGILVQSPLPEGLDMDAVIRLIDPRKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G++ IG    GLVPCTPAG + L++ + G D  G+HAVV+GRSN+ GKPM  LLL 
Sbjct: 124 PENVGRLWIGQ--DGLVPCTPAGVMRLLDAY-GVDPKGKHAVVVGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           R+ATVT+ HS+T +L E CR ADILV AVGR +M+  + +K G++VIDVGIN +  P   
Sbjct: 181 RHATVTICHSRTPDLAETCRRADILVAAVGRLQMITAEHVKPGAVVIDVGINPV--PGFK 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K +  GDV  D  + V G ITPVPGGVGPMTIAMLMANTV AA    G
Sbjct: 239 KRIR-GDVDFDSVQEVAGLITPVPGGVGPMTIAMLMANTVKAARMQTG 285


>gi|146308488|ref|YP_001188953.1| methenyltetrahydrofolate cyclohydrolase [Pseudomonas mendocina ymp]
 gi|190359417|sp|A4XY05|FOLD3_PSEMY RecName: Full=Bifunctional protein FolD 3; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|145576689|gb|ABP86221.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Pseudomonas
           mendocina ymp]
          Length = 307

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 194/283 (68%), Gaps = 7/283 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +  ++AE V  LK   G+   LAVVLVG+DPAS  YV  K   A+ CG  
Sbjct: 9   LIDGKAAAARVLAEVAEDVRALKA-AGIVPALAVVLVGDDPASQVYVRNKVLRAEECGIR 67

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D ++  L+  +  LN D S+HGILVQLPLP+ + EQ ++Q++ P KDVDG H
Sbjct: 68  SLEFKLPADTAEARLQALIAELNADASVHGILVQLPLPAHIDEQRVLQAVTPLKDVDGFH 127

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTPAG + L++   G DL+G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 128 AENVGGLSQGREV--LTPCTPAGCLRLLQDSCG-DLTGKHAVVIGRSNIVGKPMAALLLK 184

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HSK+ NL  +CR ADI+V AVGRPR+V  DW+K G++VIDVGINRI+  + G
Sbjct: 185 AHCSVTVVHSKSANLKTLCRQADIVVAAVGRPRLVDADWLKPGAVVIDVGINRID--ENG 242

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           ++ LVGDV  D     V AITPVPGGVGPMTIA LM NT++AA
Sbjct: 243 RSRLVGDVDFDSALPQVSAITPVPGGVGPMTIAYLMKNTLVAA 285


>gi|260431099|ref|ZP_05785070.1| bifunctional protein FolD [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414927|gb|EEX08186.1| bifunctional protein FolD [Silicibacter lacuscaerulensis ITI-1157]
          Length = 296

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 197/294 (67%), Gaps = 6/294 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK  A+ +  ++A+ VA LK+E G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   QVIDGKAFAAKVRAQVADKVAKLKEEHGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    + S+ DL   +  LN D ++HGILVQLPLP  ++E  +I +I P KDVDG 
Sbjct: 64  NSYEHKLDAETSEQDLLALIDKLNNDPAVHGILVQLPLPKHLNEDLVINAINPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G +  G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVGLLATGQ--KAMVPCTPLGCLMMLRDHHG-SLSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T+NLPE+ R ADI+V AVGRP MV  DWIK G+ VIDVGINR+   + 
Sbjct: 181 GDSCTVTIAHSRTRNLPEVVRRADIVVAAVGRPEMVPGDWIKEGATVIDVGINRVE--RD 238

Query: 243 GKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GKT LVGDV     S   GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 239 GKTRLVGDVDYASASERAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPE 292


>gi|299133136|ref|ZP_07026331.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Afipia sp.
           1NLS2]
 gi|298593273|gb|EFI53473.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Afipia sp.
           1NLS2]
          Length = 294

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 150/284 (52%), Positives = 197/284 (69%), Gaps = 5/284 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           S+IDGKV+A+ L + +A  VA LK+   +  GLAVVL+GNDPAS  YV +KT+     G 
Sbjct: 4   SVIDGKVIAAKLREDVAAEVAQLKRYHNLTPGLAVVLIGNDPASEVYVGSKTKQTHAAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D  Q D+   +  LN+D S+HGILVQLPLP  +   +I+ +I P KDVDGL
Sbjct: 64  NSFEHKLSADTPQADVLALIDKLNRDPSVHGILVQLPLPKGLDANTIVNAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VNAG++  G   + L PCTP G I+L +      L G +A+V+GRSNL G+P+ QLLL
Sbjct: 124 HPVNAGRLASG--LSALTPCTPLGCIILAKTVHA-SLEGMNAIVLGRSNLVGRPLVQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+AHS+T++LP +CR AD++  AVGRP MV+ DWIK G+ VIDVGINR+   + 
Sbjct: 181 NENATVTIAHSRTRDLPALCRQADLVFAAVGRPEMVKRDWIKPGATVIDVGINRLPG-EG 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GK+ LVGDVA  E   V GA+TPVPGGVG MT+A L+ NTV AA
Sbjct: 240 GKSRLVGDVAYAEAMEVAGAVTPVPGGVGQMTVACLLVNTVRAA 283


>gi|56696443|ref|YP_166800.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Ruegeria
           pomeroyi DSS-3]
 gi|56697933|ref|YP_168304.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Ruegeria
           pomeroyi DSS-3]
 gi|81349146|sp|Q5LNV2|FOLD1_SILPO RecName: Full=Bifunctional protein FolD 1/3; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|56678180|gb|AAV94846.1| folD bifunctional protein [Ruegeria pomeroyi DSS-3]
 gi|56679670|gb|AAV96336.1| folD bifunctional protein [Ruegeria pomeroyi DSS-3]
          Length = 296

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 154/293 (52%), Positives = 194/293 (66%), Gaps = 6/293 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++AE VA LK   G+  GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TVIDGKAFAARIRGQVAEHVAELKAGHGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S ++    D S+ DL   +  LN D  +HGILVQLPLP  + E  +I +I P KDVDG 
Sbjct: 64  NSYEHKLDADTSEADLLALIDRLNGDPDVHGILVQLPLPGHLDEDLVINAIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG  AVVIGRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHGS-LSGMDAVVIGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+L ++ R ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + 
Sbjct: 181 GDSCTVTIAHSRTKDLADVVRRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRIE--RD 238

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           GKT LVGDV  D C  V GAITPVPGGVGPMTIA L+ANT+ A  R+  +  P
Sbjct: 239 GKTRLVGDVHYDSCAQVAGAITPVPGGVGPMTIACLLANTLTACTRANKLTEP 291


>gi|317057837|ref|YP_004106304.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Ruminococcus
           albus 7]
 gi|315450106|gb|ADU23670.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Ruminococcus
           albus 7]
          Length = 283

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 151/292 (51%), Positives = 201/292 (68%), Gaps = 10/292 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK V++ + + I + V  LK + G+++GLAVV+VG+DPAS  YV  K +  +  
Sbjct: 1   MANIIDGKAVSAQVKEGIRQEVEALKAK-GIEIGLAVVIVGDDPASQVYVKNKEKACEAV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF+S +Y  P + ++ +L   V  LNKDD + GILVQLPLP  + ++ II +I P+KDVD
Sbjct: 60  GFNSYKYALPAETTEEELLALVDKLNKDDKVDGILVQLPLPKHLDDKIIINNIRPDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H VN GK+MIGD++   +PCTPAG + LI+   G +++G+  VVIGRSN+ GKP   L
Sbjct: 120 AFHPVNVGKIMIGDYS--FLPCTPAGVMELIKS-TGTEVAGKECVVIGRSNIVGKPQAML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HSKTKNL E+C  ADILV AVGR +MV  D+IK G++VIDVG+NR    
Sbjct: 177 LLHENGTVTITHSKTKNLKEVCARADILVAAVGRAKMVTADYIKEGAVVIDVGMNR---D 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + GK  L GDV  ++CK   G ITPVPGGVGPMTIAMLM NT+ A     G+
Sbjct: 234 ENGK--LCGDVDFEDCKEKAGFITPVPGGVGPMTIAMLMKNTLTAGKEHHGV 283


>gi|326386837|ref|ZP_08208452.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208640|gb|EGD59442.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 291

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 159/292 (54%), Positives = 198/292 (67%), Gaps = 8/292 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +  LIDGK +A+ L   +A  VA +  + G + GLAVVLVG DPAS  YV  K R     
Sbjct: 2   VAQLIDGKAIAARLRQDLAVEVAAMTAQ-GHRPGLAVVLVGEDPASQVYVRNKARQTVEV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S +Y  P    Q +L   V  LN D ++ GILVQLPLP  +   +++++I+PEKDVD
Sbjct: 61  GMESFEYRLPASTGQDELLALVDRLNADPAVDGILVQLPLPPQIDATTVLRAILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G V  G    G+VPCTP G+++LIE  +  DL+G +AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPTNVGLVATG--AGGIVPCTPLGSMMLIETVRR-DLAGLNAVVIGRSNIVGKPMVQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+   TVT+AHSKT +LP +CR ADILV AVGRP MV+ DW+K G++VIDVGINR+   
Sbjct: 178 LLAAGCTVTVAHSKTVDLPGLCRRADILVAAVGRPEMVRGDWVKPGAIVIDVGINRVTGA 237

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA--YRSL 289
             GK+ LVGDVA  E ++V GAITPVPGGVGPMTIA L+ NTV AA   RSL
Sbjct: 238 D-GKSRLVGDVAFAEAQAVAGAITPVPGGVGPMTIACLLHNTVKAAAVRRSL 288


>gi|89053474|ref|YP_508925.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Jannaschia sp. CCS1]
 gi|119369800|sp|Q28TR2|FOLD_JANSC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|88863023|gb|ABD53900.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Jannaschia sp. CCS1]
          Length = 308

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 195/295 (66%), Gaps = 7/295 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++A  V  LK E G+  GLAVVLVG DPAS  YVS K +     G  
Sbjct: 14  IIDGKAFAADVRGQVAGHVQRLKDEHGITPGLAVVLVGEDPASEVYVSHKHKATVEVGMT 73

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D S+ DL   +  LN D ++HGIL Q P+P  + E+  +  I P KDVDGL 
Sbjct: 74  SFEHKLPADTSEDDLFALIDKLNADPAVHGILCQFPVPDHLDERRTVARISPAKDVDGLS 133

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIE-QFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           V NAG +  G     LV CTP G ++L+  +F    LSG+ AVVIGRSNLFGKPM QLLL
Sbjct: 134 VTNAGLLSSG--GEALVSCTPLGCLMLLRAEFDS--LSGKDAVVIGRSNLFGKPMAQLLL 189

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP-Q 241
             N TVT+AHS+TK+L ++CR ADILV AVGR  MV+ DWIK G+ VIDVGI+R+  P +
Sbjct: 190 GDNCTVTIAHSRTKDLADVCRRADILVAAVGRAEMVRGDWIKPGATVIDVGISRVPHPDK 249

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            GKT L+GDV   E   V GAITPVPGGVGPMTIA L+ANTV A  R+ G+  P+
Sbjct: 250 PGKTKLIGDVHFAEAVDVAGAITPVPGGVGPMTIACLLANTVTACCRAHGLDEPR 304


>gi|316931645|ref|YP_004106627.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Rhodopseudomonas
           palustris DX-1]
 gi|315599359|gb|ADU41894.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Rhodopseudomonas
           palustris DX-1]
          Length = 295

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 197/292 (67%), Gaps = 4/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK++++ L  ++A  VA LK + G+  GLAVVLVGNDPAS  YV +K +  +  G  
Sbjct: 5   IIDGKIISAELRARVAAEVARLKTDHGITPGLAVVLVGNDPASEVYVRSKHKQTQEAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D+ Q +L   +  LN D ++HGILVQLPLP  +   ++I +I P KDVDGL+
Sbjct: 65  SFEHRLPADVPQAELMALIAKLNADPAVHGILVQLPLPKGLDSNAVIDAIDPAKDVDGLN 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             NAG++  G F   L PCTP G+I++ +      L G +A+VIGRSNL GKP+ QLLL+
Sbjct: 125 PTNAGRLASGLFA--LTPCTPLGSIIMAKTVH-ASLEGMNALVIGRSNLVGKPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS+T++LP + R AD++  AVG+  MV+ DWIK G+ VIDVGINR      G
Sbjct: 182 ENATVTIAHSRTRDLPALSRQADLVFAAVGKAEMVKGDWIKPGATVIDVGINRTPGKDGG 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  L+GDVA DE K V GAITPVPGGVG MT+A L+ NTV AA    G+  P
Sbjct: 242 KDKLLGDVAFDEAKEVAGAITPVPGGVGLMTVACLLVNTVRAACAIHGLPKP 293


>gi|84501660|ref|ZP_00999832.1| folD bifunctional protein [Oceanicola batsensis HTCC2597]
 gi|84390281|gb|EAQ02840.1| folD bifunctional protein [Oceanicola batsensis HTCC2597]
          Length = 300

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 196/296 (66%), Gaps = 6/296 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DGK   + +  ++A+ VA L  +  ++ GLAVVLVG DPAS  YV  K    K  G 
Sbjct: 4   EILDGKAFGAKIRARVADHVARLVADHDLRPGLAVVLVGEDPASQVYVRNKGIATKEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++  P D ++ DL   +  LN D +IHGILVQ P+P  +SE+ I+  I P KDVDGL
Sbjct: 64  KSVEHKLPADTTEADLYALIDELNADPTIHGILVQFPVPDQLSERDIVARIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
            V NAG  ++      +V CTP G ++L+ +  G  LSG+ AVVIGRSNL GKPM QLLL
Sbjct: 124 SVTNAG--LLASGQRAMVSCTPLGCLMLLRETLGS-LSGKDAVVIGRSNLVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T ++ E  R ADI+V AVGRPRMV  DWIK G+ VIDVGINRI +P+ 
Sbjct: 181 RDSCTVTIAHSRTADIAETVRRADIVVAAVGRPRMVPGDWIKPGACVIDVGINRIPAPEK 240

Query: 243 --GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             GKT LVGDV  D  + V G ITPVPGGVGP+TIA L+ANTV AA R  G+  P+
Sbjct: 241 GEGKTRLVGDVDFDSAREVAGQITPVPGGVGPLTIACLLANTVTAACRINGLDEPE 296


>gi|190891657|ref|YP_001978199.1| folD2 [Rhizobium etli CIAT 652]
 gi|190696936|gb|ACE91021.1| folD2 [Rhizobium etli CIAT 652]
          Length = 298

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/287 (51%), Positives = 195/287 (67%), Gaps = 4/287 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ L ++I   V  L+  TG   GLAVVLVG+DPAS  YV++K R     G  S
Sbjct: 12  IDGKEYAAGLLERIKADVETLQATTGAVPGLAVVLVGHDPASAIYVASKHRQTVAAGMRS 71

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            +Y    + +Q +L + V  LN D  +HGILVQLPLP+ +   ++IQ+I PEKDVDG HV
Sbjct: 72  FEYRLAQETTQGELLDLVHHLNNDAEVHGILVQLPLPAHLDPNAVIQAINPEKDVDGFHV 131

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            NAG++  G+    LVPCTP G ++LI+   G  LSG HAV++G+SN+ GKPM Q+L++ 
Sbjct: 132 SNAGRLATGN--PALVPCTPLGCMMLIKDTLGESLSGLHAVIVGKSNIVGKPMAQMLMNA 189

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+ HS+T+N  E+CRTADILVVA GR  +V+ DWIK G++VIDVGINRI   +  K
Sbjct: 190 HCTVTVVHSQTRNAAELCRTADILVVAAGRAGLVRGDWIKPGAVVIDVGINRIEDGE--K 247

Query: 245 TVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + +VGDVA        AITPVPGGVGPMTIA L++NT+ A  R   M
Sbjct: 248 SRIVGDVAYGEAGHARAITPVPGGVGPMTIACLLSNTLTAFRRHHAM 294


>gi|146337437|ref|YP_001202485.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bradyrhizobium sp. ORS278]
 gi|158705717|sp|A4YK09|FOLD_BRASO RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|146190243|emb|CAL74235.1| bifunctional: 5,10-methylene-tetrahydrofolate dehydrogenase;
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bradyrhizobium sp. ORS278]
          Length = 294

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 199/292 (68%), Gaps = 5/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK++A+ L  ++A  V  +K + G+  GLAVVLVGNDPAS  YV +K    +  G  
Sbjct: 5   IIDGKIIAADLRAQVAREVERVKHDLGLTPGLAVVLVGNDPASEVYVRSKHTQTQAAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D++Q +L   +  LN+D S+HGILVQLPLP  +  +++I +I P KDVDGLH
Sbjct: 65  SFEHKLPADVAQAELLALISKLNQDPSVHGILVQLPLPKGLDTEAVINAIDPAKDVDGLH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             NAG++  G     L PCTP G I+L +      L G +A+VIGRSNL G+P+ QLLL+
Sbjct: 125 PHNAGRLAGGQ--PALAPCTPLGCIILSKTVH-ASLEGMNAIVIGRSNLVGRPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS++++LP +   AD++  AVGRP MV+ DWIK G+ VIDVGINRI +P+ G
Sbjct: 182 ENATVTIAHSRSRDLPALTARADLVYAAVGRPEMVKRDWIKPGATVIDVGINRIPTPE-G 240

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           KT LVGDVA  E   V GAITPVPGGVG MT+A L+ NT+ AA    G+  P
Sbjct: 241 KTRLVGDVAYAEVAEVAGAITPVPGGVGQMTVACLLVNTLRAACAIAGLPKP 292


>gi|307293982|ref|ZP_07573826.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Sphingobium
           chlorophenolicum L-1]
 gi|306880133|gb|EFN11350.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Sphingobium
           chlorophenolicum L-1]
          Length = 297

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 201/296 (67%), Gaps = 4/296 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +G +IDGK  A  L  K+ + V     +TG + GLAVVLVG DPAS  YV  K +M    
Sbjct: 3   IGKIIDGKAFAETLRGKVGDGVIAFTAKTGRKPGLAVVLVGEDPASSVYVRNKGKMTLAA 62

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+++  P  I + +L + V  LN DD + GILVQLPLP+ ++E S+I +I P KDVD
Sbjct: 63  GMESMEFKLPASIGEEELLDLVEELNADDRVDGILVQLPLPAHINEASVIGTIDPAKDVD 122

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G HVVN+G +  G     +VPCTP G ++L++   G DLSG  AVV+GRSN+ GKPM QL
Sbjct: 123 GFHVVNSGLLATGQ--DAMVPCTPLGCLMLLKDELG-DLSGLEAVVVGRSNIVGKPMAQL 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ N TVT+AHS+T++L  +   ADI+V AVGR  MV+ +WIK G+ VIDVGINR+   
Sbjct: 180 LLAENCTVTIAHSRTRDLASVVHRADIVVAAVGRAEMVKGEWIKPGATVIDVGINRVTDT 239

Query: 241 QLGKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           + GK+ +VGDVA  E  + V AITPVPGGVGPMTIA+L+ NT++AA+   G+  P+
Sbjct: 240 EDGKSRIVGDVATAEALAHVRAITPVPGGVGPMTIAVLLRNTLVAAHARAGLAKPE 295


>gi|149202860|ref|ZP_01879831.1| folD bifunctional protein [Roseovarius sp. TM1035]
 gi|149143406|gb|EDM31442.1| folD bifunctional protein [Roseovarius sp. TM1035]
          Length = 301

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 154/293 (52%), Positives = 198/293 (67%), Gaps = 6/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  K+A  V  LK+E G+  GLAVVLVG DPAS  YV +K +     G +
Sbjct: 10  VIDGKAFAAEVRTKVASHVTRLKEENGITPGLAVVLVGEDPASQVYVRSKGKQTVEVGMN 69

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++   VD S+ DL   +  LNKD ++HGILVQLPLP  +    +I SI P KDVDG H
Sbjct: 70  SYEHKLDVDTSEADLLALIDRLNKDATVHGILVQLPLPKHLDSDLVINSIDPAKDVDGFH 129

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  L+G  AVV+GRSN+ GKPM QLLL 
Sbjct: 130 ISNVG--LLGTGQKSMVPCTPLGCLMMLRDHHG-SLAGMDAVVLGRSNIVGKPMAQLLLG 186

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+TK++ ++CR ADI+V AVGRP MV  DWIK G+ VIDVGINRI   + G
Sbjct: 187 DSCTVTIAHSRTKDIADVCRRADIVVAAVGRPEMVPGDWIKPGATVIDVGINRIE--RDG 244

Query: 244 KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           KTVLVGDV      +V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 245 KTVLVGDVDYASAAAVAGAITPVPGGVGPMTIACLLANTLTACCRANGLAEPE 297


>gi|146308475|ref|YP_001188940.1| methenyltetrahydrofolate cyclohydrolase [Pseudomonas mendocina ymp]
 gi|190359411|sp|A4XXZ2|FOLD2_PSEMY RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|145576676|gb|ABP86208.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Pseudomonas
           mendocina ymp]
          Length = 303

 Score =  278 bits (711), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 149/283 (52%), Positives = 195/283 (68%), Gaps = 7/283 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +  ++ E V  LK   G++  LAVVLVG+DPAS  YV  K   A+ CG  
Sbjct: 9   LIDGKAAAARVLAEVTEDVRTLKA-AGIKPALAVVLVGDDPASQVYVRNKVLRAEECGIR 67

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D ++ DL   + SLN D S+HGILVQLPLP+ + E  ++Q+I P KDVDG H
Sbjct: 68  SLEHKLPADTAEADLLALIHSLNADYSVHGILVQLPLPAHIDETRVLQAINPLKDVDGFH 127

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTPAG + L++   G DL+G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 128 AENVGGLSQGRDV--LTPCTPAGCLRLLQDSCG-DLTGKHAVVIGRSNIVGKPMAALLLK 184

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +V++ HSK+ NL E+CR ADI+V AVG+PR+V  DW+K G++VIDVGINRI+  + G
Sbjct: 185 AHCSVSVVHSKSANLRELCRQADIVVAAVGKPRLVDADWLKPGAVVIDVGINRID--EGG 242

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           ++ LVGDV  D   +   AITPVPGGVGPMTIA LM NT++AA
Sbjct: 243 RSRLVGDVDFDSALTRAAAITPVPGGVGPMTIAFLMKNTLVAA 285


>gi|288960696|ref|YP_003451036.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Azospirillum sp.
           B510]
 gi|288913004|dbj|BAI74492.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Azospirillum sp.
           B510]
          Length = 298

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 153/284 (53%), Positives = 188/284 (66%), Gaps = 5/284 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ LT+ IA  VA L        GLAVVLVG DPAS  YV  K R     G 
Sbjct: 11  TIIDGKAFAASLTEAIAAEVAGLSAAGKRAPGLAVVLVGEDPASQVYVRNKGRQTIAAGM 70

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D ++ DL   V  LN D ++ GILVQLPLP+ ++  ++I +I P KDVDG 
Sbjct: 71  RSFEHRLPADTAETDLIALVRRLNADPAVDGILVQLPLPAHINTNAVIDAIDPAKDVDGF 130

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HVVNAG++  G     LVPCTP G +L+++   G DLSG  AVV+GRSN+ GKPM QLLL
Sbjct: 131 HVVNAGRLAAG--LDALVPCTPLGCLLMLKHVLG-DLSGLRAVVVGRSNIVGKPMAQLLL 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TVT+AHS T++L E CR ADIL+ AVGRP +++ DWIK G+ VIDVGINR   P  
Sbjct: 188 QENCTVTIAHSHTRDLAEECRQADILIAAVGRPGLIKGDWIKPGATVIDVGINRAAGPD- 246

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           G + LVGDV  D    V G ITPVPGGVGPMTIA L+ NT+ AA
Sbjct: 247 GTSRLVGDVDYDAALGVAGHITPVPGGVGPMTIACLLRNTLTAA 290


>gi|92116229|ref|YP_575958.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Nitrobacter
           hamburgensis X14]
 gi|119370010|sp|Q1QQJ9|FOLD_NITHX RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|91799123|gb|ABE61498.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Nitrobacter
           hamburgensis X14]
          Length = 294

 Score =  278 bits (710), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 201/293 (68%), Gaps = 5/293 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           S+IDGKV+A+ L  ++A  VA +K++ G+  GLAVVLVG+DPAS  YV +K +  +  G 
Sbjct: 4   SIIDGKVIAADLRARVAFEVARVKRDHGLTPGLAVVLVGSDPASEVYVRSKHKQTQAAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D++Q DL   V  LN D ++HGILVQLPLP  +  ++I+ +I P KDVDGL
Sbjct: 64  ASFEHVLPADVAQPDLLALVARLNADPAVHGILVQLPLPKGLDTETIVAAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  NAG++  G     L PCTP G I+L +      L G  A+VIGRSNL G+P+ QLLL
Sbjct: 124 HPHNAGRLAGG--LPALSPCTPLGCIILTKSVH-SSLEGMDAIVIGRSNLVGRPLVQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+AHS+++NLPE+CR AD++  AVG+  MV+ DW+K G+ VIDVGI R  +   
Sbjct: 181 NENATVTIAHSRSRNLPELCRRADLVYAAVGKAEMVRGDWLKPGATVIDVGITRRPAAD- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           GKT L+GDVA DE   V GA+TPVPGGVG MT+A L+ NT+ AA    G+ +P
Sbjct: 240 GKTRLIGDVAFDEAMEVAGAVTPVPGGVGQMTVACLLVNTLRAACAIKGLPAP 292


>gi|254514738|ref|ZP_05126799.1| bifunctional protein FolD [gamma proteobacterium NOR5-3]
 gi|219676981|gb|EED33346.1| bifunctional protein FolD [gamma proteobacterium NOR5-3]
          Length = 297

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 196/288 (68%), Gaps = 4/288 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           S+IDGK  A  L +++A  V+ +  E     GLAVVLVG DPAS  YV  K +     G 
Sbjct: 4   SIIDGKAAAQALRERLALEVSRIDAEHSWVPGLAVVLVGEDPASQVYVRNKGKQTAEAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P   S+ +L + V +LN DD+++GILVQLPLP  +  Q +I++I P KDVDG 
Sbjct: 64  RSFEHKLPTSTSERELLDLVRALNADDAVNGILVQLPLPEHIDAQLVIETIEPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLI-EQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
           H +N G +  GD  T LVPCTP G ++++ EQF    ++GQ+AVV+GRSN+ GKPM QLL
Sbjct: 124 HPMNTGGLSNGD-PTALVPCTPLGCLMMLREQFPE-GMAGQNAVVVGRSNIVGKPMAQLL 181

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           ++ + TVT+AHSKT++LP +C+TADILV AVGRP MV+ DW+K G++VIDVGINR+    
Sbjct: 182 IAESCTVTVAHSKTRDLPALCQTADILVAAVGRPEMVRGDWVKEGAVVIDVGINRVEVEG 241

Query: 242 LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             K  LVGDV   E      AITPVPGGVGPMTIA L+ NTV+AA R 
Sbjct: 242 QDKARLVGDVAFAEAAERARAITPVPGGVGPMTIACLLRNTVVAACRQ 289


>gi|326795677|ref|YP_004313497.1| Bifunctional protein folD [Marinomonas mediterranea MMB-1]
 gi|326546441|gb|ADZ91661.1| Bifunctional protein folD [Marinomonas mediterranea MMB-1]
          Length = 301

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/293 (51%), Positives = 195/293 (66%), Gaps = 7/293 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK +A  L   +A+ VA LK+   V  GLAVV+VG+DPAS  YV  K + AK  G +S
Sbjct: 10  IDGKAMADRLVADVAKQVATLKQTEHVIPGLAVVIVGDDPASKVYVGNKIKRAKEAGLNS 69

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
           ++Y  P + +Q +LE  +  LN D  +HGILVQLPLP  +SE  +I+ I  EKDVDG H 
Sbjct: 70  IKYELPENCTQDELEQLIERLNNDADVHGILVQLPLPKPLSEARVIELISAEKDVDGFHP 129

Query: 125 VNAGKVMIGDFTTGLVPCTPAGA-ILLIEQFKG-CDLSGQHAVVIGRSNLFGKPMGQLLL 182
            N G+++ G  +  LVPCTP G  I+L E F G   LSG+HAVVIGRSN+ GKP+ QLLL
Sbjct: 130 QNVGRLVAGQHS--LVPCTPLGCLIMLREHFHGEAALSGKHAVVIGRSNIVGKPLAQLLL 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TV++ HS+T+++  +CR ADIL+ AVGRP++V+ +W+K G++VIDVGIN I S   
Sbjct: 188 QANCTVSIVHSRTRDIETLCRQADILIAAVGRPQLVEKNWVKPGAVVIDVGINAIESD-- 245

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           G   LVGDV       V  AITPVPGGVGPMTIA LM NT+ AA   +    P
Sbjct: 246 GARKLVGDVDFASVSQVASAITPVPGGVGPMTIACLMQNTLNAARMQIQHSDP 298


>gi|307946978|ref|ZP_07662313.1| bifunctional protein FolD [Roseibium sp. TrichSKD4]
 gi|307770642|gb|EFO29868.1| bifunctional protein FolD [Roseibium sp. TrichSKD4]
          Length = 299

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 153/295 (51%), Positives = 199/295 (67%), Gaps = 5/295 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  +IA  V  L  + G+  GLAV+LVG DPAS  YV+AK +     G 
Sbjct: 4   NIIDGKAFATNVRRQIANQVQRLCDDHGITPGLAVILVGEDPASEVYVAAKHKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D SQ DL   +  LN D ++HGIL Q P+P  +SE++++  I P KDVDGL
Sbjct: 64  ASFEHKLPADTSQEDLFALIDQLNSDPAVHGILCQFPVPDHLSERNVVARIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
            VVNAG +  G+  TGLV CTP G ++L+    G ++SG+ AVVIGRSNLFGKPM QLLL
Sbjct: 124 SVVNAGLLASGE--TGLVSCTPLGCLMLLRDQIG-NMSGKEAVVIGRSNLFGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T +L  + R ADILV AVGR  MV+ +WIK G+ VIDVGI RI  P+ 
Sbjct: 181 QEDCTVTIAHSRTADLSAVARRADILVAAVGRAEMVKGNWIKPGATVIDVGITRIPHPEK 240

Query: 243 -GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            GK+ L+GDVA  E   V  A+TPVPGGVGPMTIA L+ANT+ A  R+ G++  K
Sbjct: 241 PGKSRLLGDVAYHEALDVAAAVTPVPGGVGPMTIACLLANTLTACQRANGLEEIK 295


>gi|39933490|ref|NP_945766.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodopseudomonas palustris CGA009]
 gi|192288848|ref|YP_001989453.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodopseudomonas palustris TIE-1]
 gi|81564265|sp|Q6NCQ6|FOLD_RHOPA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|226704393|sp|B3QA91|FOLD_RHOPT RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|39647336|emb|CAE25857.1| putative methylenetetrahydrofolate dehydrogenase [Rhodopseudomonas
           palustris CGA009]
 gi|192282597|gb|ACE98977.1| Methenyltetrahydrofolate cyclohydrolase [Rhodopseudomonas palustris
           TIE-1]
          Length = 295

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 195/292 (66%), Gaps = 4/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +++ +  ++A  V  LK + G+  GLAVVLVGNDPAS  YV +K +  +  G  
Sbjct: 5   IIDGKTISAEVRARVAAEVTRLKTDHGITPGLAVVLVGNDPASEVYVRSKHKQTQEAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D+ Q +L   +  LN D ++HGILVQLPLP  +   ++I +I P KDVDGL+
Sbjct: 65  SFEHRLPADVPQAELMALIAKLNADPAVHGILVQLPLPKGLDSNAVIDAIDPAKDVDGLN 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             NAG++  G F   L PCTP G+I++ +      L G +A+VIGRSNL GKP+ QLLL+
Sbjct: 125 PTNAGRLASGLFA--LTPCTPLGSIIMAKTVH-ASLEGMNALVIGRSNLVGKPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS+T++LP +CR AD++  AVG+  MV+ DWIK G+ VIDVGINR      G
Sbjct: 182 ENATVTIAHSRTRDLPALCRQADLVFAAVGKAEMVKGDWIKPGATVIDVGINRTPGKDGG 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  L+GDVA  E K V GAITPVPGGVG MT+A L+ NTV AA    G+  P
Sbjct: 242 KDKLLGDVAFAEAKEVAGAITPVPGGVGLMTVACLLVNTVRAACAIHGLPKP 293


>gi|87119854|ref|ZP_01075750.1| folD bifunctional protein [Marinomonas sp. MED121]
 gi|86164556|gb|EAQ65825.1| folD bifunctional protein [Marinomonas sp. MED121]
          Length = 287

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 194/288 (67%), Gaps = 6/288 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK +A  + +K+A  VA  K++  V  GLAVVLVG DPAS  YV  K + A   G +S
Sbjct: 5   IDGKALADDIVEKVALDVAAFKRDQKVTPGLAVVLVGEDPASAVYVRNKVKRANQAGLNS 64

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++    D SQ +L+  +  LN+DDS+HGILVQLPLP  + E  +I++I P KDVDG H 
Sbjct: 65  TEHYLAKDTSQEELDKLISQLNQDDSVHGILVQLPLPKHLDESHVIEAISPAKDVDGFHP 124

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G ++ G  +  L+PCTP G ++++ +    DLSG++AVVIGRSN+ GKPM  LLL  
Sbjct: 125 QNVGNLVTGQKS--LIPCTPLGCMIMLNREID-DLSGKNAVVIGRSNIVGKPMASLLLQA 181

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           N TVT  HSKT+ +  ICR ADILV AVG+  +V+ +W+K G+++IDVGIN +     GK
Sbjct: 182 NCTVTTVHSKTQGIESICRNADILVAAVGQALLVKKEWVKPGAVIIDVGINSVEVE--GK 239

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
             L+GDV  D+  S+ GAITPVPGGVGPMTIA LM NT+ AA   LG+
Sbjct: 240 RRLLGDVDYDQVSSIAGAITPVPGGVGPMTIACLMQNTLTAAQHQLGV 287


>gi|294010667|ref|YP_003544127.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Sphingobium
           japonicum UT26S]
 gi|292673997|dbj|BAI95515.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Sphingobium
           japonicum UT26S]
          Length = 297

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 201/296 (67%), Gaps = 4/296 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +G +IDGK  A  L  K+A+ V     +TG + GLAVVLVG DPAS  YV  K +M    
Sbjct: 3   IGKIIDGKAFAETLRGKVADGVGAFIAKTGRKPGLAVVLVGEDPASSVYVRNKGKMTVAA 62

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+++  P  I + +L + V  LN D+ + GILVQLPLP  ++E S+I +I P KDVD
Sbjct: 63  GMESMEFKLPASIGEEELLDLVEELNADERVDGILVQLPLPPHINEASVIGTIDPAKDVD 122

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G HVVN+G +  G     +VPCTP G I+L++   G DLSG  AVV+GRSN+ GKPM QL
Sbjct: 123 GFHVVNSGLLATGQ--EAMVPCTPLGCIMLLKDELG-DLSGLEAVVVGRSNIVGKPMSQL 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ N TVT+AHS+T+++  +   ADI+V AVGR  MV+ +WIK G+ VIDVGINR+   
Sbjct: 180 LLAENCTVTIAHSRTRDIASVVHRADIVVAAVGRAEMVKGEWIKPGATVIDVGINRVTDT 239

Query: 241 QLGKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           + GK+ +VGDVA  E  + V AITPVPGGVGPMTIA+L+ NT++AA+   G+  P+
Sbjct: 240 EDGKSRIVGDVATAEALAHVRAITPVPGGVGPMTIAVLLRNTLVAAHARAGLPRPE 295


>gi|313671976|ref|YP_004050087.1| 5,10-methylenetetrahydrofolate dehydrogenase (nadp+);
           methenyltetrahydrofolate cyclohydrolase
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938732|gb|ADR17924.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+);
           methenyltetrahydrofolate cyclohydrolase
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 285

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 149/294 (50%), Positives = 195/294 (66%), Gaps = 10/294 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK ++  +   + E VAF K++     G+AV+LVGNDPAS  YV+ K +     
Sbjct: 1   MAIVMDGKKLSEKIRGSLKEKVAFYKEKYDRVPGIAVILVGNDPASTVYVNMKEKACLEA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G+ SV    P   S  DL   V   N D++IHGILVQLPLP  + E+ I+ SI P KDVD
Sbjct: 61  GYKSVVERIPESSSTEDLLRLVEKYNADNTIHGILVQLPLPKQIDEKRILYSIDPAKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G + IG+ T  L PCTP G +   E++   DL+G++AVV+GRSN+ GKPM  L
Sbjct: 121 GFHPYNVGLMHIGEDT--LFPCTPYGVMKFFEEY-NIDLTGKNAVVLGRSNIVGKPMSAL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS+TKNLPE+CRTADILV A+G+P  V  D++K G++VIDVGINR++  
Sbjct: 178 LLKANATVTICHSRTKNLPEVCRTADILVAAIGKPNFVTKDFVKEGAVVIDVGINRLD-- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
             GK  LVGDV  DE + +   ITPVPGGVGPMTI MLM NT+ A  +S+ + +
Sbjct: 236 --GK--LVGDVKYDEVEKLASHITPVPGGVGPMTITMLMYNTMKAFEKSIKINN 285


>gi|209883466|ref|YP_002287323.1| bifunctional protein FolD [Oligotropha carboxidovorans OM5]
 gi|226704380|sp|B6JAU5|FOLD_OLICO RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|209871662|gb|ACI91458.1| bifunctional protein FolD [Oligotropha carboxidovorans OM5]
          Length = 294

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 195/291 (67%), Gaps = 5/291 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK +A+ L + +A  VA LK++  +  GLAVVL+GNDPAS  YV +KT+     G  S
Sbjct: 6   IDGKAIAAKLREDVAAEVARLKRDHDLTPGLAVVLIGNDPASEVYVGSKTKQTVAAGMAS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++    D  Q  +   +  LN+D ++HGILVQLPLP  +    I+ +I P KDVDGLH 
Sbjct: 66  FEHKLAADTPQAQVLALIARLNRDPAVHGILVQLPLPKGLDATIIVNAIDPAKDVDGLHP 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           VNAG++  G     L PCTP G I+L +      L G +A+V+GRSNL G+P+ QLLL+ 
Sbjct: 126 VNAGRLASG--LPALTPCTPLGCIILAKTVH-ASLEGMNAIVLGRSNLVGRPLVQLLLNE 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           NATVT+AHS+T+NLP +CR AD++  AVGRP MV+ DWIK G+ VIDVGINR+   + GK
Sbjct: 183 NATVTIAHSRTRNLPALCRQADLVFAAVGRPEMVKGDWIKPGATVIDVGINRLPG-EGGK 241

Query: 245 TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           + LVGDVA  E   V GA+TPVPGGVG MT+A L+ NTV AA    G+ +P
Sbjct: 242 SRLVGDVAYAEAMEVAGAVTPVPGGVGQMTVACLLVNTVRAACAIKGLSAP 292


>gi|294678704|ref|YP_003579319.1| bifunctional protein FolD [Rhodobacter capsulatus SB 1003]
 gi|294477524|gb|ADE86912.1| bifunctional protein FolD-2 [Rhodobacter capsulatus SB 1003]
          Length = 296

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 149/293 (50%), Positives = 194/293 (66%), Gaps = 6/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++A  VA L++  G+  GLAVVLVG DPAS  YV  K    +  G +
Sbjct: 5   IIDGKAFAARVRAEVATHVARLQETQGLTPGLAVVLVGEDPASQVYVKNKGIQTREVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++    D S+ DL   +  LN D ++HGILVQLPLP  +    +I +I P KDVDG H
Sbjct: 65  SYEHKLSADTSEADLLALIARLNADPAVHGILVQLPLPKHLDADLVINAIDPAKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G  ++G     +VPCTP G ++++    G  L+G  AVV+GRSN+ GKPM QLLL+
Sbjct: 125 ISNVG--LLGTGQKAMVPCTPLGCLMMLRDHHG-SLAGLTAVVVGRSNIVGKPMAQLLLA 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+TK+L E+CR ADILV AVGRP M+  DW+K G+ VIDVGINRI   + G
Sbjct: 182 DSCTVTIAHSRTKDLAEVCRRADILVAAVGRPEMIPGDWVKPGATVIDVGINRIE--RDG 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           K  LVGDV  D    V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 240 KGKLVGDVHFDSAVQVAGAITPVPGGVGPMTIACLLANTLTACCRAHGLAEPE 292


>gi|218674898|ref|ZP_03524567.1| folD1 [Rhizobium etli GR56]
          Length = 217

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 165/217 (76%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK VA+ +   +  + A L+K +GV  GLAV++VG+DPAS +YV +K RMAK C
Sbjct: 1   MATVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVIIVGDDPASHAYVGSKGRMAKEC 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF SVQ+  P +  Q +L   V +LN D SIHGILVQLPLP  ++ + IIQSI+PEKDVD
Sbjct: 61  GFKSVQHTLPAETRQEELAALVATLNADPSIHGILVQLPLPKPLASEPIIQSILPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL VVNAGK+  GD  TGLV CTPAGA++ + +  G DLSG +AVVIGRSNLFGKPM QL
Sbjct: 121 GLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLNAVVIGRSNLFGKPMAQL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRM 217
           LL+ NATVTMAHS+TKNL E+CR ADILV AVGRP M
Sbjct: 181 LLNANATVTMAHSRTKNLAEVCRNADILVAAVGRPEM 217


>gi|103488573|ref|YP_618134.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Sphingopyxis
           alaskensis RB2256]
 gi|119370050|sp|Q1GNH1|FOLD_SPHAL RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|98978650|gb|ABF54801.1| Methenyltetrahydrofolate cyclohydrolase [Sphingopyxis alaskensis
           RB2256]
          Length = 302

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/295 (51%), Positives = 201/295 (68%), Gaps = 7/295 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ L  +IA++V   +  TG   GLAVVLVG+DPAS  YV +K +     G  
Sbjct: 10  VIDGKAFAAGLRARIADAVPAFRAATGRAPGLAVVLVGDDPASAVYVGSKGKATVAAGMA 69

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++      +Q ++E  +  LN D+++ GIL+QLPLP  + EQ+ + +I P+KDVDGL 
Sbjct: 70  SFEHRLAATATQDEVEALLRQLNADEAVDGILLQLPLPGHLDEQAAVATIDPDKDVDGLT 129

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            V+AG++ +G    G+VPCTP G +LL++   G DLSG+ A+VIGRS L GKPMGQLLL 
Sbjct: 130 PVSAGRLALG--IPGMVPCTPYGCLLLLQDRLG-DLSGKDAIVIGRSILVGKPMGQLLLG 186

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            N TVTMAHS+TK+LP + R ADI+V AVGR  MV+ DWIK G++VIDVGINR+  P  G
Sbjct: 187 ANCTVTMAHSRTKDLPALVRRADIVVAAVGRAEMVKGDWIKPGAIVIDVGINRL-PPADG 245

Query: 244 --KTVLVGDVADECK-SVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
             K  LVGDV       V  AITPVPGGVGPMTIA L+ NT++AA+R  G+  P+
Sbjct: 246 AAKGRLVGDVDYAAALGVADAITPVPGGVGPMTIACLLRNTLVAAHRRAGLADPE 300


>gi|209549226|ref|YP_002281143.1| methenyltetrahydrofolate cyclohydrolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534982|gb|ACI54917.1| Methenyltetrahydrofolate cyclohydrolase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 298

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 194/287 (67%), Gaps = 4/287 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ L ++I   V  LK  TG   GLAVVLVG+DPAS  YV++K R     G  S
Sbjct: 12  IDGKEYAAELLERIRADVETLKATTGAVPGLAVVLVGDDPASAIYVASKQRQTVAAGMKS 71

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            +Y    + SQ +L   V  LN+D  ++GILVQLPLP  +   ++IQ+I P+KDVDG HV
Sbjct: 72  FEYRLAAETSQDELLELVHRLNEDPEVYGILVQLPLPVHLDPNAVIQAINPDKDVDGFHV 131

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            NAG++  G+    LVPCTP G ++LI+   G +LSG HAV++G+SN+ GKPM Q+L++ 
Sbjct: 132 SNAGRLATGN--PALVPCTPLGCMMLIKATLGENLSGLHAVIVGKSNIVGKPMAQMLMNA 189

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + T+T+ HS+T+N  E+CR ADILVVA GR  +V+ DWIK G++VIDVGINRI   +  K
Sbjct: 190 HCTITVVHSQTRNAAELCRAADILVVAAGRAGLVRGDWIKPGAVVIDVGINRIQDGE--K 247

Query: 245 TVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + +VGDVA        AITPVPGGVGPMTIA L++NT+ A  R   M
Sbjct: 248 SRIVGDVAYGEAGHARAITPVPGGVGPMTIACLLSNTLTAFRRHHAM 294


>gi|27375660|ref|NP_767189.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bradyrhizobium japonicum USDA 110]
 gi|81740252|sp|Q89WX9|FOLD_BRAJA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|27348797|dbj|BAC45814.1| bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase
           [Bradyrhizobium japonicum USDA 110]
          Length = 294

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 203/292 (69%), Gaps = 5/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGKV+A+ L  ++A+ VA +K+E  +  GLAVVLVGNDPAS  YV +K    +  G  
Sbjct: 5   IIDGKVIAADLRARVADEVARVKREHNLVPGLAVVLVGNDPASEVYVRSKGTQTQAAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D+SQ DL   V  LN+D ++HGILVQLPLP  ++ +++I +I P KDVDGLH
Sbjct: 65  SFEHKLPADVSQADLLAVVAKLNRDPAVHGILVQLPLPKGLNTEAVINAIDPAKDVDGLH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             NAG+ + G F   L PCTP G+I+L +      L G +A+VIGRSNL G+P+ QLLL+
Sbjct: 125 PNNAGR-LAGGFEA-LSPCTPLGSIILTKSVH-PSLEGLNAIVIGRSNLVGRPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS++++LP + + AD++  AVG+P MV+ DW+K G+ VID+GI+RI   + G
Sbjct: 182 ENATVTIAHSRSRDLPGLVKRADLVYAAVGKPEMVRGDWLKPGATVIDIGISRIPK-EDG 240

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           KT LVGDVA  E   V GAITPVPGGVG MT+A L+ NT+ AA    G+  P
Sbjct: 241 KTRLVGDVAYQEALGVAGAITPVPGGVGQMTVACLLVNTLRAACAIAGLPKP 292


>gi|225378142|ref|ZP_03755363.1| hypothetical protein ROSEINA2194_03802 [Roseburia inulinivorans DSM
           16841]
 gi|225209948|gb|EEG92302.1| hypothetical protein ROSEINA2194_03802 [Roseburia inulinivorans DSM
           16841]
          Length = 280

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 200/288 (69%), Gaps = 8/288 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK ++  + D++ E V  LK +TG +V LAV+ VGNDPAS  YV  K +  ++ 
Sbjct: 1   MAQIIDGKKISQDIKDELKEKVTALK-DTGTEVALAVIQVGNDPASSVYVRNKKKACEYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y  P + ++  L   +  LNKD++++GILVQLP+P  +    II++I PEKDVD
Sbjct: 60  GIRSLSYELPEETTEDALIELIEKLNKDETVNGILVQLPVPKHIDPDKIIRTISPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N GK++IG+   G V CTPAG I L+++  G ++SG++ VV+GRSN+ GKPM  L
Sbjct: 120 GFHPQNVGKLVIGE--EGFVSCTPAGVIQLLKR-SGIEISGKNCVVVGRSNIVGKPMALL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           +L  NATVT+AHSKTKNL E+C+TADIL+VA+G+P+ +  D++K G++VIDVGI+R  + 
Sbjct: 177 MLRENATVTIAHSKTKNLKELCQTADILIVAIGKPQFITADYVKEGAVVIDVGIHRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           +L   V   +VA++      AITPVPGGVGPMTIAMLM+N V +  R 
Sbjct: 237 KLCGDVRYEEVAEKA----SAITPVPGGVGPMTIAMLMSNCVESLDRE 280


>gi|300024716|ref|YP_003757327.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526537|gb|ADJ25006.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 295

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 199/291 (68%), Gaps = 5/291 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A+ +   +A  VA L+KE G++ GLAVVLVG DPAS  YV+ K +     G +
Sbjct: 6   IIDGKQIAASVRADVAAEVARLQKEHGLKPGLAVVLVGEDPASKVYVANKAKQTVEVGMN 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P + S+ D+   V  LN D + HGILVQLPLP  ++ + ++ SI P+KDVDG H
Sbjct: 66  SWEHRLPAETSEADVLAVVDKLNNDPACHGILVQLPLPKHINAEKVLNSINPDKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++ +G+    LVPCTP G+++L +      LSG  AVVIGRSN+ GKP+  LLL 
Sbjct: 126 PVNVGRLWVGE--RALVPCTPTGSVILAKSVLP-SLSGLDAVVIGRSNIVGKPVAALLLR 182

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            N +VT+AHS+TKN+ ++ + AD++V AVG P MV+  WIK G+ +IDVGINR+ S + G
Sbjct: 183 ENCSVTIAHSRTKNIEDVVKRADLVVAAVGIPEMVKASWIKPGATIIDVGINRVPS-ENG 241

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
           KT LVGDVA +EC  V GAITPVPGGVGPMTIA L+ N   AA    G+KS
Sbjct: 242 KTKLVGDVAYEECAKVAGAITPVPGGVGPMTIACLLRNAAQAAAMIAGVKS 292


>gi|225174885|ref|ZP_03728882.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169525|gb|EEG78322.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Dethiobacter
           alkaliphilus AHT 1]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 196/287 (68%), Gaps = 10/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LI G  VA+ + ++I+  +A LK++TG   GLAV+LVG DPAS +YV  K + A   GF
Sbjct: 4   KLISGPEVAAAIREQISTELASLKEKTGKVPGLAVILVGEDPASQAYVGNKEKTAGKLGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV      DI+Q +L   +  LNKD+ IHGILVQLPLP  + E+++I +I  EKDVDG 
Sbjct: 64  HSVVDRVSADITQEELLKKIDDLNKDEDIHGILVQLPLPDHIEEKAVIDAIAVEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G +MIGD     +PCTP G + ++E   G DL G++AVV+GRSN+ GKP+  L+L
Sbjct: 124 HPINVGNLMIGDDC--YIPCTPHGCMKMLEHI-GYDLKGKNAVVVGRSNIVGKPVALLML 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            ++ATVT+ HS+T +L  +CR AD+LVVAVGRP M+  D +K G++VIDVGINR++    
Sbjct: 181 QQHATVTICHSRTADLGAVCREADVLVVAVGRPNMITGDMVKPGAVVIDVGINRVD---- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  LVGDV  D  K V   ITPVPGGVGPMTI MLM NT+ A  R 
Sbjct: 237 GK--LVGDVEFDSAKEVASYITPVPGGVGPMTITMLMLNTLEAFKRK 281


>gi|23015144|ref|ZP_00054929.1| COG0190: 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 295

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 192/287 (66%), Gaps = 7/287 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG + +  L + IA  VA +K++  V  GLAVVLVG DPAS  YV  K +     G 
Sbjct: 5   KLIDGNLFSGKLRETIAARVAEMKEKHRVTPGLAVVLVGEDPASQVYVRTKGKRTIEAGM 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D  +  L   + SLNKD  +HGILVQLP+P  +  Q +I++I P KDVDG 
Sbjct: 65  RSFEHKLPADTPEDALLLLIESLNKDPDVHGILVQLPVPKHIDTQKVIEAIDPAKDVDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++  G     +VPCTP G++LL++   G  L G  AVVIGRSN+ GKPM QLL+
Sbjct: 125 HPVNVGRLAAG--MDAMVPCTPLGSLLLLKDTLG-KLGGLDAVVIGRSNIVGKPMAQLLI 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LP + R ADI++ AVGRP M++ DWIK G+ VIDVGINRI  P+ 
Sbjct: 182 KESCTVTVAHSQTKDLPSVVRRADIVIAAVGRPEMIKGDWIKPGATVIDVGINRIELPE- 240

Query: 243 GKTVLVGDV--ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GKT LVGDV  A   K V GAITPVPGGVGPMTIA L+ NTV+A  R
Sbjct: 241 GKTKLVGDVDFASAVK-VAGAITPVPGGVGPMTIACLLRNTVVACAR 286


>gi|186939589|dbj|BAG31005.1| putative 5,10-methylene tetrahydrofolate dehydrogenase [Ensifer sp.
           AJ110404]
          Length = 296

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 146/283 (51%), Positives = 193/283 (68%), Gaps = 4/283 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ L +++   V  +K ETGV  GLAVVLVG DPAS  YV++K +     G  S
Sbjct: 10  IDGKQFATGLLERVKADVEAVKAETGVVPGLAVVLVGEDPASALYVASKHKQTMAAGMKS 69

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P + +Q +L   V  LN D  IHGILVQLPLP+ +   ++IQ+I P+KDVDG HV
Sbjct: 70  FEHRLPAETTQAELLVLVNRLNVDPEIHGILVQLPLPAHLDPNAVIQAINPDKDVDGFHV 129

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            NAG++  G+    LVPCTP G ++L++   G +L+G HAV++G+SN+ GKPM Q+L++ 
Sbjct: 130 SNAGRLATGN--PALVPCTPLGCMMLLKDTLGENLAGMHAVIVGKSNIVGKPMAQMLMNA 187

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+ HS+TKN  E CR ADILVVA GR  +V+ DWIK G++VIDVGINRI     GK
Sbjct: 188 HCTVTVVHSQTKNTAEFCRAADILVVAAGRAGLVRGDWIKPGAVVIDVGINRIQVD--GK 245

Query: 245 TVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           + +VGDV         AITPVPGGVGPMTIA L++NT+ A  R
Sbjct: 246 SRIVGDVVYGEAGHARAITPVPGGVGPMTIACLLSNTLTAFRR 288


>gi|254281775|ref|ZP_04956743.1| bifunctional protein FolD [gamma proteobacterium NOR51-B]
 gi|219677978|gb|EED34327.1| bifunctional protein FolD [gamma proteobacterium NOR51-B]
          Length = 282

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 193/284 (67%), Gaps = 5/284 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDGK+ A+ + +++   V    K  G + GL VVLVG DPAS  YV  K + A+  GF
Sbjct: 2   QLIDGKLKAAEILEQVKAGVEGQVKADGARPGLTVVLVGEDPASQVYVRNKEKRAEEAGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +      P   S+ DL   +  LN D S+HGILVQLPLP  ++EQ++I +I PEKDVDG 
Sbjct: 62  NGQLIRLPSTTSESDLLAVIDKLNTDKSVHGILVQLPLPEQINEQAVIGAIAPEKDVDGF 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G+++ GD +  +VPCTP G + LIE     DL G HAV+IGRSN+ GKP+  LLL
Sbjct: 122 HEVNGGRLLNGD-SRAMVPCTPLGCLHLIETVI-PDLKGMHAVIIGRSNIVGKPLSMLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            ++ TVT+ HSKT++LP +C  ADIL+ AVG P +V+ DW+K G++VIDVGINR+   + 
Sbjct: 180 QKSCTVTITHSKTRDLPNVCAGADILIAAVGVPELVKADWVKPGAVVIDVGINRV--ARD 237

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GK VLVGDV  D  + +  AITPVPGGVGPMTIA L++NT+ A+
Sbjct: 238 GKQVLVGDVDFDAVRDIASAITPVPGGVGPMTIACLLSNTLAAS 281


>gi|114771180|ref|ZP_01448600.1| folD bifunctional protein [alpha proteobacterium HTCC2255]
 gi|114548105|gb|EAU50992.1| folD bifunctional protein [alpha proteobacterium HTCC2255]
          Length = 299

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 149/294 (50%), Positives = 193/294 (65%), Gaps = 5/294 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +   +A+ V+ LK +  +  GLAVVLVG D AS  YV  K       G +
Sbjct: 5   IIDGKEFAANVRALVAKQVSKLKNDHNIIPGLAVVLVGEDAASQVYVRNKHASTVEVGMN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D S+ DL   +  LN D+ +HGIL QLPLP  + E+ +I SI+PEKDVDG H
Sbjct: 65  SYEHRLPADTSESDLLGLINELNNDEKVHGILCQLPLPKHLDEELVINSIIPEKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N G +  G  +  +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM  LLL 
Sbjct: 125 ISNVGMLSTGQKS--MVPCTPLGCLMMLRDHHG-SLSGLNAVVVGRSNIVGKPMANLLLR 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP-QL 242
            + TVT+AHS+TKN+ +ICR ADI++ AVGRP M+  DWI  G+ VIDVGINRI  P + 
Sbjct: 182 DSCTVTIAHSRTKNIEDICRRADIVIAAVGRPEMITGDWIADGATVIDVGINRIPHPDKE 241

Query: 243 GKTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK  LVGDV     S   GAITPVPGGVGPMTIA L+ANT+ A  RS G+  P+
Sbjct: 242 GKFKLVGDVDFASASAKAGAITPVPGGVGPMTIACLLANTLTACCRSNGLDEPE 295


>gi|126463074|ref|YP_001044188.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodobacter sphaeroides ATCC 17029]
 gi|158705767|sp|A3PM50|FOLD_RHOS1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|126104738|gb|ABN77416.1| Methenyltetrahydrofolate cyclohydrolase [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 296

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 148/292 (50%), Positives = 197/292 (67%), Gaps = 6/292 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ +  ++AE VA LK+  G+  GLAVVLVG DPAS  YV AK +     G  S
Sbjct: 6   IDGKAFAAGVRARVAEEVARLKEGHGIVPGLAVVLVGEDPASQVYVGAKGKQTVEVGMAS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P + S+ +L   +  LN D ++HGILVQLPLP+ ++   +I ++ P KDVDG H+
Sbjct: 66  FEHRLPAETSEAELLALIDRLNHDPAVHGILVQLPLPAHLNADLVINALDPAKDVDGFHI 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G++  G  +  +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM QLLL  
Sbjct: 126 SNVGRLGTGQKS--MVPCTPLGCLMMLRDHLGT-LSGLNAVVVGRSNIVGKPMAQLLLGE 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+T++L  +CR ADILV AVGRP M+  D++K G+ VIDVGINRI   + GK
Sbjct: 183 SCTVTIAHSRTRDLAAVCRGADILVAAVGRPEMITGDFVKPGATVIDVGINRIE--RDGK 240

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           T LVGDV       V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 241 TKLVGDVDYASAAEVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPQ 292


>gi|310816572|ref|YP_003964536.1| bifunctional protein FolD 2 [Ketogulonicigenium vulgare Y25]
 gi|308755307|gb|ADO43236.1| bifunctional protein FolD 2 [Ketogulonicigenium vulgare Y25]
          Length = 297

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 194/292 (66%), Gaps = 5/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++  +V  LK + G+  GLAVVLVG DPAS  YV  K R     G +
Sbjct: 5   IIDGKAFAAKVRAQVGAAVTALKAQ-GITPGLAVVLVGEDPASQVYVRNKHRQTIEVGMN 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P +  + DL   +  LN D ++ GILVQLPLP+ ++ + +I +I P KDVDG H
Sbjct: 64  SFEHRLPAETPEADLLALIAQLNADTAVDGILVQLPLPAHLNAELVINAIDPTKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + N GK++ G  +  +VPCTP G+++L+    G DL+G  AVVIGRSN+ GKPM  LLL 
Sbjct: 124 IDNVGKLVTGQKS--MVPCTPLGSLMLLRDSLG-DLNGLEAVVIGRSNIVGKPMANLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           +  TVT+AHS+T++LP + R ADI+V AVGRP MV+ +W+K G+ VIDVGINRI      
Sbjct: 181 QGCTVTIAHSRTRDLPAVVRRADIVVAAVGRPEMVKGEWLKPGATVIDVGINRIQPAGAD 240

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  LVGD   D C +V GAITPVPGGVGPMTIA L+ANT+ A  R  G+  P
Sbjct: 241 KAKLVGDCDFDSCAAVAGAITPVPGGVGPMTIACLLANTLTATCRRYGLPEP 292


>gi|332559121|ref|ZP_08413443.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodobacter sphaeroides WS8N]
 gi|332276833|gb|EGJ22148.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodobacter sphaeroides WS8N]
          Length = 296

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/292 (50%), Positives = 196/292 (67%), Gaps = 6/292 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ +  ++AE VA LK+  G+  GLAVVLVG DPAS  YV AK +     G  S
Sbjct: 6   IDGKAFAAGVRARVAEEVARLKEGHGIVPGLAVVLVGEDPASQVYVGAKGKQTVEVGMAS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P + S+ +L   +  LN D ++HGILVQLPLP  ++   +I ++ P KDVDG H+
Sbjct: 66  FEHRLPAETSEAELLALIDRLNHDPAVHGILVQLPLPGHLNADLVINALDPAKDVDGFHI 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G++  G  +  +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM QLLL  
Sbjct: 126 SNVGRLGTGQKS--MVPCTPLGCLMMLRDHLGT-LSGLNAVVVGRSNIVGKPMAQLLLGE 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+T++L  +CR ADILV AVGRP M+  D++K G+ VIDVGINRI   + GK
Sbjct: 183 SCTVTIAHSRTRDLAAVCRGADILVAAVGRPEMITGDFVKPGATVIDVGINRIE--RDGK 240

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           T LVGDV       V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 241 TKLVGDVDYASAAEVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPQ 292


>gi|144900432|emb|CAM77296.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 299

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 191/294 (64%), Gaps = 5/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG   ++ L ++I   V  ++    V  GLAVVLVG DPAS  YV  K + A  CG 
Sbjct: 5   KLIDGNAFSANLREEITARVHEIRDFHHVTPGLAVVLVGEDPASQVYVRNKNKRAAECGM 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D S+  L N +  LN D  +HGILVQLPLP  +  Q +I++I P+KDVDG 
Sbjct: 65  KSFEHVLPADTSEHHLLNLIEGLNDDPEVHGILVQLPLPRHIDAQKVIETIRPDKDVDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N G  M+     G++PCTP G+++++    G  L+G  A+V+GRSN+ GKPM  LL+
Sbjct: 125 HPWNVG--MLASGGIGMIPCTPLGSLMMLRDHLG-PLTGLKAIVVGRSNIVGKPMAHLLI 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T++LP   R ADI+V AVGRP M++ DWIK G+ VIDVGINRI  P  
Sbjct: 182 RESCTVTIAHSQTRDLPAEVRAADIVVAAVGRPEMIRGDWIKPGATVIDVGINRIGLPD- 240

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK+ LVGDV  DE   V GAITPVPGGVGPMTIA L+ NT+ AA R   +  P+
Sbjct: 241 GKSKLVGDVKFDEAVKVAGAITPVPGGVGPMTIACLLRNTLTAAARLHRLDIPE 294


>gi|77464232|ref|YP_353736.1| methenyltetrahydrofolate cyclohydrolase [Rhodobacter sphaeroides
           2.4.1]
 gi|119370036|sp|Q3J049|FOLD_RHOS4 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|77388650|gb|ABA79835.1| Methenyltetrahydrofolate cyclohydrolase [Rhodobacter sphaeroides
           2.4.1]
          Length = 296

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/292 (50%), Positives = 196/292 (67%), Gaps = 6/292 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ +  ++AE VA LK+  G+  GLAVVLVG DPAS  YV AK +     G  S
Sbjct: 6   IDGKAFAAGVRARVAEEVARLKEGHGIVPGLAVVLVGEDPASQVYVGAKGKQTVEVGMAS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P   S+ +L   +  LN D ++HGILVQLPLP+ ++   +I ++ P KDVDG H+
Sbjct: 66  FEHRLPAGTSEAELLALIDRLNHDPAVHGILVQLPLPAHLNADLVINALDPAKDVDGFHI 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G++  G  +  +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM QLLL  
Sbjct: 126 SNVGRLGTGQKS--MVPCTPLGCLMMLRDHLGA-LSGLNAVVVGRSNIVGKPMAQLLLGE 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+T++L  +CR ADILV AVGRP M+  D++K G+ VIDVGINRI   + GK
Sbjct: 183 SCTVTIAHSRTRDLAAVCRGADILVAAVGRPEMITGDFVKPGATVIDVGINRIE--RDGK 240

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           T LVGDV       V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 241 TKLVGDVDYASAAEVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPQ 292


>gi|308049772|ref|YP_003913338.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           ;methenyltetrahydrofolate cyclohydrolase [Ferrimonas
           balearica DSM 9799]
 gi|307631962|gb|ADN76264.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           ;methenyltetrahydrofolate cyclohydrolase [Ferrimonas
           balearica DSM 9799]
          Length = 296

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 191/288 (66%), Gaps = 4/288 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            +LIDGK +A+ + ++I + V  L        GLAVVLVG DPAS  YV  K    +  G
Sbjct: 10  ATLIDGKAIANEVVEEIGQQVRELVAAGQPIPGLAVVLVGEDPASQVYVRNKLLKCQQAG 69

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S +Y  PV+  + DL   ++ LN D  +HGILVQLPLP  + EQ ++Q+I PEKDVDG
Sbjct: 70  IVSREYRLPVETMESDLLGLLVDLNDDPDVHGILVQLPLPKHIDEQKVLQAIAPEKDVDG 129

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H  N G++++G     LVPCTP G ++++ +  G  L+G+H VV+GRSN+ GKP   L 
Sbjct: 130 FHPENLGRLLVG-APDALVPCTPLGCLIMLRRTLGDALAGKHVVVVGRSNIVGKPAALLA 188

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L ++ TVTM HS+++N+  +CR AD+L+VAVGRP +V+ DW+K G++V+DVGINR+    
Sbjct: 189 LQQHCTVTMVHSRSENIEALCRQADVLIVAVGRPELVRADWVKPGAVVLDVGINRVERD- 247

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
            GK  LVGDVA DE   +  AITPVPGGVGPMTIA L+ NT+ A  R 
Sbjct: 248 -GKAKLVGDVAFDEVAPIASAITPVPGGVGPMTIACLLRNTLQAYQRQ 294


>gi|114568605|ref|YP_755285.1| methenyltetrahydrofolate cyclohydrolase [Maricaulis maris MCS10]
 gi|119369808|sp|Q0ATP0|FOLD_MARMM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|114339067|gb|ABI64347.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Maricaulis
           maris MCS10]
          Length = 298

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 195/296 (65%), Gaps = 8/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK +A+ +  +  E  A L    G    LAVVLVG DPAS  YV  K R  +  G  
Sbjct: 5   LIDGKAIAAEIDARAGEVGAKLASSLGRPPCLAVVLVGEDPASDVYVRNKVRRTEAAGLT 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S++     + ++ ++   V  LN DD + GILVQ+PLP  +    +I  I P+KDVDGL 
Sbjct: 65  SIEIRKSAEATEAEIIAIVERLNADDGVDGILVQMPLPGHIDTNRVIGRIDPDKDVDGLT 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            V+AG++++G    GL PCTPAG +LL E+  G DLSG+  VVIGRS L GKP   L L 
Sbjct: 125 EVSAGRLVLG--KPGLRPCTPAGCVLLAERALG-DLSGKSVVVIGRSILVGKPAALLFLE 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ-- 241
           +NATVT+AHS+T +LP +CRTADILV AVGRP MV+ DW+K G+ V+DVGINRI++P+  
Sbjct: 182 KNATVTIAHSRTADLPSLCRTADILVPAVGRPEMVRGDWVKPGACVLDVGINRIDAPERG 241

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
            GKT LVGD A DE     G ITPVPGG+GPMTIAML+ NTVIAA  +L  K P  
Sbjct: 242 AGKTRLVGDAAFDEIVGHAGWITPVPGGIGPMTIAMLLKNTVIAA--ALRAKQPAL 295


>gi|221640116|ref|YP_002526378.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodobacter sphaeroides KD131]
 gi|254789417|sp|B9KLK2|FOLD_RHOSK RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|221160897|gb|ACM01877.1| methenyltetrahydrofolate cyclohydrolase [Rhodobacter sphaeroides
           KD131]
          Length = 296

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 148/292 (50%), Positives = 196/292 (67%), Gaps = 6/292 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ +  ++AE VA LK+  G+  GLAVVLVG DPAS  YV AK +     G  S
Sbjct: 6   IDGKAFAAGVRARVAEEVARLKEGHGIVPGLAVVLVGEDPASQVYVGAKGKQTVEVGMTS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P   S+ +L   +  LN D ++HGILVQLPLP+ ++   +I ++ P KDVDG H+
Sbjct: 66  FEHRLPAGTSEAELLALIDRLNHDPAVHGILVQLPLPAHLNADLVINALDPAKDVDGFHI 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G++  G  +  +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM QLLL  
Sbjct: 126 SNVGRLGTGQKS--MVPCTPLGCLMMLRDHLGT-LSGLNAVVVGRSNIVGKPMAQLLLGE 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+T++L  +CR ADILV AVGRP M+  D++K G+ VIDVGINRI   + GK
Sbjct: 183 SCTVTVAHSRTRDLAAVCRGADILVAAVGRPEMITGDFVKPGATVIDVGINRIE--RDGK 240

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           T LVGDV       V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 241 TKLVGDVDYASAAEVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPQ 292


>gi|83591896|ref|YP_425648.1| methenyltetrahydrofolate cyclohydrolase [Rhodospirillum rubrum ATCC
           11170]
 gi|119370035|sp|Q2RWY4|FOLD_RHORT RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|83574810|gb|ABC21361.1| Methenyltetrahydrofolate cyclohydrolase [Rhodospirillum rubrum ATCC
           11170]
          Length = 296

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 155/289 (53%), Positives = 203/289 (70%), Gaps = 6/289 (2%)

Query: 1   MGS-LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKH 59
           MG+ LIDGK +A  L ++IA+ VA LK   G+  GLAVVLVG D AS  YV +K +MA  
Sbjct: 1   MGAHLIDGKAIAQQLRERIAQEVADLKAHRGLVPGLAVVLVGEDAASQVYVGSKEKMAVA 60

Query: 60  CGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDV 119
            G HSV        S+ ++   V +LN D +I GILVQLPLP+ + E  I+ +I P+KDV
Sbjct: 61  VGMHSVVCRLAATTSEAEVLAKVEALNADPTIDGILVQLPLPAHIDEDKILLAIDPDKDV 120

Query: 120 DGLHVVNAGKVMIG--DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPM 177
           DG H VN G++ IG  +   G+VPCTP G ++L++   G DL+G+ A+VIGRSN+ GKPM
Sbjct: 121 DGFHPVNVGRLSIGQSNGEHGMVPCTPKGCLMLLKGVLG-DLTGKTALVIGRSNIVGKPM 179

Query: 178 GQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI 237
            QLLLS N TVT+AHS++++LP++CR  DI+V AVGRP MV+ DW+K G++VIDVG+NR+
Sbjct: 180 AQLLLSANCTVTLAHSRSRDLPDLCRRMDIVVAAVGRPEMVKGDWLKPGAVVIDVGMNRL 239

Query: 238 -NSPQLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
             +P   K  LVGDV      +V GAITPVPGGVGPMTIA L+ANT+ A
Sbjct: 240 PAAPGAEKGKLVGDVDYASAAAVAGAITPVPGGVGPMTIACLLANTLEA 288


>gi|224499939|ref|ZP_03668288.1| hypothetical protein LmonF1_09769 [Listeria monocytogenes Finland
           1988]
          Length = 284

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 196/291 (67%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L KE G Q GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTREVAELVKE-GKQPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P ++++  L + V  LN+D +IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V   DV +E     G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDVDFDDVVEEA----GFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|85713677|ref|ZP_01044667.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Nitrobacter sp.
           Nb-311A]
 gi|85699581|gb|EAQ37448.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Nitrobacter sp.
           Nb-311A]
          Length = 294

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 199/293 (67%), Gaps = 5/293 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           S+IDGKV+A+ L  ++A  V  +K++ G+  GLAVVLVGNDPAS  YV +K +  +  G 
Sbjct: 4   SIIDGKVIAADLRAQVAGEVTRMKRDHGLTPGLAVVLVGNDPASEVYVRSKHKQTQAAGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++    D++Q DL   +  LN D ++HGILVQLPLP  +   ++I +I P KDVDGL
Sbjct: 64  ASFEHTLSADVAQADLLALIAELNADPAVHGILVQLPLPKRLDTGAVIAAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  NAG++  G     L PCTP G I+L +      L G  A+V+GRSNL G+P+ QLLL
Sbjct: 124 HPHNAGRLAGG--LPALSPCTPLGCIILTKSVH-ASLEGLDAIVLGRSNLVGRPLVQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + N TVT+AHS+++NLPE+CR AD++  AVG+  MV+ DW+K G+ VIDVGI R+ + + 
Sbjct: 181 NENVTVTIAHSRSRNLPELCRRADLVYAAVGKAEMVRGDWLKPGATVIDVGITRVPTVE- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           G+T L+GDVA +E   V GA+TPVPGGVG MT+A L+ NT+ AA    G+ +P
Sbjct: 240 GQTRLIGDVAFNEAMKVAGAVTPVPGGVGQMTVACLLVNTLRAACAIRGLPAP 292


>gi|16803400|ref|NP_464885.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Listeria
           monocytogenes EGD-e]
 gi|47095943|ref|ZP_00233546.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes str. 1/2a F6854]
 gi|224501697|ref|ZP_03670004.1| hypothetical protein LmonFR_04142 [Listeria monocytogenes FSL
           R2-561]
 gi|254827621|ref|ZP_05232308.1| folD [Listeria monocytogenes FSL N3-165]
 gi|254898475|ref|ZP_05258399.1| hypothetical protein LmonJ_01630 [Listeria monocytogenes J0161]
 gi|254912034|ref|ZP_05262046.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936361|ref|ZP_05268058.1| folD [Listeria monocytogenes F6900]
 gi|255029813|ref|ZP_05301764.1| hypothetical protein LmonL_13469 [Listeria monocytogenes LO28]
 gi|284801745|ref|YP_003413610.1| hypothetical protein LM5578_1499 [Listeria monocytogenes 08-5578]
 gi|284994887|ref|YP_003416655.1| hypothetical protein LM5923_1452 [Listeria monocytogenes 08-5923]
 gi|81509148|sp|Q8Y7C5|FOLD_LISMO RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|16410776|emb|CAC99438.1| folD [Listeria monocytogenes EGD-e]
 gi|47015689|gb|EAL06619.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes str. 1/2a F6854]
 gi|258599999|gb|EEW13324.1| folD [Listeria monocytogenes FSL N3-165]
 gi|258608952|gb|EEW21560.1| folD [Listeria monocytogenes F6900]
 gi|284057307|gb|ADB68248.1| hypothetical protein LM5578_1499 [Listeria monocytogenes 08-5578]
 gi|284060354|gb|ADB71293.1| hypothetical protein LM5923_1452 [Listeria monocytogenes 08-5923]
 gi|293590000|gb|EFF98334.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 284

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 195/291 (67%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L KE G Q GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTREVAELVKE-GKQPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P ++++  L + V  LN+D +IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V   DV  E     G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDVDFDDVVQEA----GFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|47093747|ref|ZP_00231497.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes str. 4b H7858]
 gi|217964494|ref|YP_002350172.1| bifunctional protein FolD [Listeria monocytogenes HCC23]
 gi|254824581|ref|ZP_05229582.1| methenyltetrahydrofolate cyclohydrolase [Listeria monocytogenes FSL
           J1-194]
 gi|254829883|ref|ZP_05234538.1| bifunctional protein FolD [Listeria monocytogenes 10403S]
 gi|254852592|ref|ZP_05241940.1| folD [Listeria monocytogenes FSL R2-503]
 gi|255520790|ref|ZP_05388027.1| bifunctional protein FolD [Listeria monocytogenes FSL J1-175]
 gi|290893531|ref|ZP_06556514.1| methenyltetrahydrofolate cyclohydrolase [Listeria monocytogenes FSL
           J2-071]
 gi|300765400|ref|ZP_07075382.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes FSL N1-017]
 gi|254789411|sp|B8DFW8|FOLD_LISMH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|47017868|gb|EAL08651.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes str. 4b H7858]
 gi|217333764|gb|ACK39558.1| bifunctional protein FolD [Listeria monocytogenes HCC23]
 gi|258605905|gb|EEW18513.1| folD [Listeria monocytogenes FSL R2-503]
 gi|290556876|gb|EFD90407.1| methenyltetrahydrofolate cyclohydrolase [Listeria monocytogenes FSL
           J2-071]
 gi|293593819|gb|EFG01580.1| methenyltetrahydrofolate cyclohydrolase [Listeria monocytogenes FSL
           J1-194]
 gi|300513837|gb|EFK40902.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes FSL N1-017]
 gi|307570942|emb|CAR84121.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes L99]
 gi|313608933|gb|EFR84687.1| bifunctional protein FolD [Listeria monocytogenes FSL F2-208]
 gi|328467498|gb|EGF38567.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Listeria
           monocytogenes 1816]
          Length = 284

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 196/291 (67%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L KE G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTREVAELVKE-GKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P ++++  L + V  LN+D +IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V   DV +E     G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDVDFDDVVEEA----GFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|196248858|ref|ZP_03147558.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           G11MC16]
 gi|196211734|gb|EDY06493.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           G11MC16]
          Length = 284

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 197/291 (67%), Gaps = 11/291 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A  +  ++A+ VA LK   G++ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 4   QIISGTELAKTIRAELADKVAKLKA-NGIEPGLAVILVGDDPASHSYVKGKQKACAEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+ Y FP  IS+ +L   +  LN D ++HGILVQLPLP+ + E S+I++I PEKDVDG 
Sbjct: 63  RSLLYTFPATISEEELLAKIQELNADPTVHGILVQLPLPAHIREWSVIETIAPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+MIG      +PCTP G +++++   G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 123 HPINVGKMMIGQ--PAFLPCTPHGVLVMVKS-AGIDIAGKHVVVVGRSNIVGKPVGQLFL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT AHSKT +L  I R ADIL+VAVG+ R++  + +K G++VIDVG+NR+ S   
Sbjct: 180 REHATVTYAHSKTPDLAAITRQADILIVAVGKARLIGPEHVKPGAVVIDVGVNRLES--- 236

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           GK  L GDV  D  K V   +TPVPGGVGPMTI ML+ NT+ AA R L  K
Sbjct: 237 GK--LCGDVDFDAVKEVASYVTPVPGGVGPMTITMLLYNTMEAA-RQLAAK 284


>gi|254295257|ref|YP_003061280.1| Methenyltetrahydrofolate cyclohydrolase [Hirschia baltica ATCC
           49814]
 gi|254043788|gb|ACT60583.1| Methenyltetrahydrofolate cyclohydrolase [Hirschia baltica ATCC
           49814]
          Length = 296

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 200/299 (66%), Gaps = 9/299 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M + IDGK +A+ +   +A++V+ L      Q  LAV+LVG DPAS  YV++K +  + C
Sbjct: 1   MATRIDGKAIAADVRVNVAKAVSELPS----QPTLAVILVGEDPASQVYVNSKVKQTQEC 56

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+    P + +Q  +E  +  LN D  + GIL+QLPLP  +   S I+ I P+KDVD
Sbjct: 57  GMRSLHNVLPANATQDQVEAEIAKLNDDPEVDGILLQLPLPKGLDADSAIEKISPDKDVD 116

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GL   +AG++++G    GL PCTP+G ++L ++  G DLSG++ VV+GRS L GKP   L
Sbjct: 117 GLTEASAGRLVLG--KPGLRPCTPSGCVILAKRALGNDLSGKNVVVVGRSILVGKPAALL 174

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L+ N TVT+AHS+TK+L  +CR ADILV AVGRP+M+  +++K G++VIDVGINRI++P
Sbjct: 175 FLAENCTVTIAHSRTKDLAAVCREADILVPAVGRPQMLTGEYVKPGAVVIDVGINRIDAP 234

Query: 241 QL--GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
           +   GKT LVGD   D C++V G ITPVPGGVGPMTIA L+ NTV+AA    G   P  
Sbjct: 235 ERGEGKTRLVGDAEFDSCEAVAGHITPVPGGVGPMTIACLLQNTVLAACARRGWNIPDI 293


>gi|138895966|ref|YP_001126419.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Geobacillus thermodenitrificans NG80-2]
 gi|158705733|sp|A4IQS0|FOLD_GEOTN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|134267479|gb|ABO67674.1| Methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Geobacillus thermodenitrificans NG80-2]
          Length = 284

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 197/291 (67%), Gaps = 11/291 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A  +  ++A+ VA LK   G++ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 4   QIISGTELAKTIRAELADEVAKLKA-NGIEPGLAVILVGDDPASHSYVKGKQKACAEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+ Y FP  IS+ +L   +  LN D ++HGILVQLPLP+ + E S+I++I PEKDVDG 
Sbjct: 63  RSLLYTFPATISEEELLAKIQELNADPTVHGILVQLPLPAHIREWSVIETIAPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+MIG      +PCTP G +++++   G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 123 HPINVGKMMIGQ--PAFLPCTPHGVLVMVKS-AGIDIAGKHVVVVGRSNIVGKPVGQLFL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT AHSKT +L  I R ADIL+VAVG+ R++  + +K G++VIDVG+NR+ S   
Sbjct: 180 REHATVTYAHSKTPDLAAITRQADILIVAVGKARLIGPEHVKPGAVVIDVGVNRLES--- 236

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           GK  L GDV  D  K V   +TPVPGGVGPMTI ML+ NT+ AA R L  K
Sbjct: 237 GK--LCGDVDFDAVKEVASYVTPVPGGVGPMTITMLLHNTMEAA-RQLAAK 284


>gi|15615347|ref|NP_243650.1| methylenetetrahydrofolate dehydrogenase [Bacillus halodurans C-125]
 gi|81786240|sp|Q9K966|FOLD_BACHD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|10175405|dbj|BAB06503.1| methylenetetrahydrofolate
           dehydrogenase(NADP+)/methenyltetrahydrofolate
           cyclohydrolase [Bacillus halodurans C-125]
          Length = 279

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 196/283 (69%), Gaps = 11/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           L+DGK +A+   D++   V  LK E G+  GLAV+LVGNDPAS  YV +K +  +  G +
Sbjct: 5   LLDGKALAAKKRDELKSEVTKLK-ERGITPGLAVILVGNDPASTVYVRSKQKACEQIGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV    P   S+ +L   +  LN D +IHGILVQLPLP  +SEQ++I+ I P KDVDG H
Sbjct: 64  SVLKELPASTSEEELLTEIDRLNNDPTIHGILVQLPLPEQISEQAVIERISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++MIG+ T   +PCTP G ++++++    +++G+H VV+GRSN+ GKP+GQL+L+
Sbjct: 124 PISVGRMMIGEDT--FLPCTPFGVLVMLQE-ANVEIAGKHVVVVGRSNIVGKPVGQLMLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT  HS+TKNL EI + ADIL+VAVGR R +    +K G++VIDVGINR++    G
Sbjct: 181 EHATVTYCHSRTKNLTEITKQADILIVAVGRARFIDASHVKEGAVVIDVGINRVD----G 236

Query: 244 KTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           K  L GDV  E  + V   +TPVPGGVGPMTI ML+ANT+ AA
Sbjct: 237 K--LCGDVDFESVREVASHLTPVPGGVGPMTITMLLANTIQAA 277


>gi|226223961|ref|YP_002758068.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Listeria
           monocytogenes Clip81459]
 gi|254932325|ref|ZP_05265684.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|259647300|sp|C1L2R6|FOLD_LISMC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|225876423|emb|CAS05132.1| Putative Tetrahydrofolate dehydrogenase/cyclohydrolase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|293583881|gb|EFF95913.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|328475074|gb|EGF45862.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Listeria
           monocytogenes 220]
 gi|332311801|gb|EGJ24896.1| Bifunctional protein folD [Listeria monocytogenes str. Scott A]
          Length = 284

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 196/291 (67%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L KE G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTREVAELVKE-GKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P ++++  L + V  LN+D +IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V   DV +E     G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDVDFDDVVEEA----GFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|163814152|ref|ZP_02205544.1| hypothetical protein COPEUT_00306 [Coprococcus eutactus ATCC 27759]
 gi|158450601|gb|EDP27596.1| hypothetical protein COPEUT_00306 [Coprococcus eutactus ATCC 27759]
          Length = 287

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 143/283 (50%), Positives = 192/283 (67%), Gaps = 10/283 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGKV++  + D++ E VA +K E G ++ LAV+ VGNDPAS  YV  K +  ++ 
Sbjct: 8   MYKLIDGKVISKQIKDELKEKVAAIKAE-GTEICLAVIQVGNDPASSVYVGNKKKACEYI 66

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y  P + ++ +L   +  LN DD ++GILVQLPLP  + E  +I++I P+KDVD
Sbjct: 67  GIGSLSYELPENTTEEELLTLIEKLNADDKVNGILVQLPLPKHIDEDKVIKTISPKKDVD 126

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H ++ G + IG    G V CTPAG I LI++  G ++ G+  VV+GRSN+ GKPM  L
Sbjct: 127 GFHPMSVGALSIG--QPGFVSCTPAGVIQLIKR-SGIEIEGKECVVLGRSNIVGKPMSML 183

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS+TK+L E+C+ ADILVVA+G+P+M+   +IK G+ VIDVGI+R  + 
Sbjct: 184 LLRENGTVTVCHSRTKDLKEVCKRADILVVAIGKPKMIDASYIKDGATVIDVGIHRDENN 243

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           +     L GDV  D  K V GAITPVPGGVGPMTIAMLMAN V
Sbjct: 244 K-----LCGDVDFDSAKEVAGAITPVPGGVGPMTIAMLMANCV 281


>gi|315282225|ref|ZP_07870679.1| bifunctional protein FolD [Listeria marthii FSL S4-120]
 gi|313614127|gb|EFR87817.1| bifunctional protein FolD [Listeria marthii FSL S4-120]
          Length = 284

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 195/287 (67%), Gaps = 8/287 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L K TG + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTSEVAELAK-TGKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P ++++  L + V  LN+D +IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPKHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +L   V   DV +E     G ITPVPGGVGPMTI ML+ANT+ AA R
Sbjct: 237 KLCGDVDFDDVVEEA----GFITPVPGGVGPMTITMLLANTLKAAKR 279


>gi|261405952|ref|YP_003242193.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           sp. Y412MC10]
 gi|261282415|gb|ACX64386.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           sp. Y412MC10]
          Length = 286

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 153/290 (52%), Positives = 198/290 (68%), Gaps = 10/290 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++I GK ++  +   IA  V  L K+  V+ GLAVVLVG+DPAS  YV  K +     GF
Sbjct: 5   TIISGKQISEEIRKGIALEVEQLSKQN-VRPGLAVVLVGDDPASHVYVRNKEKACHDLGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S  +  P D SQ ++   V  LN  +SIHGILVQLPLP  + E+++I +I  EKDVDG 
Sbjct: 64  YSEVHRLPADSSQNEVLALVDKLNAQESIHGILVQLPLPKHIEEKAVIDAIAVEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G ++IGD +  L+PCTPAG I +I++  G +++G+HAVVIGRSN+ GKP+  LL 
Sbjct: 124 HPVNVGNLVIGDDS--LLPCTPAGVIEMIKR-TGIEIAGKHAVVIGRSNIVGKPVSLLLQ 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVTM HSKT N+ EI R ADILVVA+GR  M+   ++K G++VIDVG+NR+ +   
Sbjct: 181 RENATVTMCHSKTGNMAEIARQADILVVAIGRANMIDASYVKPGAVVIDVGMNRLEN--- 237

Query: 243 GKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           GK  L GDV  E  K+V G ITPVPGGVGPMTI MLM NT+IAA R  G+
Sbjct: 238 GK--LAGDVDFESVKAVSGPITPVPGGVGPMTITMLMQNTLIAAKRLNGL 285


>gi|84687696|ref|ZP_01015569.1| folD bifunctional protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664279|gb|EAQ10770.1| folD bifunctional protein [Rhodobacterales bacterium HTCC2654]
          Length = 298

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 150/295 (50%), Positives = 197/295 (66%), Gaps = 6/295 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  K+AE VA L K+ G++ GLAVVLVG DPAS  YV +K +     G 
Sbjct: 4   TIIDGKAFAAEVRGKVAEHVAELAKK-GIKPGLAVVLVGEDPASQVYVRSKGKQTVEAGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++      S+ DL   V  LN D +++GILVQLPLP  + E  +I +I P KDVDG 
Sbjct: 63  ESFEHKLDASTSEADLLALVDKLNNDPTVNGILVQLPLPDHIDEDKVIGAIDPAKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G +  G     +VPCTP G ++L+    G  LSG+ AVV+GRSN+ GKPM QLLL
Sbjct: 123 HISNVGLLATGQ--KAMVPCTPLGCLMLLRDHFGS-LSGKSAVVVGRSNIVGKPMAQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI-NSPQ 241
             + TVT+AHS+TK++ ++ R ADI+V AVGRP MV  DW+K G++VIDVGINR+  + +
Sbjct: 180 RDSCTVTIAHSRTKDIEDVVRGADIVVAAVGRPEMVTGDWLKPGAVVIDVGINRLPPAEE 239

Query: 242 LGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            GK  LVGDV     S V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 240 GGKGKLVGDVDFASASEVAGAITPVPGGVGPMTIACLLANTLTATCRANGLPEPE 294


>gi|148251885|ref|YP_001236470.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bradyrhizobium sp. BTAi1]
 gi|158705716|sp|A5E8S0|FOLD_BRASB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|146404058|gb|ABQ32564.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bradyrhizobium
           sp. BTAi1]
          Length = 294

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 196/292 (67%), Gaps = 5/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGKV+A+ L  ++A  V  +K++ G+  GLAVVLVGNDPAS  YV +K    +  G  
Sbjct: 5   IIDGKVIAADLRGQVAREVERVKRDHGLTPGLAVVLVGNDPASEVYVRSKHTQTQAAGMA 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D++Q +L   +  LN D S+HGILVQLPLP  +  + +I +I P KDVDGLH
Sbjct: 65  SFEHKLPADVAQSELLALIDKLNHDPSVHGILVQLPLPKGLETEIVINAIDPAKDVDGLH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             NAG++  G     L PCTP G I+L +      L G +A+VIGRSNL G+P+ QLLL+
Sbjct: 125 PHNAGRLSGGQ--PALAPCTPLGCIILSKTVH-PSLEGLNAIVIGRSNLVGRPLVQLLLN 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS++++L  +   AD++  AVGRP MV+ DWIK G+ VIDVGINRI + + G
Sbjct: 182 ENATVTIAHSRSRDLAALTARADLVYAAVGRPEMVKRDWIKPGATVIDVGINRIPTAE-G 240

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           KT LVGDVA  E   V GAITPVPGGVG MT+A L+ NT+ AA    G+  P
Sbjct: 241 KTRLVGDVAYAEVAEVAGAITPVPGGVGQMTVACLLVNTLRAACAIAGLPKP 292


>gi|332186941|ref|ZP_08388682.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Sphingomonas sp. S17]
 gi|332012951|gb|EGI55015.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Sphingomonas sp. S17]
          Length = 292

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 147/290 (50%), Positives = 189/290 (65%), Gaps = 10/290 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ L  +IA  V   +   G   GLAVVLVG DPAS  YV +K +  +  G 
Sbjct: 5   TIIDGKAFAAGLRTRIATQVVTFRDAAGRAPGLAVVLVGEDPASSVYVRSKGKATREAGM 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D  Q  L   V  LN D ++ GILVQLPLP  +  Q++IQ+I P+KDVDG 
Sbjct: 65  ESFEHRLPADTDQATLLALVEQLNADPTVDGILVQLPLPGQIDAQAVIQAIDPDKDVDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VNAG++  G    G VPCTP G ++L++      LSG  AVV+GRSN+ GKPM QLLL
Sbjct: 125 HPVNAGRLATG--VEGFVPCTPLGCLMLLKSIH-PSLSGMDAVVVGRSNIVGKPMAQLLL 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T+NL E+   ADI+V AVG P +V+ +WIK G+ VIDVGINRI     
Sbjct: 182 GESCTVTVAHSRTRNLAEVVGRADIVVAAVGVPGLVKGEWIKPGASVIDVGINRI----- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            +T LVGDV  D      GAITPVPGGVGPMTIA+L+ NT+++A R  G+
Sbjct: 237 -ETGLVGDVEYDAAAERAGAITPVPGGVGPMTIAVLLRNTLVSAGRREGV 285


>gi|329924777|ref|ZP_08279766.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Paenibacillus sp. HGF5]
 gi|328940442|gb|EGG36765.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Paenibacillus sp. HGF5]
          Length = 286

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 152/290 (52%), Positives = 198/290 (68%), Gaps = 10/290 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++I GK ++  +   IA  V  L K+  V+ GLAVVLVG+DPAS  YV  K +     GF
Sbjct: 5   TIISGKQISEEIRKGIALEVEQLSKQN-VRPGLAVVLVGDDPASHVYVRNKEKACHDLGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S  +  P D SQ ++   V  LN  +SIHGILVQLPLP  + E+++I +I  EKDVDG 
Sbjct: 64  YSEVHRLPADSSQNEVLALVDKLNAQESIHGILVQLPLPKHIEEKAVIDAIAVEKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G ++IGD +  L+PCTPAG I +I++  G +++G+HAVVIGRSN+ GKP+  LL 
Sbjct: 124 HPVNVGNLVIGDDS--LLPCTPAGVIEMIKR-TGIEIAGKHAVVIGRSNIVGKPVSLLLQ 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVTM HSKT N+ EI R ADILVVA+GR  M+   ++K G++VIDVG+NR+ +   
Sbjct: 181 RENATVTMCHSKTGNMAEIARQADILVVAIGRANMIDASYVKPGAVVIDVGMNRLEN--- 237

Query: 243 GKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           GK  L GDV  E  K+V G ITPVPGGVGPMTI MLM NT++AA R  G+
Sbjct: 238 GK--LAGDVDFESVKAVSGPITPVPGGVGPMTITMLMQNTLLAAKRLNGL 285


>gi|146276623|ref|YP_001166782.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Rhodobacter sphaeroides ATCC 17025]
 gi|166988400|sp|A4WQ13|FOLD_RHOS5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|145554864|gb|ABP69477.1| Methenyltetrahydrofolate cyclohydrolase [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 296

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 196/292 (67%), Gaps = 6/292 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK  A+ +  ++A+ VA LK + G+  GLAVVLVG DPAS  YV AK +     G  S
Sbjct: 6   IDGKAFAAGVRAQVADHVARLKADHGLVPGLAVVLVGEDPASQVYVGAKGKQTVEVGMAS 65

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++    + S+ +L   +  LN+D  +HGILVQLPLP  ++   +I ++ P KDVDG H+
Sbjct: 66  FEHRLSAETSEAELLALIDRLNRDPLVHGILVQLPLPPHLNSDLVINALDPAKDVDGFHI 125

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G++  G  +  +VPCTP G ++++    G +LSG +AVV+GRSN+ GKPM QLLL  
Sbjct: 126 SNVGRLGTGQKS--MVPCTPLGCLMMLRDHLG-NLSGLNAVVVGRSNIVGKPMAQLLLGE 182

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           + TVT+AHS+TK+L  +CR ADILV AVGRP M+  ++IK G+ VIDVGINRI   + GK
Sbjct: 183 SCTVTIAHSRTKDLAAVCRGADILVAAVGRPEMITGEFIKPGATVIDVGINRIE--RDGK 240

Query: 245 TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           T LVGDV       V GAITPVPGGVGPMTIA L+ANT+ A  R+ G+  P+
Sbjct: 241 TKLVGDVDFASAAEVAGAITPVPGGVGPMTIACLLANTLTACCRANGLPEPQ 292


>gi|46907586|ref|YP_013975.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|81403354|sp|Q71ZW2|FOLD_LISMF RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|46880854|gb|AAT04152.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria monocytogenes serotype 4b str.
           F2365]
          Length = 284

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 195/291 (67%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L KE G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTREVAELVKE-GKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P ++++  L + V  LN+D +IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHS+TK+LP++ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLIENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V   DV +E     G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDVDFDDVVEEA----GFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|332186702|ref|ZP_08388445.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Sphingomonas sp. S17]
 gi|332013354|gb|EGI55416.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Sphingomonas sp. S17]
          Length = 298

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 146/293 (49%), Positives = 193/293 (65%), Gaps = 6/293 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A  L  +IAE++      TG + GLAVVLVG DPAS  YV +K RMA+  G 
Sbjct: 4   TIIDGKAFAEGLGQRIAEAIPAFAARTGRRPGLAVVLVGTDPASEVYVRSKGRMARKLGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P   SQ +L   V  LN DD + GILVQLPLP  +   +++++I P KDVDGL
Sbjct: 64  ESFEHVLPETTSQAELLALVARLNTDDRVDGILVQLPLPKGLDSLAVVEAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H ++AG++  G    GLV CTP G I+L+E   G  LSG+ A+V+GRS L GKPM QLLL
Sbjct: 124 HPMSAGRLASG--LPGLVSCTPLGCIMLLEATLGS-LSGRDAIVVGRSILVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +R+ TVT+AHS+T++LP     ADI+V AVG   M++ +WI+ G+ VID+G +R+   + 
Sbjct: 181 ARDCTVTIAHSRTRDLPAKVAQADIVVAAVGAAEMIRGEWIRPGATVIDIGTSRVE--RD 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           G+  LVGDV     K   GAITPVPGGVGPMTI  LM N V+AA+R  G+  P
Sbjct: 239 GRKTLVGDVDFAGAKERAGAITPVPGGVGPMTIMTLMHNAVLAAHRRAGLPDP 291


>gi|304320599|ref|YP_003854242.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Parvularcula
           bermudensis HTCC2503]
 gi|303299501|gb|ADM09100.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Parvularcula
           bermudensis HTCC2503]
          Length = 295

 Score =  268 bits (685), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 147/296 (49%), Positives = 198/296 (66%), Gaps = 6/296 (2%)

Query: 1   MGS-LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKH 59
           MG+ LIDGK  A+++  K+  +   L    G    LAVVLVG DPAS  YV  K ++ K 
Sbjct: 1   MGARLIDGKAQAAIVRAKVKVAAGELAARLGRPPCLAVVLVGADPASEVYVRNKVKLTKA 60

Query: 60  CGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDV 119
            G  S++   P  I Q  L+  +  LN+++ + GIL+Q+P+P+ +     +  I P KDV
Sbjct: 61  VGMTSIERRLPETIDQATLDATLTDLNENEEVDGILLQMPIPAHLDTDRALSLIDPAKDV 120

Query: 120 DGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQ 179
           DGL  ++AG +++G    GLVPCTP GA++LI+   G DLSG+ A+V+GRS L GKP+  
Sbjct: 121 DGLTPISAGALVLG--RAGLVPCTPQGAMILIQSVLGPDLSGRTAIVLGRSILVGKPLSL 178

Query: 180 LLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           LL S NATVTMAHS++ +LP +CR+ADIL  AVGRP +V+ DWIK G++VIDVGINR+  
Sbjct: 179 LLQSANATVTMAHSRSPDLPALCRSADILCAAVGRPELVRGDWIKPGAVVIDVGINRVI- 237

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
            + G+  L+GDVA  E +SV  A+TPVPGGVGPMTIA L+ NTV+AA R  G   P
Sbjct: 238 -EEGRPRLIGDVAFGEAESVADAVTPVPGGVGPMTIACLLRNTVLAAARQAGEAIP 292


>gi|312134798|ref|YP_004002136.1| methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor owensensis OL]
 gi|311774849|gb|ADQ04336.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor owensensis OL]
          Length = 289

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 196/285 (68%), Gaps = 8/285 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDGK +A  + +++   V  LK+  G++  LAVV+VG+DPAS SYV++K +     G
Sbjct: 3   AKIIDGKRIAQEIKNEVKTEVEKLKQR-GIEPALAVVIVGDDPASRSYVNSKKKACSEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +SV++    + +Q +LE+ V  LN+D+ I+GILVQLPLP+ + E+ I   I+P KDVDG
Sbjct: 62  INSVEFALSKNTTQEELESLVDRLNRDEKINGILVQLPLPNGLDEKRICTKILPHKDVDG 121

Query: 122 LHVVNAGKVMIG-DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G V+ G +F   + PCTP G I L+++ +  ++ G+HAVVIGRSN+ GKP+  L
Sbjct: 122 FHPLNVGMVVTGIEFERAIKPCTPFGIIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK+L EIC+ ADILV AVG+PR V  D +K G++VIDVGINR ++ 
Sbjct: 181 LLRENATVTICHSYTKDLKEICKQADILVAAVGKPRFVTSDMVKEGAVVIDVGINRDDAT 240

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q     LVGDV  E  + V   ITPVPGGVGPMT+AMLM NT+ A
Sbjct: 241 QK----LVGDVDFETVEKVASFITPVPGGVGPMTVAMLMKNTLFA 281


>gi|228992929|ref|ZP_04152853.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           pseudomycoides DSM 12442]
 gi|228998973|ref|ZP_04158555.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           mycoides Rock3-17]
 gi|229006512|ref|ZP_04164156.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           mycoides Rock1-4]
 gi|228754738|gb|EEM04139.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           mycoides Rock1-4]
 gi|228760590|gb|EEM09554.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           mycoides Rock3-17]
 gi|228766786|gb|EEM15425.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           pseudomycoides DSM 12442]
          Length = 286

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 144/285 (50%), Positives = 192/285 (67%), Gaps = 8/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN+DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPDTITEERLLAEIDRLNEDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKTKN+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ + +L 
Sbjct: 181 ENATVTYCHSKTKNIKELSKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLETGKLC 240

Query: 244 KTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             V   +V D    + G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 241 GDVDFENVLD----IAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|187736130|ref|YP_001878242.1| Methenyltetrahydrofolate cyclohydrolase [Akkermansia muciniphila
           ATCC BAA-835]
 gi|226704310|sp|B2UM17|FOLD_AKKM8 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|187426182|gb|ACD05461.1| Methenyltetrahydrofolate cyclohydrolase [Akkermansia muciniphila
           ATCC BAA-835]
          Length = 291

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 195/292 (66%), Gaps = 7/292 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK VAS + +++   +A L+ E G+  GLAVVLVG DPAS  YV++K +     G 
Sbjct: 2   QIIDGKQVASQVLEEVERDIARLR-EQGITPGLAVVLVGEDPASQVYVNSKVKKCAELGM 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S +   P D SQ +L   V  LN D S+HGILVQ P P  + E +++  I P KDVDG 
Sbjct: 61  NSRKIVLPSDASQEELLRIVRELNVDPSVHGILVQSPPPPHIDEAAVVLEIDPAKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N  K+++ D  TG VPCTP G + L+ +  G + +G +AVVIGRS + GKPM  LL+
Sbjct: 121 HPENVAKLVLED-ETGFVPCTPLGCMRLL-KAAGIETAGANAVVIGRSMIVGKPMAHLLM 178

Query: 183 SR--NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           S+  NATVT+AHS+TKNLPE+CR+ADI+V A+GRP  V  D++K G++V+DVGINR+   
Sbjct: 179 SKQANATVTVAHSRTKNLPELCRSADIIVAAIGRPAFVTADFVKDGAVVVDVGINRVEDA 238

Query: 241 QLGKTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
              +   +VGDVA DE      AITPVPGGVGPMTIAMLMANTV A  +  G
Sbjct: 239 SAKRGYRIVGDVAYDEVAPKCRAITPVPGGVGPMTIAMLMANTVKACRQQTG 290


>gi|261417745|ref|YP_003251427.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Geobacillus sp. Y412MC61]
 gi|319767443|ref|YP_004132944.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           Y412MC52]
 gi|261374202|gb|ACX76945.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           Y412MC61]
 gi|317112309|gb|ADU94801.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           Y412MC52]
          Length = 284

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 193/291 (66%), Gaps = 11/291 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A  +   +A+  A LK + GV++GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 4   QIISGTEMARTIRTALADEAAQLKAD-GVELGLAVILVGDDPASHSYVKGKQKACAEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  Y FP  I +  L   +  LN D ++HGILVQLPLP  + E S+I++I PEKDVDG 
Sbjct: 63  RSFLYTFPAAIDEETLLAKIRELNVDPAVHGILVQLPLPDHICEWSVIETIAPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+MIG      +PCTP G IL++ Q  G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 123 HPINVGKMMIGQ--RAFLPCTPHG-ILVMVQSAGIDIAGKHVVVVGRSNIVGKPVGQLFL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT  HSKT +L  I R ADIL+VAVG+ R++  + +K G++VIDVG+NR+ +   
Sbjct: 180 REHATVTYTHSKTPDLAAITRQADILIVAVGKARLIGPEHVKPGAVVIDVGVNRLEN--- 236

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           GK  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ AA R L  K
Sbjct: 237 GK--LCGDVDFDAVKEVAGYITPVPGGVGPMTITMLLHNTIEAA-RQLAAK 284


>gi|146329762|ref|YP_001210169.1| methylenetetrahydrofolate dehydrogenase [Dichelobacter nodosus
           VCS1703A]
 gi|158705728|sp|A5EX57|FOLD_DICNV RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|146233232|gb|ABQ14210.1| methylenetetrahydrofolate dehydrogenase [Dichelobacter nodosus
           VCS1703A]
          Length = 291

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 141/284 (49%), Positives = 196/284 (69%), Gaps = 5/284 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I+GK +A+ +  +I +  A     TGV+ GLAV+LVGNDPAS  YV  K   A+  GF
Sbjct: 4   EIINGKEIAAEIRREIKQETAQFIAATGVRPGLAVILVGNDPASEVYVRNKGIQAEEVGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  Y  P   +Q +L   +++LN D  I GILVQLPLP+ ++ + ++ +I P KDVDG 
Sbjct: 64  LSQIYRLPAQTTQAELLAKIVALNNDPQICGILVQLPLPAHLNAEIVLNTIDPNKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++  G+  +  VPCTP G  L+++++ G  L+G+ A++IGRSN+ GKPM  LLL
Sbjct: 124 HPLNIGRLWAGEPCS--VPCTPLGCSLILKRYFGDSLAGKKALIIGRSNIVGKPMAALLL 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            ++ATVT+AHSKT ++P +CR ADI++ AVG+P +V+ DWIK+G++V+DVGINRI     
Sbjct: 182 QQHATVTIAHSKTPDVPALCRQADIVIAAVGQPELVKGDWIKSGAVVLDVGINRIAVGD- 240

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
            KT LVGDVA E  K V  AITPVPGG+GPMTIA L+ NT+  A
Sbjct: 241 -KTKLVGDVAFESAKEVAAAITPVPGGIGPMTIACLLKNTLTLA 283


>gi|152976585|ref|YP_001376102.1| methenyltetrahydrofolate cyclohydrolase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|189044519|sp|A7GSJ9|FOLD_BACCN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|152025337|gb|ABS23107.1| Methenyltetrahydrofolate cyclohydrolase [Bacillus cytotoxicus NVH
           391-98]
          Length = 286

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 144/285 (50%), Positives = 192/285 (67%), Gaps = 8/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SY+  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYIKGKQKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN+DD I+GILVQLPLP  + E++II+ I P+KDVDG H
Sbjct: 64  SELIEFPDTITEERLLAEIDRLNEDDRINGILVQLPLPKHIEEKAIIERISPKKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PINIGRMMTGQDT--FLPCTPHGILELVKE-TNIDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKTKN+ E+ + ADILVVAVGRP+MV  D+IK G++VIDVG+NR+ + +L 
Sbjct: 181 ENATVTYCHSKTKNIKELSKLADILVVAVGRPKMVTADYIKEGAVVIDVGVNRLETGKLC 240

Query: 244 KTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             V   +V D    + G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 241 GDVDFENVLD----IAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|322392257|ref|ZP_08065718.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus peroris ATCC 700780]
 gi|321144792|gb|EFX40192.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus peroris ATCC 700780]
          Length = 306

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG +PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGGNPASQVYVRNKERSAIAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS     P  I+Q +L   +   N+D + HGILVQLPLP  + E+ ++ +I PEKDVD
Sbjct: 82  GFHSEVVRVPETITQDELLELIAKYNQDPAWHGILVQLPLPKHIDEEEVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 199 LLAKNATVTLTHSRTHNLAQVASKADILVVAIGRAKFVTADFVKAGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    V   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 258 --GK--LCGDVDYDAVAPVASHITPVPGGVGPMTITMLMEQTYQAALRTL 303


>gi|52141315|ref|YP_085514.1| bifunctional protein: methylenetetrahydrofolate dehydrogenase;
           methenyltetrahydrofolate cyclohydrolase [Bacillus cereus
           E33L]
 gi|81686284|sp|Q635A3|FOLD_BACCZ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|51974784|gb|AAU16334.1| bifunctional protein: methylenetetrahydrofolate dehydrogenase;
           methenyltetrahydrofolate cyclohydrolase [Bacillus cereus
           E33L]
          Length = 286

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLTEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|312622757|ref|YP_004024370.1| methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203224|gb|ADQ46551.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 289

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 194/285 (68%), Gaps = 8/285 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             LIDGK +A  + +++   +  LK + G++  LAVV+VG+DPAS SYV++K +     G
Sbjct: 3   AKLIDGKKIAQEIKNEVKTELEKLK-QRGIEPTLAVVIVGDDPASRSYVNSKKKACSEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +SV++    D +Q +LE+ +  LN+D+ I+GILVQLPLP+ + E+ I   I+P KDVDG
Sbjct: 62  INSVEFALSKDTTQDELESLIDRLNRDEKINGILVQLPLPNGLDEKRICTKILPHKDVDG 121

Query: 122 LHVVNAGKVMIG-DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G V  G +F   + PCTP G I L+++ +  ++ G+HAVVIGRSN+ GKP+  L
Sbjct: 122 FHPLNVGMVATGIEFERAIKPCTPFGIIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK+L EIC+ ADILV AVG+PR V  D +K G++VIDVGINR  + 
Sbjct: 181 LLRENATVTICHSYTKDLKEICKQADILVAAVGKPRFVTSDMVKEGAVVIDVGINRDGAT 240

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q     LVGDV  E  + V   ITPVPGGVGPMT+AMLM NT+ A
Sbjct: 241 Q----KLVGDVDFETVEKVASFITPVPGGVGPMTVAMLMKNTLFA 281


>gi|125973608|ref|YP_001037518.1| methenyltetrahydrofolate cyclohydrolase [Clostridium thermocellum
           ATCC 27405]
 gi|256003427|ref|ZP_05428418.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           thermocellum DSM 2360]
 gi|281417813|ref|ZP_06248833.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           thermocellum JW20]
 gi|158705725|sp|A3DEE6|FOLD_CLOTH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|125713833|gb|ABN52325.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Clostridium
           thermocellum ATCC 27405]
 gi|255992717|gb|EEU02808.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           thermocellum DSM 2360]
 gi|281409215|gb|EFB39473.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           thermocellum JW20]
 gi|316940150|gb|ADU74184.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           thermocellum DSM 1313]
          Length = 285

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/292 (48%), Positives = 196/292 (67%), Gaps = 10/292 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +++GK +++ + +++   V  LKK   +  GLAV++VGNDPAS  YV++K +     G
Sbjct: 3   AKVLNGKELSTKIKEELKIEVEDLKK-NNINPGLAVIIVGNDPASRVYVNSKKKACAEIG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S +Y    + +Q +L   +  LNKDD + GILVQLPLP  + E+ +I +I P KDVD 
Sbjct: 62  IESFEYALEENTTQEELIELIHKLNKDDKVSGILVQLPLPKHIDEEKVIYAIDPSKDVDA 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN GK+MIG+     +PCTPAG + LI++  G D++G+  VV+GRSN+ GKPM  LL
Sbjct: 122 FHPVNVGKLMIGN--PDFLPCTPAGVMELIKE-SGIDITGKECVVVGRSNIVGKPMAMLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L++N TVT+ HS+T+N+ E+C+ ADILVVAVG+P  ++   IK G++VIDVGINR+ + +
Sbjct: 179 LAQNGTVTVCHSRTQNIDEVCKRADILVVAVGKPEFIKGSSIKPGAVVIDVGINRLENKK 238

Query: 242 LGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
                LVGDV  E  S V  AITPVPGGVGPMTIAMLM NTV AA     MK
Sbjct: 239 -----LVGDVEYESASRVASAITPVPGGVGPMTIAMLMKNTVKAAKLQAKMK 285


>gi|157692930|ref|YP_001487392.1| bifunctional methylenetetrahydrofolate dehydrogenase
           (NADP(+))/methenyltetrahydrofolate cyclohydrolase
           [Bacillus pumilus SAFR-032]
 gi|166988377|sp|A8FF15|FOLD_BACP2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|157681688|gb|ABV62832.1| bifunctional methylenetetrahydrofolate dehydrogenase
           (NADP(+))/methenyltetrahydrofolate cyclohydrolase
           [Bacillus pumilus SAFR-032]
          Length = 283

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 197/288 (68%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LK++ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAKEKREQLAKEVEELKQK-GVTPGLAVILIGDDPASLSYVRGKKKAAEAMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           H    +    +++ +L   +   N +D  HGILVQLPLP  +SE+++I+ I PEKDVDG 
Sbjct: 63  HFQLDHLDASLTEEELLQLIDQYNANDQFHGILVQLPLPKHISEKAVIERISPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTPAG + L+ +  G +LSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNIGKMLLGEDT--FLPCTPAGIVELLNK-TGVNLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+T N+ E    ADILVVAVGR   ++ D IK G++VIDVG+NR+++   
Sbjct: 180 NENATVTYCHSRTANISEHTLKADILVVAVGRANFIKADQIKEGAIVIDVGVNRLDT--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  LVGDV  +E K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LVGDVDFEEAKEKASYITPVPGGVGPMTITMLAHNTVKSAKRTL 282


>gi|149181859|ref|ZP_01860348.1| methylenetetrahydrofolate dehydrogenase [Bacillus sp. SG-1]
 gi|148850398|gb|EDL64559.1| methylenetetrahydrofolate dehydrogenase [Bacillus sp. SG-1]
          Length = 285

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 188/287 (65%), Gaps = 10/287 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK +A    D I E V  LKKE  V  GLAVVLVG +PAS +YV  K +  +  G H
Sbjct: 5   LIDGKQIAKYFRDSITEEVKQLKKEGQVP-GLAVVLVGENPASKTYVKMKRKTCEEMGIH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +   +S+ +L   +  LN D SIHGILVQLPLP  +    +I+ I P+KDVDG H
Sbjct: 64  SVLVEYNNKVSENELLEKIEQLNNDSSIHGILVQLPLPEGIETAKVIERISPDKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++MIG+     +PCTP G I+ + Q++  + +G+HAVV+GRSN+ GKP GQLLL 
Sbjct: 124 PVNIGRMMIGE--DSFLPCTPYG-IMKMLQYEDINPAGKHAVVVGRSNIVGKPAGQLLLR 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+NL +  R ADIL+ A GR + +  + IK G++VIDVG+NR    + G
Sbjct: 181 ENATVTYCHSKTENLSDYTRNADILISAAGRAKFINGNDIKPGAVVIDVGMNR---DEEG 237

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           K  L GD+  E  ++  G ITPVPGGVGPMTI MLM NTV AA R+ 
Sbjct: 238 K--LCGDIDFESARNTAGYITPVPGGVGPMTITMLMYNTVKAARRTF 282


>gi|317486843|ref|ZP_07945657.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Bilophila
           wadsworthia 3_1_6]
 gi|316921908|gb|EFV43180.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Bilophila
           wadsworthia 3_1_6]
          Length = 296

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 193/296 (65%), Gaps = 7/296 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +I G  + + + D++ + V  ++++ G   GL  +LVG +PAS SYV+ K + A   
Sbjct: 1   MADIISGTEMRAAILDELRQEVEAIREKHGTVPGLVTILVGENPASISYVTLKVKTALSL 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFH +Q N P D+S+  L   +   N+D SIHGILVQLPLP  + E  +I +I P+KDVD
Sbjct: 61  GFHEIQDNQPADVSEEALLALIDKYNRDPSIHGILVQLPLPKHIDENKVIYAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKP---- 176
           G H VN G+++IG      +PCTPAG   ++ +  G +++G   VV+GRSN+ GKP    
Sbjct: 121 GFHPVNLGRMVIGGDAVRFLPCTPAGIQEMLVR-SGVEMAGAEVVVVGRSNIVGKPISVM 179

Query: 177 MGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINR 236
           +GQ     NATVTM H++TK+L E CR ADIL+VA G P +V+ DWIK G+ VIDVG+NR
Sbjct: 180 LGQKGPGANATVTMVHTRTKDLAEHCRRADILIVAAGVPGLVKPDWIKPGATVIDVGVNR 239

Query: 237 IN-SPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           +  + + GK +L GDV   E   V G ITPVPGGVGPMTIAMLM NTV +A+  LG
Sbjct: 240 VGFNEKTGKPILSGDVDFAEASKVAGKITPVPGGVGPMTIAMLMKNTVRSAWYHLG 295


>gi|206976275|ref|ZP_03237183.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus H3081.97]
 gi|217961671|ref|YP_002340241.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus AH187]
 gi|222097627|ref|YP_002531684.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           cereus Q1]
 gi|229140915|ref|ZP_04269459.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-ST26]
 gi|229198308|ref|ZP_04325015.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           m1293]
 gi|301055674|ref|YP_003793885.1| bifunctional protein: methylenetetrahydrofolate dehydrogenase;
           methenyltetrahydrofolate cyclohydrolase [Bacillus
           anthracis CI]
 gi|226704319|sp|B7HNU4|FOLD_BACC7 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|254789386|sp|B9IXH4|FOLD_BACCQ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|206745471|gb|EDZ56870.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus H3081.97]
 gi|217067161|gb|ACJ81411.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus AH187]
 gi|221241685|gb|ACM14395.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus Q1]
 gi|228585187|gb|EEK43298.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           m1293]
 gi|228642491|gb|EEK98778.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-ST26]
 gi|300377843|gb|ADK06747.1| bifunctional protein: methylenetetrahydrofolate dehydrogenase;
           methenyltetrahydrofolate cyclohydrolase [Bacillus cereus
           biovar anthracis str. CI]
          Length = 286

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|258544397|ref|ZP_05704631.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase
           [Cardiobacterium hominis ATCC 15826]
 gi|258520356|gb|EEV89215.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase
           [Cardiobacterium hominis ATCC 15826]
          Length = 290

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 196/284 (69%), Gaps = 6/284 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK  A+ +  ++A+  A  + +TGVQ GLAVVLVGND AS  YV  K   AK  GF
Sbjct: 4   EIIDGKAFAAKIRAEVAQECAAFRAQTGVQPGLAVVLVGNDAASEVYVRNKGIQAKEAGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S++Y  P + +Q +L   V +LN D  +HGILVQLPLP+ +   +++ +I P+KDVDG 
Sbjct: 64  NSLEYRLPAETTQSELLAQVAALNADPQVHGILVQLPLPAHLDADAVLNAIAPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++  G+  +  +PCTP G  L+++   G DLSG+ A+VIGRSN+ GKPM  LLL
Sbjct: 124 HPVNVGRLWTGNPVS--IPCTPLGCALILKDRLG-DLSGKRAIVIGRSNIVGKPMAALLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+AHS+T +L   CR ADI++ AVG+P +V+ DW+K G+ V+DVGINRI   + 
Sbjct: 181 AANATVTIAHSRTADLAARCREADIVIAAVGKPELVRGDWLKAGATVLDVGINRIAEGE- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
            KT LVGDV      +V GAITPVPGG+GPMTIA L+ NT+  A
Sbjct: 240 -KTRLVGDVHFASAVAVAGAITPVPGGIGPMTIACLLRNTLACA 282


>gi|56420931|ref|YP_148249.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Geobacillus kaustophilus HTA426]
 gi|81703967|sp|Q75TC1|FOLD_GEOKA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|47076817|dbj|BAD18357.1| methylenetetrahydrofolate dehydrogenase [Geobacillus kaustophilus]
 gi|56380773|dbj|BAD76681.1| methylenetetrahydrofolate dehydrogenase ; methenyltetrahydrofolate
           cyclohydrolase [Geobacillus kaustophilus HTA426]
          Length = 284

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 192/291 (65%), Gaps = 11/291 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A  +   +A+  A LK + GV+ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 4   QIISGTEMARTIRTALADEAAQLKAD-GVEPGLAVILVGDDPASHSYVKGKQKACAEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  Y FP  I +  L   +  LN D ++HGILVQLPLP  + E S+I++I PEKDVDG 
Sbjct: 63  RSFLYTFPAAIDEETLLAKIRELNVDPAVHGILVQLPLPDHICEWSVIETIAPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+MIG      +PCTP G IL++ Q  G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 123 HPINVGKMMIGQ--RAFLPCTPHG-ILVMVQSAGIDIAGKHVVVVGRSNIVGKPVGQLFL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT  HSKT +L  I R ADIL+VAVG+ R++  + IK G++VIDVG+NR+ +   
Sbjct: 180 REHATVTYTHSKTPDLAAITRQADILIVAVGKARLIGPEHIKPGAVVIDVGVNRLEN--- 236

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           GK  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ AA R L  K
Sbjct: 237 GK--LCGDVDFDAVKEVAGYITPVPGGVGPMTITMLLHNTIEAA-RQLAAK 284


>gi|83313473|ref|YP_423737.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Magnetospirillum
           magneticum AMB-1]
 gi|119369806|sp|Q2VYZ7|FOLD_MAGSA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|82948314|dbj|BAE53178.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Magnetospirillum
           magneticum AMB-1]
          Length = 295

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 149/287 (51%), Positives = 187/287 (65%), Gaps = 7/287 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG + ++ L + I   VA +K    +  GLAVVLVG DPAS  YV  K +     G 
Sbjct: 5   KLIDGNLFSAKLRETITARVAEMKAAHHITPGLAVVLVGEDPASQVYVRTKGKRTVETGM 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S ++  P D  +  L   + SLNKD  +HGILVQLP+P  +  Q +I++I P KDVDG 
Sbjct: 65  RSFEHKLPADTPEDALLLLIESLNKDPEVHGILVQLPVPKHIDTQKVIEAIDPAKDVDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++  G     LVPCTP G++LL++   G  L G  AVVIGRSN+ GKPM QLL+
Sbjct: 125 HPVNVGRLAAGG--DALVPCTPLGSLLLLKDTLG-KLGGLDAVVIGRSNIVGKPMAQLLI 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+TK+LP + R ADI++ AVGRP M++ DWIK G+ VIDVGINRI  P  
Sbjct: 182 KESCTVTVAHSQTKDLPGVVRRADIVIAAVGRPEMIKGDWIKPGATVIDVGINRIELPD- 240

Query: 243 GKTVLVGDV--ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           G   LVGDV  A   K V GAITPVPGGVGPMTIA L+ NT++A  R
Sbjct: 241 GTKKLVGDVDFASAVK-VAGAITPVPGGVGPMTIACLLRNTLVACAR 286


>gi|251773487|gb|EES54035.1| Methenyltetrahydrofolate cyclohydrolase [Leptospirillum
           ferrodiazotrophum]
          Length = 290

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 148/292 (50%), Positives = 194/292 (66%), Gaps = 9/292 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK +A+ L D+ A+ V  L    G   GLAV+LVG DPAS +YV+ K    +  GFH
Sbjct: 7   ILDGKALAATLHDEQAKKVQALAPRAGRPPGLAVILVGEDPASRTYVANKRNACRKVGFH 66

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           + +YN     +  DL + + +LN D +I GILVQLPLP+ V ++ I+  I P+KDVDG H
Sbjct: 67  APEYNLKDSTTTQDLLSLIDTLNADPAIDGILVQLPLPAHVRKEEILLRIAPDKDVDGFH 126

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G+++ G+   GLV CTP G I L+++  G  +SG+HAVVIGRS + G+PM  LLL+
Sbjct: 127 PANLGRLVAGE--PGLVACTPRGIITLLDR-AGIPISGKHAVVIGRSVIVGRPMSLLLLN 183

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           R+ATVT+ HSKT +LP   R ADILV A+GRP M+  D+IK G+ VIDVGI+R      G
Sbjct: 184 RDATVTICHSKTPDLPAAARQADILVAALGRPEMIGRDYIKPGATVIDVGISRGAD---G 240

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           K  L GDV  DE + V GAITPVPGGVGPMTIA L+ NT+ A     G+ SP
Sbjct: 241 K--LKGDVRFDEAREVAGAITPVPGGVGPMTIATLLDNTLDAYLHHTGLSSP 290


>gi|49480926|ref|YP_038242.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|118479372|ref|YP_896523.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           thuringiensis str. Al Hakam]
 gi|196034934|ref|ZP_03102341.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus W]
 gi|196046285|ref|ZP_03113511.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus 03BB108]
 gi|218905317|ref|YP_002453151.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus AH820]
 gi|225866163|ref|YP_002751541.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus 03BB102]
 gi|228916817|ref|ZP_04080382.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228929227|ref|ZP_04092254.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228947898|ref|ZP_04110185.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229123701|ref|ZP_04252896.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           95/8201]
 gi|229186424|ref|ZP_04313588.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BGSC 6E1]
 gi|81394879|sp|Q6HDY4|FOLD_BACHK RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158705712|sp|A0RIH3|FOLD_BACAH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|226704316|sp|B7JM32|FOLD_BACC0 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|254789385|sp|C1ERQ4|FOLD_BACC3 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|49332482|gb|AAT63128.1| bifunctional protein: methylenetetrahydrofolate dehydrogenase;
           methenyltetrahydrofolate cyclohydrolase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|118418597|gb|ABK87016.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Bacillus
           thuringiensis str. Al Hakam]
 gi|195992473|gb|EDX56434.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus W]
 gi|196022755|gb|EDX61436.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus 03BB108]
 gi|218539111|gb|ACK91509.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus AH820]
 gi|225787787|gb|ACO28004.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus 03BB102]
 gi|228597051|gb|EEK54707.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BGSC 6E1]
 gi|228659836|gb|EEL15481.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           95/8201]
 gi|228811885|gb|EEM58219.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228830517|gb|EEM76127.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228843004|gb|EEM88087.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 286

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|16800465|ref|NP_470733.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Listeria
           innocua Clip11262]
 gi|81526957|sp|Q92BZ4|FOLD_LISIN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|16413870|emb|CAC96628.1| folD [Listeria innocua Clip11262]
          Length = 284

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 196/292 (67%), Gaps = 10/292 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L K+ G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTSEVAELVKQ-GKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +++  L   V  LN+D++IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPETVTEEKLLKVVEELNEDNTIHGILVQLPLPKHISEEKVIDAISFDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ ++IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKEYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +     L GDV  D+ K   G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 K-----LCGDVDFDDVKEQAGFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|187478154|ref|YP_786178.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bordetella avium 197N]
 gi|119369623|sp|Q2L1G0|FOLD_BORA1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|115422740|emb|CAJ49268.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase and methylenetetrahydrofolate
           cyclohydrolase] [Bordetella avium 197N]
          Length = 284

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 149/287 (51%), Positives = 192/287 (66%), Gaps = 10/287 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDG  ++  + +++AE  A L  + GV+ GLAVVLVG DPAS  YV  K    +  G H
Sbjct: 5   IIDGVALSQRIREEVAERAAALTAQ-GVRPGLAVVLVGEDPASQVYVRNKVAACEKAGLH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV+  +P D+S+ DL   + +LN+D SIHGILVQLPLP+ +    +I++I PEKDVDG H
Sbjct: 64  SVKEQYPADLSEADLLARIDALNRDPSIHGILVQLPLPAHLDSHKVIEAIAPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + NAG +M G       PCTP G + ++E  +G  L G  AVV+G SN+ GKPM  LLL+
Sbjct: 124 ISNAGLLMTGQPL--FRPCTPYGVMKMLES-EGVTLRGAEAVVVGASNIVGKPMAMLLLA 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             ATVT+ +SKT++L    R AD+LVVA GRPRM+  D IK G++VIDVGINR +    G
Sbjct: 181 AGATVTICNSKTRDLAAQTRRADVLVVATGRPRMITGDMIKPGAVVIDVGINRGDD---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           K  L GDV     + V GAITPVPGGVGPMTIAMLM NT+ AA R+L
Sbjct: 238 K--LCGDVDFASAQQVAGAITPVPGGVGPMTIAMLMVNTLQAAERTL 282


>gi|260576636|ref|ZP_05844623.1| Methenyltetrahydrofolate cyclohydrolase [Rhodobacter sp. SW2]
 gi|259021121|gb|EEW24430.1| Methenyltetrahydrofolate cyclohydrolase [Rhodobacter sp. SW2]
          Length = 296

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 199/293 (67%), Gaps = 6/293 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ +  ++AE VA LK E G+  GLAVVLVG DPAS  YV AK +     G 
Sbjct: 4   TVIDGKAFAARVRGQVAEQVARLKAEHGLVPGLAVVLVGEDPASQVYVGAKGKQTVEVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV++  PVD S+ DL   + +LN D  IHGILVQLPLPS ++   +I SI P KDVDG 
Sbjct: 64  ISVEHKLPVDTSEADLLALIAALNADAKIHGILVQLPLPSHLNSDLVINSIDPAKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ N G  ++G     +VPCTP G ++++    G  LSG +AVV+GRSN+ GKPM QLLL
Sbjct: 124 HISNVG--LLGTGQKAMVPCTPLGCLMMLRAHLG-KLSGLNAVVVGRSNIVGKPMAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             + TVT+AHS+T++L  +CR ADILV AVGRP M+  D++K G+ VIDVGINRI   + 
Sbjct: 181 GESCTVTIAHSRTRDLAAVCRGADILVAAVGRPEMITGDYVKPGATVIDVGINRIQ--RD 238

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           GKT LVGDV      +V GAITPVPGGVGPMTIA L+ANT+ A  R  G+  P
Sbjct: 239 GKTRLVGDVDYASAAAVAGAITPVPGGVGPMTIACLLANTLTACCRENGLPEP 291


>gi|71738145|ref|YP_275142.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|119369605|sp|Q48HJ1|FOLD2_PSE14 RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|71558698|gb|AAZ37909.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320323633|gb|EFW79717.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320328272|gb|EFW84276.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330878649|gb|EGH12798.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 300

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 7/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + ++++  V  LK + G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVSTEVKILKAD-GIEPALAVILVGNDPASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   SQ  +   +  LN DDS++GIL+QLPLPS + E   +Q+I P KDVDG H
Sbjct: 64  SLEHRLPAKSSQAQVLALIAELNADDSVNGILLQLPLPSHMEEARALQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G   + L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQG--RSVLTPCTPSGCMHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDASWLKPGAVVIDVGINRIEDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           ++ LVGD+  D   SV  AITPVPGGVGPMTIA LM NTV AA +
Sbjct: 239 RSRLVGDIDFDNALSVASAITPVPGGVGPMTIAFLMKNTVTAARQ 283


>gi|297529437|ref|YP_003670712.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           C56-T3]
 gi|297252689|gb|ADI26135.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           C56-T3]
          Length = 284

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 192/291 (65%), Gaps = 11/291 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A  +   +A+  A LK + GV+ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 4   QIISGTEMARTIRTALADEAAQLKAD-GVEPGLAVILVGDDPASHSYVKGKQKACAEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  Y FP  I +  L   +  LN D ++HGILVQLPLP  + E S+I++I PEKDVDG 
Sbjct: 63  RSFLYTFPAAIDEETLLAKIRELNVDPAVHGILVQLPLPDHICEWSVIETIAPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+MIG      +PCTP G IL++ Q  G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 123 HPINVGKMMIGQ--RAFLPCTPHG-ILVMVQSAGIDIAGKHVVVVGRSNIVGKPVGQLFL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT  HSKT +L  I R ADIL+VAVG+ R++  + +K G++VIDVG+NR+ +   
Sbjct: 180 REHATVTYTHSKTPDLAAITRQADILIVAVGKARLIGPEHVKPGAVVIDVGVNRLEN--- 236

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           GK  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ AA R L  K
Sbjct: 237 GK--LCGDVDFDAVKEVAGYITPVPGGVGPMTITMLLHNTIEAA-RQLAAK 284


>gi|196041527|ref|ZP_03108819.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus NVH0597-99]
 gi|228935504|ref|ZP_04098322.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|229093240|ref|ZP_04224358.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-42]
 gi|196027515|gb|EDX66130.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus NVH0597-99]
 gi|228690214|gb|EEL44008.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-42]
 gi|228824256|gb|EEM70070.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
          Length = 286

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 147/285 (51%), Positives = 191/285 (67%), Gaps = 10/285 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKR 280


>gi|294085440|ref|YP_003552200.1| methenyltetrahydrofolate cyclohydrolase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665015|gb|ADE40116.1| Methenyltetrahydrofolate cyclohydrolase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 297

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 186/291 (63%), Gaps = 6/291 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  +  L + +A   + +K   G    LAVVLVG + AS  YV  K    +  G  
Sbjct: 5   IIDGKAFSEKLVETVAVEASKIKNAIGRPPALAVVLVGENSASKVYVRNKIERTEAAGMR 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++    D  Q  L   +  +N DD++ GILVQLPLP  + E ++I ++ PEKDVDG H
Sbjct: 65  SIEHRLDADTDQATLLALIEEMNNDDAVDGILVQLPLPDQIDEDAVINAVAPEKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG +  G  +  LVPCTP G +LL+    G  LSG +AVV+GRSN+ GKPM QLLL 
Sbjct: 125 VVNAGLLATGQDS--LVPCTPYGCLLLLRDQLGS-LSGLNAVVVGRSNIVGKPMAQLLLK 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
            + TVT+AHS+TK+L E+C  ADILV AVGR  M+  D++K G+ VIDVGINR+ +P+  
Sbjct: 182 ESCTVTIAHSRTKDLKEVCARADILVAAVGRAEMIDGDYVKPGATVIDVGINRVAAPERG 241

Query: 243 -GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            GK  L GDV  D   +  GAITPVPGGVGPMTIA L+ NT +AA R   +
Sbjct: 242 EGKFRLTGDVDYDSAAAKAGAITPVPGGVGPMTIACLLRNTAVAAARRFNV 292


>gi|320159648|ref|YP_004172872.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Anaerolinea thermophila UNI-1]
 gi|319993501|dbj|BAJ62272.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Anaerolinea thermophila UNI-1]
          Length = 314

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 194/288 (67%), Gaps = 3/288 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DG  +A  +  +IA+ VA    E     GLA VLVG++PAS  YV +K +  +  G 
Sbjct: 26  QILDGAAMAEKIRQQIAQEVAQRLAEGKPAPGLATVLVGDNPASQVYVKSKHKACQQVGI 85

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S+ Y  P   SQ ++ + V  LN D +++GILVQLPLPS + E+ ++ +I  EKDVDG 
Sbjct: 86  RSMGYELPATASQQEVMDLVKRLNDDPAVNGILVQLPLPSGLDEEKVLGAISIEKDVDGF 145

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++         VPCTPAG ++LIE     DL+G +AVV+GRSN+ G P+  LL+
Sbjct: 146 HPINIGRLAQKGREPLFVPCTPAGCMVLIESVLP-DLNGANAVVLGRSNIVGMPVALLLV 204

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI-NSPQ 241
             NATVT+ HS+T+NL E+CR+AD+LV AVGR  MV+VDW+K G++VIDVGINR+ ++ Q
Sbjct: 205 RANATVTICHSRTRNLKEVCRSADVLVAAVGRAEMVRVDWVKPGAVVIDVGINRVEDATQ 264

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
                LVGDVA DE K V G +TPVPGGVGPMTIAML+ NT+ AA  S
Sbjct: 265 PRGYRLVGDVAFDEVKDVAGWLTPVPGGVGPMTIAMLLQNTLRAARLS 312


>gi|289167716|ref|YP_003445985.1| FolD bifunctional protein; includes: methylenetetrahydrofolate
           dehydrogenase, methenyltetrahydrofolate cyclohydrolase
           [Streptococcus mitis B6]
 gi|288907283|emb|CBJ22118.1| FolD bifunctional protein; includes: methylenetetrahydrofolate
           dehydrogenase, methenyltetrahydrofolate cyclohydrolase
           [Streptococcus mitis B6]
          Length = 306

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE    LK+ETG+  GL V+LVGN+PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTERLKEETGLVPGLVVILVGNNPASQVYVRNKERSALAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 82  GFRSEVVRVPDTITQEELLDLIAKYNQDSAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 199 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 258 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 306


>gi|222528974|ref|YP_002572856.1| methenyltetrahydrofolate cyclohydrolase [Caldicellulosiruptor
           bescii DSM 6725]
 gi|222455821|gb|ACM60083.1| Methenyltetrahydrofolate cyclohydrolase [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 289

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 194/285 (68%), Gaps = 8/285 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDGK +A  + +++   V  LK + G++  LAVV+VG+DPAS SYV++K +     G
Sbjct: 3   AKIIDGKKIAQEIKNEVKTEVEKLK-QRGIEPTLAVVIVGDDPASRSYVNSKKKACGEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +SV++    D +Q +LE+ +  LN+D+ I+GILVQLPLP+ + E+ I   I+P KDVDG
Sbjct: 62  INSVEFALSKDTTQDELESLIDRLNRDEKINGILVQLPLPNGLDEKRICTKILPHKDVDG 121

Query: 122 LHVVNAGKVMIG-DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G V  G +F   + PCTP G I L+++ +  ++ G+HAVVIGRSN+ GKP+  L
Sbjct: 122 FHPLNVGMVATGIEFERAIKPCTPFGIIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK+L EIC+ ADILV AVG+PR V  D +K G++VIDVGINR  + 
Sbjct: 181 LLRENATVTICHSYTKDLKEICKQADILVAAVGKPRFVTSDMVKEGAVVIDVGINRDGAT 240

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q     LVGDV  E  + V   ITPVPGGVGPMT+AMLM NT+ A
Sbjct: 241 QK----LVGDVDFETVEKVASFITPVPGGVGPMTVAMLMKNTLFA 281


>gi|312116203|ref|YP_004013799.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221332|gb|ADP72700.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 302

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 152/293 (51%), Positives = 197/293 (67%), Gaps = 7/293 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +G ++DG  +A+ +  + A+  A   ++TG   GLAVVLVG +PAS  YV +K ++A+  
Sbjct: 10  VGRILDGVAMAAEIKAEAAKLAAAFAEKTGRAPGLAVVLVGENPASQVYVRSKLKLAREL 69

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSV++    DI +  L   +  LN D ++ GILVQLPLP  +     I +I PEKDVD
Sbjct: 70  GFHSVEHRPAADIDRAGLLALIAQLNADPAVDGILVQLPLPPHLDADDAIAAISPEKDVD 129

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G HVVNAGK+  G    G VPCTP G + LI+  +  +L+G +AVV+GRSN+ GKPM  L
Sbjct: 130 GFHVVNAGKLFAG--LPGFVPCTPLGCLKLIKSVQ-PNLAGANAVVVGRSNIVGKPMAHL 186

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHSKT++LP +   AD+LV AVGRP M+   WIK G++V+DVGINR+  P
Sbjct: 187 LLQENCTVTIAHSKTRDLPAVIAGADVLVAAVGRPSMIPGKWIKPGAIVVDVGINRV--P 244

Query: 241 QL-GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            L GK+ LVGDV  E  K V GAITPVPGGVGPMT+A LM NT  AAY   G+
Sbjct: 245 ALDGKSKLVGDVDFESAKHVAGAITPVPGGVGPMTVAYLMVNTCRAAYLRAGL 297


>gi|322374621|ref|ZP_08049135.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. C300]
 gi|321280121|gb|EFX57160.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. C300]
          Length = 285

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 195/290 (67%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L +++AE  A LK+ETG+  GL V+LVGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGKALAAKLQEQLAEKTAKLKEETGLVPGLVVILVGNNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQAELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTL 282


>gi|260437321|ref|ZP_05791137.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Butyrivibrio crossotus DSM 2876]
 gi|292810233|gb|EFF69438.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Butyrivibrio crossotus DSM 2876]
          Length = 286

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 195/283 (68%), Gaps = 5/283 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK+++  L D++ E V   K E G+++ LAV+ VGNDPAS  YV  K +  ++ 
Sbjct: 1   MAKVIDGKLISKELKDELKEKVKAYK-EQGIEITLAVIQVGNDPASSVYVGNKKKGCEYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S+ Y    + ++  L   + +LNKD+ ++GILVQLPLPS ++E  +I++I P KDVD
Sbjct: 60  GINSLSYELEENTTEEQLLELIDTLNKDNKVNGILVQLPLPSHINEDKVIKAISPAKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + G + IG    G V CTPAG + L+++    ++ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFHPQSVGALSIGQ--PGFVSCTPAGIVELLKR-SNIEIEGKECVVVGRSNIVGKPMALL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+TKNL E+ + ADILVVA+G+P+ +  +++K G++VIDVGI+R+ + 
Sbjct: 177 LLRENGTVTIAHSRTKNLKEVTKRADILVVAIGKPKFITKEYVKEGAVVIDVGIHRLGTS 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           + GK++L GDV  D+   +  AITPVPGGVGPMTIAMLM N V
Sbjct: 237 ESGKSILCGDVDYDDVFPIASAITPVPGGVGPMTIAMLMNNCV 279


>gi|330989332|gb|EGH87435.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331010430|gb|EGH90486.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 300

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 7/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + ++++  V  LK + G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVSTEVKILKAD-GIEPALAVILVGNDPASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   SQ  +   +  LN DDS++GIL+QLPLPS + E   +Q+I P KDVDG H
Sbjct: 64  SLEHRLPAKSSQAQVLALIAELNADDSVNGILLQLPLPSHMEEARALQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G   + L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQG--RSVLTPCTPSGCMHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSNDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIEDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           ++ LVGDV  D   SV  AITPVPGGVGPMTIA LM NTV AA +
Sbjct: 239 RSRLVGDVDFDNALSVASAITPVPGGVGPMTIAFLMKNTVTAARQ 283


>gi|251782894|ref|YP_002997197.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
 gi|242391524|dbj|BAH81983.1| methenyl tetrahydrofolate cyclohydrolase [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|323127698|gb|ADX24995.1| Putative bifunctional methylenetetrahydrofolate dehydrogenase /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 284

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 196/290 (67%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  +  ++   V  LK+E G+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTEIMDGKALAQKMQSELTIKVQQLKQEKGIVPGLVVILVGDNPASQVYVRNKERAALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N+DD+IHGILVQLPLP+ ++++ II +I P+KDVD
Sbjct: 61  GFKSETVRLSESICQEELIAIIERYNEDDTIHGILVQLPLPNHINDKKIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ +++  DL G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPAGIVEMLREYE-VDLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T++L ++CR AD+L+VA+G+   V  D++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRHLEDVCRHADVLIVAIGQGHFVTKDFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDVA DE   V   ITPVPGGVGPMTI ML+  T  AA RS+
Sbjct: 237 --GK--LIGDVAFDEVSQVASKITPVPGGVGPMTITMLLEQTYQAALRSV 282


>gi|223933888|ref|ZP_03625852.1| Methenyltetrahydrofolate cyclohydrolase [Streptococcus suis
           89/1591]
 gi|330832342|ref|YP_004401167.1| FolD bifunctional protein [Streptococcus suis ST3]
 gi|223897446|gb|EEF63843.1| Methenyltetrahydrofolate cyclohydrolase [Streptococcus suis
           89/1591]
 gi|329306565|gb|AEB80981.1| FolD bifunctional protein [Streptococcus suis ST3]
          Length = 282

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 189/287 (65%), Gaps = 9/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK +   L   +AE  A LK+E GV  GL V+LVG +PAS  YV  K R A   GF
Sbjct: 2   TVIDGKALGVKLQAALAEKTARLKEEKGVVPGLVVILVGENPASQVYVRNKERSALAAGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S     P  IS+ DL + +   N+DD  HGILVQLPLP+ +SE+ ++ +I P+KDVDG 
Sbjct: 62  KSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHISEEKVLLAIDPDKDVDGF 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N GK   G     ++P TPAG + + ++++  +L G+ A+VIGRSN+ GKPM QLLL
Sbjct: 122 HPTNMGKFWSGHPV--MIPSTPAGIMEMFKEYQ-IELEGKSALVIGRSNIVGKPMAQLLL 178

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+AHS+TKNLPE+ R ADILVVA+GR   V  +++K G++VIDVG+NR  +   
Sbjct: 179 DANATVTIAHSRTKNLPELARQADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDEN--- 235

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  L+GDV  DE   V   ITPVPGGVGPMTI MLM  T  A  RS
Sbjct: 236 GK--LIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRS 280


>gi|21910693|ref|NP_664961.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS315]
 gi|28895617|ref|NP_801967.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes SSI-1]
 gi|139473474|ref|YP_001128190.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes str. Manfredo]
 gi|209559669|ref|YP_002286141.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes NZ131]
 gi|81759064|sp|Q8K6S8|FOLD_STRP3 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370058|sp|Q5XB24|FOLD_STRP6 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370059|sp|Q1JAV4|FOLD_STRPB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370060|sp|Q1JL04|FOLD_STRPC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370061|sp|Q1JG29|FOLD_STRPD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370062|sp|Q1J5U5|FOLD_STRPF RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158705775|sp|A2RDM9|FOLD_STRPG RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|226704407|sp|B5XM84|FOLD_STRPZ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|21904896|gb|AAM79764.1| putative methylenetetrahydrofolate dehydrogenase [Streptococcus
           pyogenes MGAS315]
 gi|28810866|dbj|BAC63800.1| putative bifunctional methylenetetrahydrofolate dehydrogenase /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           pyogenes SSI-1]
 gi|134271721|emb|CAM29954.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus pyogenes str. Manfredo]
 gi|209540870|gb|ACI61446.1| Putative bifunctional methylenetetrahydrofolate dehydrogenase /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           pyogenes NZ131]
          Length = 284

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 194/289 (67%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +  ++A  V  LK++ G+  GLAV+LVG+DPAS  YV  K R A   
Sbjct: 1   MTELIDGKALAQKMQQELAAKVNNLKQKKGIVPGLAVILVGDDPASQVYVRNKERAALTV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N D++IHGILVQLPLP+ ++++ II +I P+KDVD
Sbjct: 61  GFKSETVRLSEFICQEELIAVIERYNADNTIHGILVQLPLPNHINDKKIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTP+G + L+ ++   +L G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPSGIMELLREY-NVNLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T+ L E+CR AD+L+VA+G+   +   +IK G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRQLEEVCRCADVLIVAIGQGHFITKQYIKEGAIVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             GK  L+GDVA DE   V   ITPVPGGVGPMTIAML+  T  +A RS
Sbjct: 237 --GK--LIGDVAFDEVAEVAAKITPVPGGVGPMTIAMLLEQTYQSALRS 281


>gi|302872169|ref|YP_003840805.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302575028|gb|ADL42819.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 289

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 142/285 (49%), Positives = 195/285 (68%), Gaps = 8/285 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDGK +A  + +++   V  LK + G++  LAVV+VG+DPAS SYV++K +     G
Sbjct: 3   AKIIDGKKIAQEIKNEVKIEVKKLK-QRGIEPTLAVVIVGDDPASRSYVNSKKKACSEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +SV++    D +Q +LE+ +  LN+D+ I+GILVQLPLP+ + E+ I   I+P KDVDG
Sbjct: 62  INSVEFALSKDTTQEELESLIDRLNRDEKINGILVQLPLPNGLDEKRICTKILPHKDVDG 121

Query: 122 LHVVNAGKVMIG-DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G V  G +F   + PCTP G I L+++ +  ++ G+HAVVIGRSN+ GKP+  L
Sbjct: 122 FHPLNVGMVATGIEFERAIKPCTPFGIIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK+L EIC+ ADILV AVG+PR V  + +K G++VIDVGINR ++ 
Sbjct: 181 LLRENATVTICHSYTKDLKEICKQADILVAAVGKPRFVTSEMVKEGAVVIDVGINRDDAT 240

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q     LVGDV  E  + V   ITPVPGGVGPMT+AMLM NT+ A
Sbjct: 241 QK----LVGDVDFETVEKVASFITPVPGGVGPMTVAMLMKNTLFA 281


>gi|42783300|ref|NP_980547.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus ATCC 10987]
 gi|81409219|sp|Q731B2|FOLD_BACC1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|42739228|gb|AAS43155.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus ATCC 10987]
          Length = 286

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYLKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|148553863|ref|YP_001261445.1| methenyltetrahydrofolate cyclohydrolase [Sphingomonas wittichii
           RW1]
 gi|190359409|sp|A5V4U1|FOLD1_SPHWW RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|148499053|gb|ABQ67307.1| Methenyltetrahydrofolate cyclohydrolase [Sphingomonas wittichii
           RW1]
          Length = 295

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 150/297 (50%), Positives = 191/297 (64%), Gaps = 7/297 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A+ +  ++A  V  L  E G   GLAVVLVG DPAS  YV  K    +  
Sbjct: 1   MAAIIDGKAIAAAIRAEVAAGVTALTAEGGAAPGLAVVLVGEDPASLVYVGRKIAQTRQA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S ++  P    + DL   +  LN+DD +HGILVQLPLP  +    ++ +I P KDVD
Sbjct: 61  GIRSFEHRLPAGTGEADLLGLIERLNRDDEVHGILVQLPLPRHIRADRVLDAIDPLKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G++ IG  T GLVPCTP G +LL+E     D  G  AVVIG+SN+ GKP+  L
Sbjct: 121 GFHPVNVGRLSIG--TDGLVPCTPLGCMLLLETVID-DFRGLKAVVIGKSNIVGKPVAML 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL R  TVT+ H  T+NLP+I RTADI+VVA G P +V+ DW++ G++VIDVGINRI  P
Sbjct: 178 LLERECTVTVTHILTRNLPDIVRTADIVVVAAGSPGLVRGDWVRPGAVVIDVGINRIGEP 237

Query: 241 QLGK-TVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK-SPK 295
             GK + LVGD A +      AITPVPGGVGPMT+A L+ NT++AA R  G   SPK
Sbjct: 238 --GKDSRLVGDAAFDELGHAAAITPVPGGVGPMTVACLLRNTLVAARRQQGADASPK 292


>gi|50914600|ref|YP_060572.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS10394]
 gi|56808399|ref|ZP_00366151.1| COG0190: 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus pyogenes
           M49 591]
 gi|94988858|ref|YP_596959.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS9429]
 gi|94990759|ref|YP_598859.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS10270]
 gi|94992749|ref|YP_600848.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS2096]
 gi|94994737|ref|YP_602835.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS10750]
 gi|50903674|gb|AAT87389.1| Methylenetetrahydrofolate dehydrogenase (NADP+) [Streptococcus
           pyogenes MGAS10394]
 gi|94542366|gb|ABF32415.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Streptococcus
           pyogenes MGAS9429]
 gi|94544267|gb|ABF34315.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Streptococcus
           pyogenes MGAS10270]
 gi|94546257|gb|ABF36304.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Streptococcus
           pyogenes MGAS2096]
 gi|94548245|gb|ABF38291.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Streptococcus
           pyogenes MGAS10750]
          Length = 286

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 194/289 (67%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +  ++A  V  LK++ G+  GLAV+LVG+DPAS  YV  K R A   
Sbjct: 3   MTELIDGKALAQKMQQELAAKVNNLKQKKGIVPGLAVILVGDDPASQVYVRNKERAALTV 62

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N D++IHGILVQLPLP+ ++++ II +I P+KDVD
Sbjct: 63  GFKSETVRLSEFICQEELIAVIERYNADNTIHGILVQLPLPNHINDKKIILAIDPKKDVD 122

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTP+G + L+ ++   +L G+HAV+IGRSN+ GKPM QL
Sbjct: 123 GFHPMNTGHLWSG--RPLMVPCTPSGIMELLREY-NVNLEGKHAVIIGRSNIVGKPMAQL 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T+ L E+CR AD+L+VA+G+   +   +IK G++VIDVG+NR ++ 
Sbjct: 180 LLDKNATVTLTHSRTRQLEEVCRCADVLIVAIGQGHFITKQYIKEGAIVIDVGMNRDDN- 238

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             GK  L+GDVA DE   V   ITPVPGGVGPMTIAML+  T  +A RS
Sbjct: 239 --GK--LIGDVAFDEVAEVAAKITPVPGGVGPMTIAMLLEQTYQSALRS 283


>gi|324328095|gb|ADY23355.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 286

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYMKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|58039258|ref|YP_191222.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Gluconobacter oxydans 621H]
 gi|81352253|sp|Q5FST0|FOLD_GLUOX RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|58001672|gb|AAW60566.1| Methylene-THF dehydrogenase [Gluconobacter oxydans 621H]
          Length = 304

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 147/283 (51%), Positives = 186/283 (65%), Gaps = 5/283 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  LTD++   VA   ++     GLAVVLVGNDPAS  YV  K       G  
Sbjct: 15  IIDGKGIARALTDQVGREVAKFVEQGNTIPGLAVVLVGNDPASEVYVKNKAIQTHRVGMR 74

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P   SQ +L + +  LN +  IHGILVQLPLP+ +   ++  +I P KDVDGL 
Sbjct: 75  SFMHMLPQSTSQDELLDLIAQLNANPKIHGILVQLPLPAQIDPVAVTNAIAPHKDVDGLG 134

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VNAG++ +G    G+VPCTP G ++L++     D++G HAVVIG SNL GKPM QLLL 
Sbjct: 135 EVNAGRLSLG--IDGIVPCTPLGCLMLLQSVHK-DMTGMHAVVIGASNLVGKPMAQLLLK 191

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            N TVT+AH  T+N  E+ R ADILVVA G+  +V+ DWIK G+ VIDVGI R+ + + G
Sbjct: 192 ENCTVTVAHIHTRNTKELAREADILVVATGKSELVRGDWIKPGATVIDVGITRVPA-ENG 250

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           KT LVGDVA DE   + G ITPVPGGVGPMTIA L+ NT+ AA
Sbjct: 251 KTRLVGDVAFDEAFPIAGHITPVPGGVGPMTIACLLHNTLQAA 293


>gi|302188788|ref|ZP_07265461.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. syringae 642]
          Length = 300

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 143/296 (48%), Positives = 192/296 (64%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++   V  LK E G++  LAV+LVGND AS  YV  K   A   G H
Sbjct: 5   IIDGKAAAARVLQQVRHDVNTLKAE-GIEPALAVILVGNDAASEVYVRNKILRAGEAGIH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D SQ  L   +  LN D++++GIL+QLPLP+ + E  ++Q+I P KDVDG H
Sbjct: 64  SLEHRLPADSSQARLLALIAELNADNTVNGILLQLPLPAHIEENRVLQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCLHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSTDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIEDH--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    V  AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDSASEVAAAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|15675405|ref|NP_269579.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes M1 GAS]
 gi|19746455|ref|NP_607591.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS8232]
 gi|71911047|ref|YP_282597.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS5005]
 gi|81533518|sp|Q99YX2|FOLD_STRP1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|81653067|sp|Q7CN13|FOLD_STRP8 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370063|sp|Q48SM7|FOLD_STRPM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|13622591|gb|AAK34300.1| putative bifunctional methylenetetrahydrofolate dehydrogenase /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           pyogenes M1 GAS]
 gi|19748658|gb|AAL98090.1| putative bifunctional methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS8232]
 gi|71853829|gb|AAZ51852.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS5005]
          Length = 284

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 194/289 (67%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +  ++A  V  LK++ G+  GLAV+LVG+DPAS  YV  K R A   
Sbjct: 1   MTELIDGKALAQKMQQELAAKVNNLKQKKGIVPGLAVILVGDDPASQVYVRNKERAALTV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N D++IHGILVQLPLP+ ++++ II +I P+KDVD
Sbjct: 61  GFKSETVRLSEFICQEELIAVIERYNADNTIHGILVQLPLPNHINDKKIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTP+G + L+ ++   +L G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPSGIMELLREY-NVNLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T+ L E+CR AD+L+VA+G+   +   +IK G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRQLEEVCRCADVLIVAIGQGHFITKQYIKDGAIVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             GK  L+GDVA DE   V   ITPVPGGVGPMTIAML+  T  +A RS
Sbjct: 237 --GK--LIGDVAFDEVAEVAAKITPVPGGVGPMTIAMLLEQTYQSALRS 281


>gi|83945080|ref|ZP_00957446.1| putative methylenetetrahydrofolate dehydrogenase [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851862|gb|EAP89717.1| putative methylenetetrahydrofolate dehydrogenase [Oceanicaulis
           alexandrii HTCC2633]
          Length = 310

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 145/280 (51%), Positives = 189/280 (67%), Gaps = 5/280 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +    A     L+   G    LAVVLVG DPAS  YV  K R  +  G  
Sbjct: 14  LIDGKAAAAAVDAAAAAGARQLEPRLGRAPCLAVVLVGEDPASQVYVRNKVRRTEAAGMR 73

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV++  P DISQ +L   V +LN+D+ + GILVQLPLP  + E  ++Q+I P+KDVDGL 
Sbjct: 74  SVEHILPADISQAELLTVVRALNEDEGVDGILVQLPLPKGLDETEVVQTIRPDKDVDGLT 133

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             +AG +++G    G+ PCTP+G++ L +Q  G DL+G+  VVIGRS L GKP   L L+
Sbjct: 134 AQSAGALVLG--APGMRPCTPSGSVFLAKQALG-DLTGKSVVVIGRSILVGKPAALLFLA 190

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            N TVT+AHS+T++LP +CR ADI+V AVGRP MV+ DW+K G+ VIDVGINR+   + G
Sbjct: 191 ENCTVTLAHSRTQDLPAVCREADIIVAAVGRPNMVKGDWLKPGACVIDVGINRVEG-ENG 249

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           K+ LVGDV  ++     G +TPVPGGVGPMTIAML+ANTV
Sbjct: 250 KSRLVGDVDFEQAIETAGFVTPVPGGVGPMTIAMLLANTV 289


>gi|71903835|ref|YP_280638.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes MGAS6180]
 gi|306827049|ref|ZP_07460347.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes ATCC 10782]
 gi|71802930|gb|AAX72283.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Streptococcus
           pyogenes MGAS6180]
 gi|304430795|gb|EFM33806.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus pyogenes ATCC 10782]
          Length = 286

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 194/289 (67%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  +  ++A  V  LK++ G+  GLAV+LVG+DPAS  YV  K R A   
Sbjct: 3   MTELIDGKALAQKMQQELAAKVNNLKQKKGIVPGLAVILVGDDPASQVYVRNKERAALTV 62

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N D++IHGILVQLPLP+ ++++ II +I P+KDVD
Sbjct: 63  GFKSETVRLSEFICQEELIAVIERYNADNTIHGILVQLPLPNHINDKKIILAIDPKKDVD 122

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTP+G + L+ ++   +L G+HAV+IGRSN+ GKPM QL
Sbjct: 123 GFHPMNTGHLWSG--RPLMVPCTPSGIMELLREY-NVNLEGKHAVIIGRSNIVGKPMAQL 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T+ L E+CR AD+L+VA+G+   +   +IK G++VIDVG+NR ++ 
Sbjct: 180 LLDKNATVTLTHSRTRQLEEVCRCADVLIVAIGQGHFITKQYIKDGAIVIDVGMNRDDN- 238

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             GK  L+GDVA DE   V   ITPVPGGVGPMTIAML+  T  +A RS
Sbjct: 239 --GK--LIGDVAFDEVAEVAAKITPVPGGVGPMTIAMLLEQTYQSALRS 283


>gi|229086756|ref|ZP_04218922.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-44]
 gi|228696577|gb|EEL49396.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-44]
          Length = 286

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEDVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN+DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPDTITEERLLAEIDRLNEDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKTKN+ E+ + ADIL+VA+GRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTKNIKELAKLADILIVAIGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    + G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDIAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|312127958|ref|YP_003992832.1| methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777977|gb|ADQ07463.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 289

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 194/285 (68%), Gaps = 8/285 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDGK +A  + +++   V  LK + G++  LAVV+VG+DPAS SYV++K +     G
Sbjct: 3   AKIIDGKKIAQEIKNEVKIEVEKLK-QRGIEPTLAVVIVGDDPASRSYVNSKKKACGEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +SV++    D +Q +LE+ +  LN+D+ I+GILVQLPLP+ + E+ I   I+P KDVDG
Sbjct: 62  INSVEFALSKDTTQEELESLIDRLNRDEKINGILVQLPLPNGLDEKRICTKILPHKDVDG 121

Query: 122 LHVVNAGKVMIG-DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G V  G +F   + PCTP G I L+++ +  ++ G+HAVVIGRSN+ GKP+  L
Sbjct: 122 FHPLNVGMVATGIEFERAIKPCTPFGIIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK+L EIC+ ADILV AVG+PR V  D +K G++VIDVGINR  + 
Sbjct: 181 LLRENATVTICHSYTKDLKEICKQADILVAAVGKPRFVTSDMVKEGAVVIDVGINRDGAT 240

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q     LVGDV  E  + V   ITPVPGGVGPMT+AMLM NT+ A
Sbjct: 241 QK----LVGDVDFETVEKVASFITPVPGGVGPMTVAMLMKNTLFA 281


>gi|157149818|ref|YP_001449992.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus gordonii str. Challis substr. CH1]
 gi|189044593|sp|A8AW32|FOLD_STRGC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|157074612|gb|ABV09295.1| methenyltetrahydrofolate cyclohydrolase [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 284

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 144/290 (49%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A+ L  K+A+  A LK++TG   GL VVLVGN+PAS  YV  K R A   
Sbjct: 1   MAELIDGKALAAKLQGKLAQKTAKLKEKTGQTPGLVVVLVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVQFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|196234140|ref|ZP_03132973.1| Methenyltetrahydrofolate cyclohydrolase [Chthoniobacter flavus
           Ellin428]
 gi|196221791|gb|EDY16328.1| Methenyltetrahydrofolate cyclohydrolase [Chthoniobacter flavus
           Ellin428]
          Length = 294

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 150/294 (51%), Positives = 199/294 (67%), Gaps = 15/294 (5%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +A     +   ++A LK   GV  GLAVVLVG+DPAS +YV +K +M    G 
Sbjct: 2   TLIDGKAIAQKTYAESKAAIANLKAR-GVTPGLAVVLVGDDPASRAYVRSKDKMCHELGM 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV++    D +Q DL   V  LN D +IHGILVQ P P  + E++II++I P KDVDG 
Sbjct: 61  HSVKHELAADTAQADLIALVKQLNADPAIHGILVQSPPPPHIDERAIIETIDPRKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGA-ILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
           H ++  K+ +GD   G VPCTP G   LLIE   G + +G + VV+GRS + GKP+  LL
Sbjct: 121 HPISVAKLALGD-ADGFVPCTPLGCQRLLIES--GIEAAGANVVVLGRSMIVGKPLALLL 177

Query: 182 LSR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI 237
           +++    +ATVT+AHS+T+NL E+CR ADIL+ A+GRP  V+ D++K G++VIDVGINR+
Sbjct: 178 MNKGKGGDATVTIAHSRTRNLAEVCRRADILIAAIGRPEFVKADFVKDGAVVIDVGINRV 237

Query: 238 ---NSPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
              N+P+  K  +VGDVA  E      AITPVPGGVGPMTIAMLMANT+ +A R
Sbjct: 238 DDLNTPKGYK--IVGDVAFTEVAPKCRAITPVPGGVGPMTIAMLMANTIASAQR 289


>gi|15900713|ref|NP_345317.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae TIGR4]
 gi|111657766|ref|ZP_01408487.1| hypothetical protein SpneT_02001054 [Streptococcus pneumoniae
           TIGR4]
 gi|81532100|sp|Q97RI9|FOLD_STRPN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|14972298|gb|AAK74957.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae TIGR4]
          Length = 285

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 197/293 (67%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLSKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|295695404|ref|YP_003588642.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus tusciae
           DSM 2912]
 gi|295411006|gb|ADG05498.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus tusciae
           DSM 2912]
          Length = 285

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 186/286 (65%), Gaps = 10/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DGK +A+ L  +I   V  L+   G+  GLAV+LVG+DPAS SYV  K + +   G 
Sbjct: 4   QILDGKQLAAALRQEIRRDVEELRARWGIVPGLAVLLVGDDPASQSYVRGKQKASTEVGI 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV    P D+S+  L   +   N+D SIHGILVQLPLP  ++E  +I  I P KDVDG 
Sbjct: 64  HSVVERLPADLSERTLLERIDHYNEDPSIHGILVQLPLPPQIAEDRVITRISPTKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N G++  G    G VPCTPAG + +I + +  ++SG HAVV+GRS + GKP+ QLLL
Sbjct: 124 HPWNVGRLYSGG--EGFVPCTPAGILEMIRRNR-IEISGAHAVVVGRSGIVGKPVAQLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+ HSKTKNL    + ADILV AVGRP ++  D IK G+ VIDVGI R++    
Sbjct: 181 RENATVTICHSKTKNLEFYTKQADILVAAVGRPGLITADMIKPGAAVIDVGITRVD---- 236

Query: 243 GKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           G+  LVGDV  E  K   G ITPVPGGVGPMTIAML+ NT+ +A R
Sbjct: 237 GR--LVGDVDFEAVKERAGWITPVPGGVGPMTIAMLLYNTLWSAKR 280


>gi|289624010|ref|ZP_06456964.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289650515|ref|ZP_06481858.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330868171|gb|EGH02880.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 300

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 7/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + ++++  V  LK + G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVSTEVKILKAD-GIEPALAVILVGNDPASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   SQ  +   +  LN DDS++GIL+QLPLPS + E   +Q+I P KDVDG H
Sbjct: 64  SLEHRLPAKSSQAQVLALIAELNADDSVNGILLQLPLPSHMEEARALQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G   + L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQG--RSVLTPCTPSGCMHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRIIDASWLKPGAVVIDVGINRIKDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           ++ LVGDV  D   SV  AITPVPGGVGPMTIA LM NTV AA +
Sbjct: 239 RSRLVGDVDFDNALSVASAITPVPGGVGPMTIAFLMKNTVTAARQ 283


>gi|322385955|ref|ZP_08059595.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus cristatus ATCC 51100]
 gi|321269938|gb|EFX52858.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus cristatus ATCC 51100]
          Length = 284

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/290 (50%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A  L  K+AE  A LK ETG + GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MANIIDGKALAEKLQAKLAEKTAKLKAETGQEPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P   SQ +L   +   N+D + HGILVQLPLP+ + +++++ +I P+KDVD
Sbjct: 61  GFRSEVVRLPESTSQEELLTLIAKYNQDPAWHGILVQLPLPAHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G++  G     ++P TPAG + +  ++K  DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPTNMGRLWSGHPL--MIPSTPAGIMEMFREYK-VDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LLS+NATVT+ HS+T +L +I + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLSKNATVTLTHSRTHHLAKIAKKADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   V   ITPVP GVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVAEVASLITPVPKGVGPMTITMLMEQTYQAFVRSL 282


>gi|114799083|ref|YP_761926.1| putative FolD bifunctional protein [Hyphomonas neptunium ATCC
           15444]
 gi|119369799|sp|Q0BX67|FOLD_HYPNA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|114739257|gb|ABI77382.1| putative FolD bifunctional protein [Hyphomonas neptunium ATCC
           15444]
          Length = 295

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/267 (53%), Positives = 180/267 (67%), Gaps = 5/267 (1%)

Query: 32  QVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSI 91
           Q  LAVVLVG DPAS  YV  K +M +  G  S+ +  P D  Q ++E  + SLN D  +
Sbjct: 29  QPCLAVVLVGEDPASEVYVRNKVKMTEAAGMVSIHHRLPADTGQAEVERLIESLNADPEV 88

Query: 92  HGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLI 151
            GIL+QLPLP  +   + I+ I P+KDVDGL  V+AG++ +G    GL PCTP G+++L 
Sbjct: 89  DGILLQLPLPKGLDADAAIEKINPDKDVDGLTEVSAGRLSLG--KPGLRPCTPVGSVILA 146

Query: 152 EQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVA 211
           ++  G DLSG++ VVIGRS L GKP   L L+ N TVT+AHSKT +L  +CR+ADILV A
Sbjct: 147 KRALGPDLSGKNVVVIGRSILVGKPAALLFLAENCTVTIAHSKTADLANVCRSADILVPA 206

Query: 212 VGRPRMVQVDWIKTGSLVIDVGINRINSPQL--GKTVLVGDVADE-CKSVVGAITPVPGG 268
           VGRP MV+ DW+K G+ VIDVGINRI +P+   GKT LVGD   E C  V G ITPVPGG
Sbjct: 207 VGRPEMVRGDWVKPGAAVIDVGINRIPAPEKGEGKTRLVGDAHYESCAEVAGFITPVPGG 266

Query: 269 VGPMTIAMLMANTVIAAYRSLGMKSPK 295
           VGPMTIA L+ NTV+AA    G   P+
Sbjct: 267 VGPMTIACLLRNTVLAACARRGWTVPE 293


>gi|22536673|ref|NP_687524.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus agalactiae 2603V/R]
 gi|25010609|ref|NP_735004.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus agalactiae NEM316]
 gi|76788200|ref|YP_329227.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus agalactiae A909]
 gi|76799062|ref|ZP_00781254.1| methenyltetrahydrofolate cyclohydrolase folD [Streptococcus
           agalactiae 18RS21]
 gi|77405305|ref|ZP_00782401.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae H36B]
 gi|77409324|ref|ZP_00786027.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae COH1]
 gi|77412380|ref|ZP_00788690.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae CJB111]
 gi|77414010|ref|ZP_00790182.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae 515]
 gi|81454967|sp|Q8E168|FOLD_STRA5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|81457382|sp|Q8E6M3|FOLD_STRA3 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370057|sp|Q3K2M6|FOLD_STRA1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|22533513|gb|AAM99396.1|AE014214_10 methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae 2603V/R]
 gi|23094963|emb|CAD46184.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76563257|gb|ABA45841.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae A909]
 gi|76585577|gb|EAO62143.1| methenyltetrahydrofolate cyclohydrolase  folD [Streptococcus
           agalactiae 18RS21]
 gi|77159936|gb|EAO71075.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae 515]
 gi|77161568|gb|EAO72569.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae CJB111]
 gi|77172056|gb|EAO75222.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae COH1]
 gi|77176100|gb|EAO78873.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus agalactiae H36B]
 gi|319744564|gb|EFV96917.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus agalactiae ATCC 13813]
          Length = 284

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 193/292 (66%), Gaps = 9/292 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK ++  +  ++   V  LK++ G+  GLAV+LVG++PAS  YV  K R A   
Sbjct: 1   MTELIDGKALSQKMQAELGRKVERLKEQHGIIPGLAVILVGDNPASQVYVRNKERSALEA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        ISQ +L + +   N+D SIHGILVQLPLP  ++++ II +I P+KDVD
Sbjct: 61  GFKSETLRLSESISQEELIDIIHQYNEDKSIHGILVQLPLPQHINDKKIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +  ++   DL G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPMMVPCTPAGIMEMFREYH-VDLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T+NL E+ + ADIL+VA+G+   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLDKNATVTLTHSRTRNLSEVTKEADILIVAIGQGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
             GK  L+GDV  ++   V   ITPVPGGVGPMTI ML+  T  AA RS+ +
Sbjct: 237 --GK--LIGDVVFEQVAEVASMITPVPGGVGPMTITMLLEQTYQAALRSVSL 284


>gi|310642665|ref|YP_003947423.1| methylenetetrahydrofolate dehydrogenase (nadp(+)) [Paenibacillus
           polymyxa SC2]
 gi|309247615|gb|ADO57182.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           polymyxa SC2]
          Length = 285

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 149/289 (51%), Positives = 192/289 (66%), Gaps = 10/289 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK ++  +   I + V  LK E   Q GLAVVLVG DPAS  YV  K +     G++
Sbjct: 5   IIDGKQISQDIRASIQQEVIRLK-EHSFQPGLAVVLVGEDPASQVYVKNKEKACHDLGYY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +    D SQ  L   V  LN   +IHGILVQLPLP  + E+++I +I  EKDVDG H
Sbjct: 64  SEVHRLAADTSQEALLKLVDKLNHQSNIHGILVQLPLPKHIQEKAVIDAIAVEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G ++IGD +  L+PCTPAG I LI++  G +++G+HAVVIGRSN+ GKP+  LL  
Sbjct: 124 PVNVGNLVIGDDS--LLPCTPAGVIELIKR-AGVEIAGKHAVVIGRSNIVGKPVSLLLQR 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVTM HS+T N+ E+ R ADILVVA+G+   +   ++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTMCHSRTANMAELSRQADILVVAIGKANFIDASFVKPGAVVIDVGMNRLEN---G 237

Query: 244 KTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           K  L GDV  E  K V G ITPVPGGVGPMTI MLM NT++AA RS G+
Sbjct: 238 K--LAGDVDFESVKQVSGPITPVPGGVGPMTITMLMQNTLVAAKRSYGL 284


>gi|258541324|ref|YP_003186757.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256632402|dbj|BAH98377.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635459|dbj|BAI01428.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638514|dbj|BAI04476.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256641568|dbj|BAI07523.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256644623|dbj|BAI10571.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256647678|dbj|BAI13619.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256650731|dbj|BAI16665.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256653722|dbj|BAI19649.1| methylene-tetrahydrofolate dehydrogenase [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 304

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 186/288 (64%), Gaps = 5/288 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           SLIDGK  A+ +   I E V    ++ GV  GLAV+LVGNDPAS  YV  K     H G 
Sbjct: 16  SLIDGKGFAAKMRQHIREDVLAFHEKHGVTPGLAVILVGNDPASEVYVRNKAVQTHHAGM 75

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  +  P + S+ +L   +  LNKD  IHGILVQLPLP+ +  + +  +I+PEKDVDGL
Sbjct: 76  RSFMHMLPENTSEAELLALIERLNKDPEIHGILVQLPLPNGLDGRRVTNAILPEKDVDGL 135

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
             +NAG++ +G     L+PCTP G +LL+    G D+ GQHAVVIG SNL GKPM  LLL
Sbjct: 136 GEINAGRLAVG--LPSLIPCTPLGCLLLLRGQLG-DMKGQHAVVIGASNLVGKPMALLLL 192

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +   TV++AH  T++   + R ADILVVA G   +V+ DWIK G+ VIDVGI RI +   
Sbjct: 193 AEGCTVSIAHIHTRDTAALARQADILVVATGCRELVRGDWIKPGATVIDVGITRIKTDD- 251

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GKT LVGDVA DE   V G ITPVPGGVGPMTIA L+ NT+ AA   L
Sbjct: 252 GKTRLVGDVAFDEAVKVAGRITPVPGGVGPMTIACLLKNTLTAAKLQL 299


>gi|315498533|ref|YP_004087337.1| methylenetetrahydrofolate dehydrogenase (nadp(+)) [Asticcacaulis
           excentricus CB 48]
 gi|315416545|gb|ADU13186.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Asticcacaulis
           excentricus CB 48]
          Length = 301

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 192/298 (64%), Gaps = 9/298 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G++IDG   A  L ++IA  VA LK E G+   L VV+VG DPAS  YV  K    K  G
Sbjct: 5   GNIIDGFGYAKGLRERIAGRVATLKAEHGLTPCLVVVIVGEDPASQIYVKNKGETTKAVG 64

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S     P D ++ DL   +  LN D  ++GILVQLPLP+ +S   +I +I P KDVDG
Sbjct: 65  MESRTIVLPADTTEADLLKLIGELNADTGVNGILVQLPLPAHMSSLKVIDAIDPLKDVDG 124

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQ----FKGCDLSGQHAVVIGRSNLFGKPM 177
            HV NAG++ +G     +VPCTP G+++L++         +LSG +AV++GRSN+ GKPM
Sbjct: 125 FHVQNAGRLAVG--LDAIVPCTPLGSLMLLKDALKTHDDGNLSGLNAVIVGRSNIVGKPM 182

Query: 178 GQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI 237
            QLLL+ N TVT+AHS+T NLP++CRTAD+LV AVGRP+ +Q DW+K G+ VIDVGINRI
Sbjct: 183 AQLLLNENCTVTIAHSRTANLPDLCRTADVLVAAVGRPKFIQGDWVKDGAYVIDVGINRI 242

Query: 238 NSPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
                GK  +VGDV  D       AITPVP GVGPMTIA L+ NT+ AA    G+  P
Sbjct: 243 EVD--GKNKIVGDVDFDAALPRATAITPVPKGVGPMTIACLLNNTLQAACVQHGLPVP 298


>gi|302670663|ref|YP_003830623.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase FolD
           [Butyrivibrio proteoclasticus B316]
 gi|302395136|gb|ADL34041.1| methylenetetrahydrofolate dehydrogenase/cyclohydrolase FolD
           [Butyrivibrio proteoclasticus B316]
          Length = 288

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 194/287 (67%), Gaps = 15/287 (5%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK ++S + D++    A LK E G++V LAV+LVG DPAS  YV  K +  ++ G+ 
Sbjct: 5   IIDGKAISSQIKDELKIKTAELK-EKGIEVTLAVILVGEDPASQVYVRNKKKACEYIGYR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+ Y  PV  +Q +L N +  LN  D + GILVQ+PLP  ++E+ +I +I P KDVDG H
Sbjct: 64  SLSYELPVSTTQEELLNLISDLNARDDVDGILVQMPLPDHINEKDVINAISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGC----DLSGQHAVVIGRSNLFGKPMGQ 179
            +N G + IG+   G V CTPAG I L++  +GC    D++G+  V+IGRSN+ GKPM  
Sbjct: 124 PMNVGALCIGE--EGFVSCTPAGVIQLLK--RGCEGTIDIAGKECVIIGRSNIVGKPMAL 179

Query: 180 LLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           L+L  NATVT+AHS+TK++  +C+ ADI++ AVG+   V  D++K G++VIDVGINR   
Sbjct: 180 LMLRENATVTVAHSRTKDIANVCKRADIIIAAVGKAGFVTKDFVKEGAVVIDVGINRGAD 239

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
              GK  L GDVA DE   V GAITPVPGGVGPMTIAMLM N + AA
Sbjct: 240 ---GK--LCGDVAFDEVSQVAGAITPVPGGVGPMTIAMLMNNCLEAA 281


>gi|313623884|gb|EFR93999.1| bifunctional protein FolD [Listeria innocua FSL J1-023]
          Length = 284

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 195/292 (66%), Gaps = 10/292 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L K+ G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTSEVAELVKQ-GKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +++  L   V  LN+D++IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPETVTEEKLLKVVEELNEDNTIHGILVQLPLPKHISEEKVIDAISFDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + ADILVVA G  + V+ ++IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKEYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +     L GDV  D+ K   G ITPVPGGVGPMTI ML+ NT+ AA R   M
Sbjct: 237 K-----LCGDVDFDDVKEQAGFITPVPGGVGPMTITMLLDNTLKAAKRIWKM 283


>gi|30264256|ref|NP_846633.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Ames]
 gi|47529699|ref|YP_021048.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187083|ref|YP_030335.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           anthracis str. Sterne]
 gi|65321566|ref|ZP_00394525.1| COG0190: 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Bacillus anthracis str.
           A2012]
 gi|165873010|ref|ZP_02217632.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0488]
 gi|167634619|ref|ZP_02392939.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0442]
 gi|167638492|ref|ZP_02396768.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0193]
 gi|170687393|ref|ZP_02878610.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0465]
 gi|170709014|ref|ZP_02899444.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0389]
 gi|177654817|ref|ZP_02936574.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0174]
 gi|190566174|ref|ZP_03019093.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis Tsiankovskii-I]
 gi|227816957|ref|YP_002816966.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. CDC 684]
 gi|229603479|ref|YP_002868475.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0248]
 gi|254683945|ref|ZP_05147805.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. CNEVA-9066]
 gi|254721780|ref|ZP_05183569.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A1055]
 gi|254736293|ref|ZP_05193999.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741331|ref|ZP_05199018.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Kruger B]
 gi|254754035|ref|ZP_05206070.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Vollum]
 gi|254757906|ref|ZP_05209933.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Australia 94]
 gi|81581411|sp|Q81M50|FOLD_BACAN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|254789383|sp|C3P7W0|FOLD_BACAA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|254789384|sp|C3LJV5|FOLD_BACAC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|30258901|gb|AAP28119.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Ames]
 gi|47504847|gb|AAT33523.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181010|gb|AAT56386.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. Sterne]
 gi|164711293|gb|EDR16848.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0488]
 gi|167513340|gb|EDR88710.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0193]
 gi|167530071|gb|EDR92806.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0442]
 gi|170126041|gb|EDS94938.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0389]
 gi|170668588|gb|EDT19334.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0465]
 gi|172080478|gb|EDT65564.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0174]
 gi|190563093|gb|EDV17059.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis Tsiankovskii-I]
 gi|227003076|gb|ACP12819.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. CDC 684]
 gi|229267887|gb|ACQ49524.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus anthracis str. A0248]
          Length = 286

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    FP  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V   ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVASYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|212638785|ref|YP_002315305.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Anoxybacillus flavithermus WK1]
 gi|226704314|sp|B7GHF9|FOLD_ANOFW RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|212560265|gb|ACJ33320.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Anoxybacillus
           flavithermus WK1]
          Length = 283

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 193/285 (67%), Gaps = 10/285 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +I+G  +A     ++A+ V  LK+E G++  LAV+LVG+ PAS SYV AK +  +  G
Sbjct: 3   AQIINGFELAKEKRAQLAKEVEQLKRE-GIEPALAVILVGDHPASQSYVKAKQKACEEIG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S+   FP DIS+  L   +  LNKD SIHGILVQLPLPS ++E  +I++I PEKDVDG
Sbjct: 62  IRSILLTFPNDISESFLLEQIARLNKDRSIHGILVQLPLPSQINELHVIEAIAPEKDVDG 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H +N G++MIG      +PCTP G + +++  +  D+ G+H VV+GRS++ GKP+GQL 
Sbjct: 122 FHPLNVGRMMIGQ--RAFLPCTPYGILYMVQSLQ-VDIIGKHVVVVGRSHIVGKPVGQLF 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  +ATVT  HS+T +L  I R ADIL+VAVG+P+++   ++K G++VIDVG+NR+ +  
Sbjct: 179 LREHATVTYCHSRTNDLEAITRQADILIVAVGKPKLITSSYVKEGAIVIDVGVNRLEN-- 236

Query: 242 LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
            GK  L GDV  D+ K V   ITPVP GVGPMTI ML+ NTV AA
Sbjct: 237 -GK--LCGDVDFDDVKQVASYITPVPKGVGPMTITMLLHNTVQAA 278


>gi|47569440|ref|ZP_00240121.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus G9241]
 gi|228987372|ref|ZP_04147492.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229157780|ref|ZP_04285855.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           ATCC 4342]
 gi|47553855|gb|EAL12225.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus G9241]
 gi|228625737|gb|EEK82489.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           ATCC 4342]
 gi|228772344|gb|EEM20790.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 286

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|322412224|gb|EFY03132.1| Putative bifunctional methylenetetrahydrofolate dehydrogenase /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           dysgalactiae subsp. dysgalactiae ATCC 27957]
          Length = 284

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 195/290 (67%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  +  ++      LK+E G+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTEIMDGKALAQKMQSELTIKAQQLKQEKGIVPGLVVILVGDNPASQVYVRNKERAAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N+DD+IHGILVQLPLP+ ++++ II +I P+KDVD
Sbjct: 61  GFKSETVRLSESICQEELIGVIERYNEDDTIHGILVQLPLPNHINDKKIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ +++  DL G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPAGIMEMLREYE-VDLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T++L ++CR AD+L+VA+G+   V  D++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRHLEDVCRHADVLIVAIGQGHFVTKDFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDVA DE   V   ITPVPGGVGPMTI ML+  T  AA RS+
Sbjct: 237 --GK--LIGDVAFDEVSQVASKITPVPGGVGPMTITMLLEQTYQAALRSV 282


>gi|225677425|ref|ZP_03788391.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590531|gb|EEH11792.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 292

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/297 (49%), Positives = 199/297 (67%), Gaps = 8/297 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L +++++ +  LK+E  +   L V+LVG++PAS  YV  K R A+  
Sbjct: 1   MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILVGSNPASQVYVRNKQRKAESI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P +IS+ +L   +  LN+D S+HGILVQLPLP+ +S   +I ++  EKDVD
Sbjct: 61  GISSETIVLPDNISEDELIEKINELNEDPSVHGILVQLPLPNHISASRVINTVSVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N GK++ G+    L+PCTP G++ LI+  +  +LSG++AVVIGRSN+ GKPM  L
Sbjct: 121 GFHDENVGKLVKGE-KNCLIPCTPKGSLHLIKSIEE-NLSGKNAVVIGRSNIVGKPMFYL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS++K+L E C  ADI+V AVG+P  VQ DWIK G++VIDVGIN +N  
Sbjct: 179 LLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIKKGAIVIDVGINSVN-- 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
            +GK  LVGDV  E  K    A+TPVPGGVGPMTIA LM NTVIAA    G+ +  F
Sbjct: 237 -VGK--LVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACLQKGVDASDF 290


>gi|115380638|ref|ZP_01467576.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|310822295|ref|YP_003954653.1| methylenetetrahydrofolate dehydrogenase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115362357|gb|EAU61654.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|309395367|gb|ADO72826.1| Methylenetetrahydrofolate dehydrogenase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 281

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/286 (51%), Positives = 190/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A+ +  ++   V  LK   G+  GLAVV VG DPAS  YV+ K + A+  
Sbjct: 1   MAQLIDGKAIAARIRAEVQADVERLKASRGLVPGLAVVRVGEDPASKIYVTGKKKAAEEV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS ++    DI+Q +L   V  LN D ++HGILVQLPLP  +  + II ++ PEKDVD
Sbjct: 61  GFHSWEHALGADITQDELLARVRQLNADPAVHGILVQLPLPKHIDAERIIAAVSPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VNAG++ +G    GL PCTP GA+ L+ +   C  +G+ AVV+GRSN+ GKPM  +
Sbjct: 121 GFHPVNAGRLSLGQ--PGLRPCTPFGAMRLLAEVS-CAPAGKRAVVVGRSNIVGKPMALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+ H K+ +LP     ADILVVAVG P ++Q +WIK G++VIDVG+NR    
Sbjct: 178 LLQADATVTICHRKS-DLPREVAQADILVVAVGVPELIQGEWIKPGAVVIDVGMNRKAD- 235

Query: 241 QLGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  LVGDVA +  +    AITPVPGGVGPMTIAMLM NT IAA
Sbjct: 236 --GK--LVGDVAFQAAAQRASAITPVPGGVGPMTIAMLMRNTFIAA 277


>gi|262282725|ref|ZP_06060493.1| methenyltetrahydrofolate cyclohydrolase [Streptococcus sp.
           2_1_36FAA]
 gi|262262016|gb|EEY80714.1| methenyltetrahydrofolate cyclohydrolase [Streptococcus sp.
           2_1_36FAA]
          Length = 284

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A  L  K+A+  A LK++TG   GL VVLVGN+PAS  YV  K R A   
Sbjct: 1   MAELIDGKALAEKLQGKLAQKTAKLKEKTGQTPGLVVVLVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMEMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++ + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKLAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RS 
Sbjct: 237 --GK--LIGDVKFDEVAEIASLITPVPGGVGPMTITMLMEQTYQAFKRSF 282


>gi|218899345|ref|YP_002447756.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus G9842]
 gi|228902699|ref|ZP_04066846.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis IBL 4222]
 gi|228910017|ref|ZP_04073837.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis IBL 200]
 gi|228967222|ref|ZP_04128258.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|226704317|sp|B7IXH2|FOLD_BACC2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|218545237|gb|ACK97631.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus G9842]
 gi|228792591|gb|EEM40157.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228849534|gb|EEM94368.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis IBL 200]
 gi|228856886|gb|EEN01399.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis IBL 4222]
          Length = 286

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D   +V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLNVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|194016780|ref|ZP_03055393.1| bifunctional protein FolD [Bacillus pumilus ATCC 7061]
 gi|194011386|gb|EDW20955.1| bifunctional protein FolD [Bacillus pumilus ATCC 7061]
          Length = 283

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 195/288 (67%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LK++ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAKEKREQLAKEVEELKQK-GVTPGLAVILIGDDPASLSYVRGKKKAAEAMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           H    +    +++  L   +   N +D  HGILVQLPLP  +SE+++I+ I PEKDVDG 
Sbjct: 63  HFQLDHLDASLTEEALLQLIDQYNANDQFHGILVQLPLPKHISEKAVIERISPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTPAG + L+ +  G  LSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNIGKMLLGEDT--FLPCTPAGIVELLNK-TGVSLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+T N+ E    ADILVVAVGR   ++ D IK G++VIDVG+NR+++   
Sbjct: 180 NENATVTYCHSRTANISEHTLKADILVVAVGRANFIKADQIKEGAIVIDVGVNRLDN--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  LVGDV  +E K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LVGDVDFEEAKEKASYITPVPGGVGPMTITMLAHNTVKSAKRTL 282


>gi|302023473|ref|ZP_07248684.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus suis 05HAS68]
          Length = 282

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 189/287 (65%), Gaps = 9/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK +   L   +AE  A LK+E GV  GL V+LVG +PAS  YV  K R A   GF
Sbjct: 2   TVIDGKALCVKLHAALAEKTARLKEEKGVVPGLVVILVGENPASQVYVRNKERSALAAGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S     P  IS+ DL + +   N+DD  HGILVQLPLP+ +SE+ ++ +I P+KDVDG 
Sbjct: 62  KSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHISEEKVLLAIDPDKDVDGF 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N GK   G     ++P TPAG + + ++++  +L G+ A+VIGRSN+ GKPM QLLL
Sbjct: 122 HPTNMGKFWSGHPV--MIPSTPAGIMEMFKEYQ-IELEGKSALVIGRSNIVGKPMAQLLL 178

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+AHS+TKNLPE+ R ADILVVA+GR   V  +++K G++VIDVG+NR  +   
Sbjct: 179 DANATVTIAHSRTKNLPELARQADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDEN--- 235

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  L+GDV  DE   V   ITPVPGGVGPMTI MLM  T  A  RS
Sbjct: 236 GK--LIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRS 280


>gi|311069032|ref|YP_003973955.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           atrophaeus 1942]
 gi|310869549|gb|ADP33024.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           atrophaeus 1942]
          Length = 283

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/288 (49%), Positives = 197/288 (68%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LK++ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAKEKREQLAKEVEKLKQQ-GVTPGLAVILIGDDPASHSYVRGKKKAAETMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +     F   +++ +L + +   N+D   HGILVQLPLP  +SE+++I+ I P+KDVDG 
Sbjct: 63  NFKLDQFDSSLTEAELLSIIDRYNQDPEFHGILVQLPLPDHISEKAVIERISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTP G + L+++    DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPHGIVELLKK-TNIDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+TKN+ E  + ADILVVAVG+   +  D IK G++VIDVG+NR+ S   
Sbjct: 180 NENATVTYCHSRTKNMSEHTKKADILVVAVGKANFITADQIKEGAIVIDVGVNRLES--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDVA +E K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LCGDVAFNEAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRTL 282


>gi|293365084|ref|ZP_06611801.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus oralis ATCC 35037]
 gi|307702207|ref|ZP_07639167.1| bifunctional protein folD [Streptococcus oralis ATCC 35037]
 gi|291316534|gb|EFE56970.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus oralis ATCC 35037]
 gi|307624220|gb|EFO03197.1| bifunctional protein folD [Streptococcus oralis ATCC 35037]
          Length = 285

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MAQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQAELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTL 282


>gi|229163127|ref|ZP_04291083.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           R309803]
 gi|228620533|gb|EEK77403.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           R309803]
          Length = 286

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRTQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|331266718|ref|YP_004326348.1| tetrahydrofolate dehydrogenase/cyclohydrolase,bifunctional protein
           FolD [Streptococcus oralis Uo5]
 gi|326683390|emb|CBZ01008.1| tetrahydrofolate dehydrogenase/cyclohydrolase,bifunctional protein
           FolD [Streptococcus oralis Uo5]
          Length = 292

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MAQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GFRSEVVRVPKTITQAELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLTHSRTHHLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 244 --GK--LCGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTL 289


>gi|308069601|ref|YP_003871206.1| FolD bifunctional protein [Paenibacillus polymyxa E681]
 gi|305858880|gb|ADM70668.1| FolD bifunctional protein [Paenibacillus polymyxa E681]
          Length = 285

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 193/291 (66%), Gaps = 10/291 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            ++IDGK ++  +   I + V  LK E   Q GLAVVLVG DPAS  YV  K +     G
Sbjct: 3   ATIIDGKQISQDIRASIQQEVIRLK-EHHFQPGLAVVLVGEDPASQVYVKNKEKACHDLG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
           ++S  +    D SQ  L   V  LN   +IHGILVQLPLP  + E+++I +I  EKDVDG
Sbjct: 62  YYSEVHRLAADTSQEALLELVDKLNHQSTIHGILVQLPLPKHIHEKAVIDAIAVEKDVDG 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN G ++IGD +  L+PCTPAG I LI++  G +++G+HAVVIGRSN+ GKP+  LL
Sbjct: 122 FHPVNVGNLVIGDDS--LLPCTPAGVIELIKR-AGVEIAGKHAVVIGRSNIVGKPVSLLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
              NATVTM HS+T N+ E+ R ADILVVA+G+   +   ++K G++VIDVG+NR+ +  
Sbjct: 179 QRENATVTMCHSRTVNIAELSRQADILVVAIGKANFIDASFVKPGAVVIDVGMNRLEN-- 236

Query: 242 LGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            GK  L GDV  E  K V G ITPVPGGVGPMTI MLM NT++AA RS G+
Sbjct: 237 -GK--LAGDVDFESVKQVSGPITPVPGGVGPMTITMLMQNTLVAAKRSYGL 284


>gi|330809023|ref|YP_004353485.1| bifunctional protein: methylenetetrahydrofolate dehydrogenase
           (NADP(+)); methenyltetrahydrofolate cyclohydrolase
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327377131|gb|AEA68481.1| putative bifunctional protein: methylenetetrahydrofolate
           dehydrogenase (NADP(+)); methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 301

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 194/294 (65%), Gaps = 10/294 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +  ++ E V  L+ E  ++  LAV+LVG+DPAS  YV  K   A+  G  
Sbjct: 6   LIDGKASAARVLIQVREDVVRLR-EQAIEPALAVILVGSDPASQVYVRNKILRAEEVGIR 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S   L   +  LN D SIHGIL+QLPLP+ + E   +++I P+KDVDG H
Sbjct: 65  SLEHRLPADTSTEQLLILIARLNADRSIHGILLQLPLPAHIDELRALEAIAPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G   T L PCTP+G + L+EQ  G DL G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 125 SQNVGGLSQG--RTVLAPCTPSGCLYLLEQTCG-DLRGKHAVVIGRSNIVGKPMAALLLQ 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +CR ADI++ AVGRPR++   W+K G++VIDVGINRI+    G
Sbjct: 182 ADCSVTVLHSRSPDPQALCRQADIVIAAVGRPRLIDASWLKPGAVVIDVGINRIDDD--G 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA---YRSLGMKS 293
           ++ LVGDV  D   + V AITPVPGGVGPMTIA LM NTV AA   +R+L  +S
Sbjct: 240 RSRLVGDVNFDSALAHVAAITPVPGGVGPMTIAFLMKNTVTAALAQHRALRSQS 293


>gi|329114926|ref|ZP_08243682.1| Bifunctional protein FolD [Acetobacter pomorum DM001]
 gi|326695823|gb|EGE47508.1| Bifunctional protein FolD [Acetobacter pomorum DM001]
          Length = 304

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/288 (51%), Positives = 185/288 (64%), Gaps = 5/288 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           SLIDGK  A+ +   I E V    ++ GV  GLAV+LVGNDPAS  YV  K     H G 
Sbjct: 16  SLIDGKGFAAKMRQNIREDVLAFHEKHGVTPGLAVILVGNDPASEVYVRNKAVQTHHAGM 75

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  +  P + S+ +L   +  LNKD  IHGILVQLPLP+ +  + +  +I+PEKDVDGL
Sbjct: 76  RSFMHMLPENTSEAELLALIDRLNKDPEIHGILVQLPLPNGLDGRRVTNAILPEKDVDGL 135

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
             +NAG++ +G     L+PCTP G + L+    G D+ GQHAVVIG SNL GKPM  LLL
Sbjct: 136 GEINAGRLAVG--LPSLIPCTPLGCLFLLRDQLG-DMKGQHAVVIGASNLVGKPMALLLL 192

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +   TV++AH  T++   + R ADILVVA G   +V+ DWIK G+ VIDVGI RI +   
Sbjct: 193 AEGCTVSIAHIHTRDTAALAREADILVVATGCRELVRGDWIKPGATVIDVGITRIKTDD- 251

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GKT LVGDVA DE   V G ITPVPGGVGPMTIA L+ NT+ AA   L
Sbjct: 252 GKTRLVGDVAFDEAVKVAGRITPVPGGVGPMTIACLLKNTLTAAKLQL 299


>gi|262277847|ref|ZP_06055640.1| bifunctional protein FolD [alpha proteobacterium HIMB114]
 gi|262224950|gb|EEY75409.1| bifunctional protein FolD [alpha proteobacterium HIMB114]
          Length = 286

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/294 (50%), Positives = 195/294 (66%), Gaps = 11/294 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQV-GLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +IDGK VA  L  KI   +  L   TG Q  GL V+L+G D AS  YV  K R A   G 
Sbjct: 2   IIDGKKVAEELRAKIKSDINKL---TGNQKPGLTVILIGEDAASQIYVKNKERFANEVGI 58

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S    F   IS+ DL+N +  LN D+++HGILVQLPLP  ++++ II++I P+KDVDG 
Sbjct: 59  NSTVIRFESSISEEDLKNEIRKLNNDNNVHGILVQLPLPKHINQRDIIETIDPKKDVDGF 118

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G +  G+    LVPCTP G   LI++    +LSG +AVVIGRSN+ GKPM QLLL
Sbjct: 119 HPINVGNLSSGN--DALVPCTPLGCYYLIKKAVP-NLSGLNAVVIGRSNINGKPMTQLLL 175

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TVT+ HSKTKN+ EIC  AD+++ AVG P+MV+ +WIK  +++IDVGINRI     
Sbjct: 176 KENCTVTIVHSKTKNIEEICCRADLIIAAVGIPKMVKSNWIKKDAVIIDVGINRIEVD-- 233

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
           GK  +VGDV  DE ++ V AITPVPGGVGPMTIA L+ NT + A+  +   +P+
Sbjct: 234 GKNKIVGDVDFDEVQNKVKAITPVPGGVGPMTIACLLENT-LKAFNKISGNAPQ 286


>gi|315612855|ref|ZP_07887766.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis ATCC 49296]
 gi|315314965|gb|EFU63006.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis ATCC 49296]
          Length = 285

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MAQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVKRVPETITQAELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDFDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTL 282


>gi|229174858|ref|ZP_04302378.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           MM3]
 gi|228608526|gb|EEK65828.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           MM3]
          Length = 286

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NAT+T  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATITYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|239827670|ref|YP_002950294.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Geobacillus sp. WCH70]
 gi|239807963|gb|ACS25028.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           WCH70]
          Length = 290

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 191/284 (67%), Gaps = 10/284 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A     ++A+ V  LK+E G++ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 7   QIISGAELAKEKRMQLAKEVEQLKRE-GIEPGLAVILVGDDPASHSYVKGKQKACAEVGI 65

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S    FP  I++  L   +  LN+D S+HGILVQLPLP  ++E  +I++I PEKDVDG 
Sbjct: 66  RSTLLTFPATITEEFLLEKIKELNEDPSVHGILVQLPLPKHINELKVIETISPEKDVDGF 125

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++M+G      +PCTP G +++++   G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 126 HPINVGRMMVGQ--KAFLPCTPHGILVMVKSI-GVDIAGKHVVVVGRSNIVGKPVGQLFL 182

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT  HSKTK+L  I R ADIL+VAVG+ R++  + +K G++VIDVG+NR+ +   
Sbjct: 183 REHATVTYCHSKTKDLASITRQADILIVAVGKARLIGAEHVKQGAIVIDVGVNRLEN--- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GK  L GDV  DE K V   ITPVP GVGPMTI ML+ NT+ AA
Sbjct: 240 GK--LCGDVNFDEVKEVASYITPVPKGVGPMTITMLLHNTIEAA 281


>gi|306829200|ref|ZP_07462390.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus mitis ATCC 6249]
 gi|304428286|gb|EFM31376.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus mitis ATCC 6249]
          Length = 285

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFHSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLFAIEPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L+ +NATVT+ HS+TK+L ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LVDKNATVTLTHSRTKDLAQVASQADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  A  R+L
Sbjct: 237 --GK--LCGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQATLRTL 282


>gi|218232457|ref|YP_002368984.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus B4264]
 gi|226704318|sp|B7HB52|FOLD_BACC4 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|218160414|gb|ACK60406.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus B4264]
          Length = 286

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TSLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|253576318|ref|ZP_04853648.1| methylenetetrahydrofolate dehydrogenase [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251844211|gb|EES72229.1| methylenetetrahydrofolate dehydrogenase [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 285

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 192/289 (66%), Gaps = 10/289 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I+GK ++  +   +   V  L K+ G   GLAVVLVG DPAS  YV  K +     G++
Sbjct: 5   IINGKQISEDIRKDLRAEVEQLAKQ-GFTPGLAVVLVGEDPASQVYVRNKEKACHELGYY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P +  Q DL   V  LN   +IHGILVQLPLP  + E+++I +I PEKDVDG H
Sbjct: 64  SEVHRLPAETPQEDLLALVDKLNHQANIHGILVQLPLPKHIDEKAVIDAISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +MIGD +  L+PCTPAG I LI++  G +++G+HAVVIGRSN+ GKP+  LL  
Sbjct: 124 PMNVGNLMIGDDS--LLPCTPAGVIELIKR-TGVEIAGKHAVVIGRSNIVGKPVSLLLQR 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVTM HS+T N+ E+ R ADILVVA+GR   V   ++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTMCHSRTANMKELTRLADILVVAIGRANFVDASYVKPGAVVIDVGMNRLVN---G 237

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           K  L GDV  E  K + G ITPVPGGVGPMTI MLM NT+IAA R  G+
Sbjct: 238 K--LAGDVDFENVKEISGPITPVPGGVGPMTITMLMQNTLIAAKRLQGL 284


>gi|295094795|emb|CBK83886.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Coprococcus sp.
           ART55/1]
          Length = 280

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 146/283 (51%), Positives = 192/283 (67%), Gaps = 10/283 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGKV++  + D++ E VA LK E GV++ LAV+ VGNDPAS  YV  K +  ++ 
Sbjct: 1   MYKLIDGKVISKQIKDELKEKVAGLKAE-GVEICLAVIQVGNDPASSVYVGNKKKACEYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y  P + ++ +L   +  LN DD ++GILVQLPLP  + E  +I++I P+KDVD
Sbjct: 60  GIGSLSYELPEETTEEELLALIEKLNSDDKVNGILVQLPLPKHIDEDKVIKTISPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H ++ G + IG    G V CTPAG I LI++  G ++ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFHPMSVGALSIG--QPGFVSCTPAGVIQLIKR-SGIEIEGKECVVLGRSNIVGKPMSML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS+TKNL E+CR ADILVVA+G+P M+   +IK G+ VIDVGI+R  + 
Sbjct: 177 LLRENGTVTVCHSRTKNLKEVCRRADILVVAIGKPEMIDASYIKEGATVIDVGIHRDENN 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTV 282
           +     L GDV  E  K V GAITPVPGGVGPMTIAMLM+N V
Sbjct: 237 K-----LCGDVDFESAKEVAGAITPVPGGVGPMTIAMLMSNCV 274


>gi|30022263|ref|NP_833894.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Bacillus cereus
           ATCC 14579]
 gi|206971009|ref|ZP_03231960.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus AH1134]
 gi|228941342|ref|ZP_04103894.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228954467|ref|ZP_04116492.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228960449|ref|ZP_04122100.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228974274|ref|ZP_04134843.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980867|ref|ZP_04141171.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis Bt407]
 gi|229047877|ref|ZP_04193453.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH676]
 gi|229071688|ref|ZP_04204904.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           F65185]
 gi|229081440|ref|ZP_04213940.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock4-2]
 gi|229111656|ref|ZP_04241206.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock1-15]
 gi|229129461|ref|ZP_04258432.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-Cer4]
 gi|229146756|ref|ZP_04275121.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-ST24]
 gi|229192393|ref|ZP_04319356.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           ATCC 10876]
 gi|296504670|ref|YP_003666370.1| methylenetetrahydrofolate dehydrogenase [Bacillus thuringiensis
           BMB171]
 gi|81433663|sp|Q818R5|FOLD_BACCR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|29897820|gb|AAP11095.1| Methylenetetrahydrofolate dehydrogenase (NADP+) [Bacillus cereus
           ATCC 14579]
 gi|206733781|gb|EDZ50952.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus cereus AH1134]
 gi|228590970|gb|EEK48826.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           ATCC 10876]
 gi|228636584|gb|EEK93049.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-ST24]
 gi|228654066|gb|EEL09933.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-Cer4]
 gi|228671791|gb|EEL27085.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock1-15]
 gi|228701855|gb|EEL54341.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock4-2]
 gi|228711419|gb|EEL63378.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           F65185]
 gi|228723334|gb|EEL74703.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH676]
 gi|228778803|gb|EEM27066.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis Bt407]
 gi|228785324|gb|EEM33334.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228799213|gb|EEM46179.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228805124|gb|EEM51718.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228818268|gb|EEM64341.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|296325722|gb|ADH08650.1| methylenetetrahydrofolate dehydrogenase (NADP+) [Bacillus
           thuringiensis BMB171]
 gi|326941962|gb|AEA17858.1| methylenetetrahydrofolate [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 286

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|313619078|gb|EFR90884.1| bifunctional protein FolD [Listeria innocua FSL S4-378]
          Length = 284

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 195/292 (66%), Gaps = 10/292 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + +K+   VA L K+ G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGEIIDGKKLAKEIQEKVTSEVAELVKQ-GKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +++  L   V  LN+D++IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPETVTEEKLLKVVEELNEDNTIHGILVQLPLPKHISEEKVIDAISFDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LP++ + A ILVVA G  + V+ ++IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPQVAKEAGILVVATGLAKFVKKEYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +     L GDV  D+ K   G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 K-----LCGDVDFDDVKEQAGFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|183603466|ref|ZP_02715060.2| bifunctional protein FolD [Streptococcus pneumoniae CDC0288-04]
 gi|307127625|ref|YP_003879656.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Streptococcus
           pneumoniae 670-6B]
 gi|183574620|gb|EDT95148.1| bifunctional protein FolD [Streptococcus pneumoniae CDC0288-04]
 gi|306484687|gb|ADM91556.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Streptococcus
           pneumoniae 670-6B]
          Length = 292

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 197/293 (67%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+AHS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|171778679|ref|ZP_02919775.1| hypothetical protein STRINF_00627 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282636|gb|EDT48060.1| hypothetical protein STRINF_00627 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 301

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A+ + +++ E V  LK E G+  GL V+LVG+DPAS  YV  K R AK  
Sbjct: 18  MAKLIDGKALAAKMQNELVEKVEKLKAEAGIVPGLVVILVGDDPASQVYVRNKERSAKKA 77

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S         S+ +L   +   N DD  HGILVQLPLP+ ++++ +I +I P+KDVD
Sbjct: 78  GFLSETVRLSESTSEEELIQVIEQYNNDDRFHGILVQLPLPAHITDKRVILAIDPKKDVD 137

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + L+  ++  DL G+ AV+IGRSN+ GKPM QL
Sbjct: 138 GFHPINTGHLWNGRPV--MVPCTPAGIMELLRAYE-VDLEGKTAVIIGRSNIVGKPMAQL 194

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHS+T++L  + + AD+L+VA+G+   V  +++K G++VIDVG+NR  + 
Sbjct: 195 LLDKNATVTLAHSRTRDLARVTKQADVLIVAIGQGHFVTKEFVKEGAVVIDVGMNRDEN- 253

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + V   ITPVPGGVGPMTI MLM  T  +A RS+
Sbjct: 254 --GK--LIGDVKFDEVEPVASLITPVPGGVGPMTITMLMEQTYQSALRSV 299


>gi|163941939|ref|YP_001646823.1| methenyltetrahydrofolate cyclohydrolase [Bacillus
           weihenstephanensis KBAB4]
 gi|226704320|sp|A9VGW3|FOLD_BACWK RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|163864136|gb|ABY45195.1| Methenyltetrahydrofolate cyclohydrolase [Bacillus
           weihenstephanensis KBAB4]
          Length = 286

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEKVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLVEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGILELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTRNIKELSKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|306825584|ref|ZP_07458923.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304431945|gb|EFM34922.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 285

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GLHSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTL 282


>gi|332204828|gb|EGJ18893.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA47901]
          Length = 285

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE    LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTEKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLSKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|322388194|ref|ZP_08061798.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus infantis ATCC 700779]
 gi|321140866|gb|EFX36367.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus infantis ATCC 700779]
          Length = 285

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE    LK+ETG+  GL V+LVG +PAS  YV  K R A   
Sbjct: 1   MTQMIDGKALAAKLQGQLAEKTVKLKEETGLVPGLVVILVGENPASQVYVRNKERSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L   +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFQSEVVRVPETITQEELLELIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAQVASKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDYDAVAPIASHITPVPGGVGPMTITMLMEQTYQAALRTL 282


>gi|229013399|ref|ZP_04170536.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           mycoides DSM 2048]
 gi|229061871|ref|ZP_04199201.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH603]
 gi|228717432|gb|EEL69100.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH603]
 gi|228747811|gb|EEL97677.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           mycoides DSM 2048]
          Length = 286

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEKVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGILELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNIKELSKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|229168925|ref|ZP_04296642.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH621]
 gi|228614517|gb|EEK71625.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH621]
          Length = 286

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEKVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGILELVKE-TNFDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNIKELSKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|291530532|emb|CBK96117.1| methenyltetrahydrofolate cyclohydrolase
           /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Eubacterium siraeum 70/3]
          Length = 279

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 188/282 (66%), Gaps = 11/282 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK V++ + ++I   +   K    + +GLAV++VGN+ AS  YV+ K +  + CG 
Sbjct: 2   NLIDGKAVSASVKEQIRAEIERDK----LDIGLAVIIVGNNQASRVYVNNKKKACEACGI 57

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P D +Q +L   + +LNKDD ++GIL QLPLP  + E+ +I++I P KDVD  
Sbjct: 58  KSYEYALPEDTTQDELMELIDTLNKDDKVNGILCQLPLPKHLDEEKVIEAISPLKDVDAF 117

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           + VN GK+MIG+++   +PCTPAG + LI    G  + G+  VVIGRSN+ GKPM  LLL
Sbjct: 118 NAVNVGKIMIGNYS--FLPCTPAGVMELIHS-TGVSVEGKECVVIGRSNIVGKPMAMLLL 174

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+ HS+TKNL E+CR ADILV AVGR   V  D +K G++VIDVG+NR    +L
Sbjct: 175 HENATVTVCHSRTKNLTEVCRRADILVSAVGRADFVTADMVKDGAVVIDVGMNRNADNKL 234

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
              V   +VA +C      ITPVPGGVGPMTIAMLM NT++A
Sbjct: 235 CGDVKFDEVAPKC----SYITPVPGGVGPMTIAMLMKNTLMA 272


>gi|229180461|ref|ZP_04307803.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           172560W]
 gi|228602885|gb|EEK60364.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           172560W]
          Length = 286

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 190/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D+IK G+ VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAAVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|332077238|gb|EGI87700.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA17545]
          Length = 285

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 197/293 (67%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+AHS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|58696858|ref|ZP_00372376.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698713|ref|ZP_00373601.1| methenyltetrahydrofolate cyclohydrolase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630179|ref|YP_002726970.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia sp. wRi]
 gi|254789425|sp|C0R2N7|FOLD_WOLWR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|58534770|gb|EAL58881.1| methenyltetrahydrofolate cyclohydrolase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58536929|gb|EAL60103.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592160|gb|ACN95179.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia sp. wRi]
          Length = 292

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 147/297 (49%), Positives = 199/297 (67%), Gaps = 8/297 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L +++++ +  LK+E  +   L V+LVG++PAS  YV  K + A+  
Sbjct: 1   MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILVGSNPASQVYVRNKQKKAESI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P +IS+ +L   +  LN+D S+HGILVQLPLP+ +S   +I ++  EKDVD
Sbjct: 61  GISSETIVLPDNISEDELIEKINELNEDPSVHGILVQLPLPNHISASRVINTVSVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N GK++ G+    L+PCTP G++ LI+  +  +LSG++AVVIGRSN+ GKPM  L
Sbjct: 121 GFHDENVGKLVKGE-KNCLIPCTPKGSLHLIKSIEE-NLSGKNAVVIGRSNIVGKPMFYL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS++K+L E C  ADI+V AVG+P  VQ DWIK G++VIDVGIN +N  
Sbjct: 179 LLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIKKGAIVIDVGINSVN-- 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
            +GK  LVGDV  E  K    A+TPVPGGVGPMTIA LM NTVIAA    G+ +  F
Sbjct: 237 -VGK--LVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACLQKGVDASNF 290


>gi|229031830|ref|ZP_04187818.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH1271]
 gi|228729448|gb|EEL80437.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH1271]
          Length = 286

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYMKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|228922936|ref|ZP_04086230.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228836707|gb|EEM82054.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 286

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYMKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|317128426|ref|YP_004094708.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           cellulosilyticus DSM 2522]
 gi|315473374|gb|ADU29977.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           cellulosilyticus DSM 2522]
          Length = 283

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/287 (49%), Positives = 190/287 (66%), Gaps = 10/287 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I GK +A     ++ + V  LK E G+  GLAV+L+G DPAS SYV +K +  K  G H
Sbjct: 5   IISGKELAKEKRIEMKKEVETLK-EKGIVPGLAVILIGTDPASQSYVRSKQKSCKEIGIH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P   ++  L + +  LNK + IHGILVQLPLP  +SE++II++I P+KDVDG H
Sbjct: 64  SELDELPETTTEQQLLHKINELNKAEHIHGILVQLPLPKHISEKAIIEAIDPKKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++M G      +PCTP G + +I+  K   + G+H VV+GRSN+ GKP+GQLLL+
Sbjct: 124 PINIGRMMTGQ--EAFLPCTPYGIVEMIKS-KDISIEGKHVVVVGRSNIVGKPVGQLLLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HS+TKN+ E  R ADIL+VAVG+   +  +++K G++VIDVG+NR      G
Sbjct: 181 ENATVTYCHSRTKNMKEYTRKADILIVAVGKAHFLNEEFVKDGAVVIDVGVNRTEE---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           K  LVGDV  D  K V   ITPVPGGVGPMTI ML+ NTVI+A R +
Sbjct: 238 K--LVGDVDFDGAKEVASYITPVPGGVGPMTITMLLHNTVISAKRHM 282


>gi|229135003|ref|ZP_04263809.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-ST196]
 gi|228648505|gb|EEL04534.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           BDRD-ST196]
          Length = 286

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEKVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLVEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGILELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNIKELSKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|308174226|ref|YP_003920931.1| methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate
           cyclohydrolase [Bacillus amyloliquefaciens DSM 7]
 gi|307607090|emb|CBI43461.1| methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate
           cyclohydrolase [Bacillus amyloliquefaciens DSM 7]
 gi|328554171|gb|AEB24663.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           amyloliquefaciens TA208]
 gi|328912563|gb|AEB64159.1| methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate
           cyclohydrolase [Bacillus amyloliquefaciens LL3]
          Length = 283

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 195/288 (67%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LK + GV  GLAV+L+G+DPAS SYV+ K + A+  G 
Sbjct: 4   TIIDGKETAKEKREQLAKEVEELKAQ-GVVPGLAVILIGDDPASVSYVTGKKKAAETMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
                 F   +++ +L   +   N++   HGILVQLPLP  +SE+++I+ I P+KDVDG 
Sbjct: 63  KFKLDRFDSSLTEAELLKVIDQYNQNPEFHGILVQLPLPDHISEKAVIERISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTP G + L+++    DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPHGIVELLKK-TNVDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+TKN+ E  + ADILVVAVG+   ++ D IK G++VIDVG+NR+ S   
Sbjct: 180 NENATVTYCHSRTKNMSEHTKKADILVVAVGKANFIKADQIKEGAIVIDVGVNRLES--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  DE K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LCGDVQFDEAKEKASFITPVPGGVGPMTITMLAHNTVKSARRTL 282


>gi|270293057|ref|ZP_06199268.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. M143]
 gi|270279036|gb|EFA24882.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. M143]
          Length = 285

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MAQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQAELLDLIAKYNQDSAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTPDFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMTI MLM  T  +A R+L
Sbjct: 237 --GK--LCGDVDYDAVAPLASHITPVPGGVGPMTITMLMEQTYQSALRTL 282


>gi|306832999|ref|ZP_07466131.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus bovis ATCC 700338]
 gi|304424898|gb|EFM28032.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus bovis ATCC 700338]
          Length = 284

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A     ++ E V  LK ETGV  GL V+LVG+DPAS  YV  K R AK  
Sbjct: 1   MATIIDGKALAVKKQTELVEKVEKLKAETGVVPGLVVILVGDDPASQVYVRNKERSAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        IS+ +L   +   N+DD  HGILVQLPLP+ ++++ +I +I P+KDVD
Sbjct: 61  GFLSETVRLSESISEEELIQVIAQYNEDDRFHGILVQLPLPAHINDKRVILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + L+ ++   DL G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPINTGHLWNGRPV--MVPCTPAGIMELLREYD-IDLEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHS+T++L  + + AD+L+VA+G+   V  +++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLAHSRTRHLARVTKQADVLIVAIGQGHFVTKEFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVPGGVGPMTI MLM  T  +A RS+
Sbjct: 237 --GK--LIGDVKFDEVEPLASFITPVPGGVGPMTITMLMEQTYQSALRSV 282


>gi|288904833|ref|YP_003430055.1| methylenetetrahydrofolate dehydrogenase and
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           gallolyticus UCN34]
 gi|325977762|ref|YP_004287478.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
 gi|288731559|emb|CBI13114.1| methylenetetrahydrofolate dehydrogenase and
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           gallolyticus UCN34]
 gi|325177690|emb|CBZ47734.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 284

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A     ++ E V  LK ETGV  GL V+LVG+DPAS  YV  K R AK  
Sbjct: 1   MATIIDGKALAVKKQTELVEKVEKLKAETGVVPGLVVILVGDDPASQVYVRNKERSAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        IS+ +L   +   N+DD  HGILVQLPLP+ ++++ +I +I P+KDVD
Sbjct: 61  GFLSETVRLSESISEEELIQVIEQYNEDDRFHGILVQLPLPAHINDKRVILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + L+ ++   DL G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPINTGHLWNGRPV--MVPCTPAGIMELLREYD-IDLEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHS+T++L  + + AD+L+VA+G+   V  +++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLAHSRTRHLARVTKQADVLIVAIGQGHFVTKEFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVPGGVGPMTI MLM  T  +A RS+
Sbjct: 237 --GK--LIGDVKFDEVEPLASFITPVPGGVGPMTITMLMEQTYQSALRSV 282


>gi|57239400|ref|YP_180536.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58579370|ref|YP_197582.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           [Ehrlichia ruminantium str. Welgevonden]
 gi|81352835|sp|Q5HAK8|FOLD_EHRRW RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|57161479|emb|CAH58405.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417996|emb|CAI27200.1| FolD bifunctional protein [Methylenetetrahydrofolate dehydrogenase;
           Methenyltetrahydrofolate cyclohydrolase] [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 300

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 183/291 (62%), Gaps = 4/291 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G+++ GK VA  +T+ +A  ++ LK +  +   L VVLVG+DPAS  YV  K R A+  G
Sbjct: 3   GNIVSGKAVADNITNILATCISDLKAQHNLTPCLIVVLVGDDPASQLYVRNKQRKAEMLG 62

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S     P  IS+  L   +  LN DDS+HGILVQLP+P  + +  II +I P+KDVDG
Sbjct: 63  LRSETMLLPSTISESSLIEKIHQLNNDDSVHGILVQLPVPRHIDKNLIINTIDPKKDVDG 122

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H  N G++  G     LVPCTP G + LI+     +LSG  AVVIGRSN+ GKPM  LL
Sbjct: 123 FHNENVGRLFTGQKKNCLVPCTPQGCLYLIKTITR-NLSGSDAVVIGRSNIVGKPMACLL 181

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  N TVT  HS T++LP+ CR ADILV AVG PR V+  W+K G++VIDVGIN I    
Sbjct: 182 LGENCTVTTVHSATRDLPDYCRRADILVAAVGIPRFVKYSWVKHGAIVIDVGINSIEEDG 241

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + K   VGDV   E   +  AITPVPGGVGPMTIA LM NT+IAA    G+
Sbjct: 242 VKK--FVGDVDFAEVNKIASAITPVPGGVGPMTIAFLMVNTIIAACNQSGI 290


>gi|307709105|ref|ZP_07645564.1| bifunctional protein folD [Streptococcus mitis SK564]
 gi|307620051|gb|EFN99168.1| bifunctional protein folD [Streptococcus mitis SK564]
          Length = 285

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++ E  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLTEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQEELLDLIGKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|307704891|ref|ZP_07641782.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus mitis SK597]
 gi|307621505|gb|EFO00551.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus mitis SK597]
          Length = 285

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 197/293 (67%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAT 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTPDFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|298487428|ref|ZP_07005474.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298158047|gb|EFH99121.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 300

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 7/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + ++++  V  LK + G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVSTEVKILKAD-GIEPALAVILVGNDPASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   SQ  +   +  LN DDS++GIL+QLPLPS + E   +Q+I P KDVDG H
Sbjct: 64  SLEHRLPAKSSQAQVLALIAELNADDSVNGILLQLPLPSHMEEARALQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G   + L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQG--RSVLTPCTPSGCMHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+VVAVGRPR++   W+K G++VIDVGIN I     G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVVAVGRPRIIDASWLKPGAVVIDVGINCIEDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           ++ LVGDV  D   SV  AITPVPGGVGPMTIA LM NTV AA +
Sbjct: 239 RSRLVGDVDFDSALSVASAITPVPGGVGPMTIAFLMKNTVTAARQ 283


>gi|319942247|ref|ZP_08016562.1| methenyltetrahydrofolate cyclohydrolase [Sutterella wadsworthensis
           3_1_45B]
 gi|319804120|gb|EFW01020.1| methenyltetrahydrofolate cyclohydrolase [Sutterella wadsworthensis
           3_1_45B]
          Length = 287

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 188/288 (65%), Gaps = 8/288 (2%)

Query: 4   LIDGKVVA-SVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +IDGK +A  V     A S A   +  G + GLAVVLVG DPASC YV  KTR  +  G 
Sbjct: 5   IIDGKALAREVEAQARARSEALASRPGGRRPGLAVVLVGEDPASCVYVKNKTRACERAGV 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P + ++ +L   +  LN D ++ GILVQLPLP  ++  ++I SI PEKDVDG 
Sbjct: 65  ISTEYRLPAETTEKELLELIEKLNNDPAVDGILVQLPLPKQINPDAVILSISPEKDVDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+++AG ++ G    G  PCTPAG + LIE   G +  G  AVVIGRSN+ GKP   +LL
Sbjct: 125 HMLSAGALLTGRRNRGYRPCTPAGVMKLIEA-SGVNPEGLEAVVIGRSNIVGKPQAVMLL 183

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+ HS+T NL +I R ADILV A GRP+MV+ D +K G++VIDVGI+R  +   
Sbjct: 184 DAHATVTVVHSRTTNLADITRRADILVCAAGRPKMVKGDMVKPGAVVIDVGIHRDEN--- 240

Query: 243 GKTVLVGDVAD-ECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV     + V GA+TPVPGGVGPMTIAML+ NTV+AA R L
Sbjct: 241 GK--LCGDVDQLSVEPVAGALTPVPGGVGPMTIAMLIDNTVLAAERHL 286


>gi|154686695|ref|YP_001421856.1| hypothetical protein RBAM_022640 [Bacillus amyloliquefaciens FZB42]
 gi|166988376|sp|A7Z6J9|FOLD_BACA2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|154352546|gb|ABS74625.1| FolD [Bacillus amyloliquefaciens FZB42]
          Length = 283

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 195/288 (67%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LK + GV  GLAV+L+G+DPAS SYV+ K + A+  G 
Sbjct: 4   TIIDGKETAKEKREQLAKEVEELKAQ-GVVPGLAVILIGDDPASVSYVTGKKKAAETMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
                 F   +++ +L   +   N++   HGILVQLPLP  +SE+++I+ I P+KDVDG 
Sbjct: 63  KFKLDRFDSSLTEAELLTVIDQYNQNPEFHGILVQLPLPDHISEKAVIERISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTP G + L+++    DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPHGIVELLKK-TNVDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+TKN+ E  + ADILVVAVG+   ++ D IK G++VIDVG+NR+ S   
Sbjct: 180 NENATVTYCHSRTKNMSEHTKKADILVVAVGKANFIKADQIKEGAIVIDVGVNRLES--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  DE K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LCGDVQFDEAKEKASFITPVPGGVGPMTITMLAHNTVKSARRTL 282


>gi|167749974|ref|ZP_02422101.1| hypothetical protein EUBSIR_00942 [Eubacterium siraeum DSM 15702]
 gi|167656995|gb|EDS01125.1| hypothetical protein EUBSIR_00942 [Eubacterium siraeum DSM 15702]
          Length = 279

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 188/282 (66%), Gaps = 11/282 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK V++ + ++I   +   K    + +GLAV++VGN+ AS  YV+ K +  + CG 
Sbjct: 2   NLIDGKAVSASVKEQIRAEIERDK----LDIGLAVIIVGNNQASRVYVNNKKKACEVCGI 57

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P D +Q +L   + +LNKDD ++GIL QLPLP  + E+ +I++I P KDVD  
Sbjct: 58  KSYEYALPEDTTQDELMELIDTLNKDDKVNGILCQLPLPKHLDEEKVIEAISPLKDVDAF 117

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           + VN GK+MIG+++   +PCTPAG + LI    G  + G+  VVIGRSN+ GKPM  LLL
Sbjct: 118 NAVNVGKIMIGNYS--FLPCTPAGVMELIHS-TGVSVEGKECVVIGRSNIVGKPMAMLLL 174

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+ HS+TKNL E+CR ADILV AVGR   V  D +K G++VIDVG+NR    +L
Sbjct: 175 HENATVTVCHSRTKNLAEVCRRADILVSAVGRADFVTADMVKDGAVVIDVGMNRNADNKL 234

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
              V   +VA +C      ITPVPGGVGPMTIAMLM NT++A
Sbjct: 235 CGDVKFDEVAPKC----SYITPVPGGVGPMTIAMLMKNTLMA 272


>gi|229075889|ref|ZP_04208865.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock4-18]
 gi|229098653|ref|ZP_04229593.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-29]
 gi|229104809|ref|ZP_04235470.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-28]
 gi|229117678|ref|ZP_04247048.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock1-3]
 gi|228665770|gb|EEL21242.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock1-3]
 gi|228678682|gb|EEL32898.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-28]
 gi|228684732|gb|EEL38670.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock3-29]
 gi|228707204|gb|EEL59401.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           Rock4-18]
          Length = 286

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H V+IGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVIIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+MV  D++K G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNIKELSKLADILIVAVGRPKMVTADYMKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|332366070|gb|EGJ43826.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK1059]
          Length = 284

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V+LVGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVILVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L   + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLGLIETYNQNSDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|325690183|gb|EGD32187.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK115]
          Length = 284

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V+LVGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVILVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GIELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSELASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|58617425|ref|YP_196624.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           [Ehrlichia ruminantium str. Gardel]
 gi|75356719|sp|Q5FG00|FOLD_EHRRG RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|58417037|emb|CAI28150.1| FolD bifunctional protein [Methylenetetrahydrofolate dehydrogenase;
           Methenyltetrahydrofolate cyclohydrolase] [Ehrlichia
           ruminantium str. Gardel]
          Length = 300

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 183/291 (62%), Gaps = 4/291 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G+++ GK VA  +T+ +A  ++ LK +  +   L VVLVG+DPAS  YV  K R A+  G
Sbjct: 3   GNIVSGKAVADNITNILATCISDLKVQHNLTPCLIVVLVGDDPASQLYVRNKQRKAEMLG 62

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S     P  IS+  L   +  LN DDS+HGILVQLP+P  + +  II +I P+KDVDG
Sbjct: 63  LRSETMLLPSTISESSLIEKIHQLNNDDSVHGILVQLPVPRHIDKNLIINTIDPKKDVDG 122

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H  N G++  G     LVPCTP G + LI+     +LSG  AVVIGRSN+ GKPM  LL
Sbjct: 123 FHNENVGRLFTGQKKNCLVPCTPQGCLYLIKTITR-NLSGSDAVVIGRSNIVGKPMACLL 181

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  N TVT  HS T++LP+ CR ADILV AVG PR V+  W+K G++VIDVGIN I    
Sbjct: 182 LGENCTVTTVHSATRDLPDYCRRADILVAAVGIPRFVKYSWVKHGAIVIDVGINSIEEDG 241

Query: 242 LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + K   VGDV   E   +  AITPVPGGVGPMTIA LM NT+IAA    G+
Sbjct: 242 VKK--FVGDVDFAEVNKIASAITPVPGGVGPMTIAFLMVNTIIAACNQSGI 290


>gi|229152383|ref|ZP_04280575.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           m1550]
 gi|228630991|gb|EEK87628.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           m1550]
          Length = 286

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 190/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GL V+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLTEEVVKLK-EQGIVPGLTVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDISGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGRP+M+  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|183603139|ref|ZP_02710282.2| bifunctional protein FolD [Streptococcus pneumoniae CDC1087-00]
 gi|183571070|gb|EDT91598.1| bifunctional protein FolD [Streptococcus pneumoniae CDC1087-00]
          Length = 306

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 82  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 199 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 258 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 306


>gi|330951920|gb|EGH52180.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae Cit 7]
          Length = 300

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 192/296 (64%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++   V  LK E G++  LAV+LVGND AS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLQQVRHDVNTLKVE-GIEPALAVILVGNDAASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   SQ  L   +  LN D+++HGIL+QLPLP+ + E  ++Q+I P KDVDG H
Sbjct: 64  SLEHRLPAASSQARLLALIAELNADNTVHGILLQLPLPAHIEENRVLQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCLHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSNDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIDDH--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    V  AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDSAIEVASAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|172079625|ref|ZP_02709688.2| bifunctional protein FolD [Streptococcus pneumoniae CDC1873-00]
 gi|172042093|gb|EDT50139.1| bifunctional protein FolD [Streptococcus pneumoniae CDC1873-00]
          Length = 292

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|330888409|gb|EGH21070.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. mori str. 301020]
          Length = 298

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 142/285 (49%), Positives = 191/285 (67%), Gaps = 9/285 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + ++++  V  LK + G+++ LA +LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVSTEVKILKAD-GIELALAFILVGNDPASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P   SQ+     +  LN DDS++GIL+QLPLPS + E   +Q+I P KDVDG H
Sbjct: 64  SLEHRLPAKSSQV--LALIAELNADDSVNGILLQLPLPSHMEEARALQAIDPGKDVDGFH 121

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G   + L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 122 SENVGGLSQG--RSVLTPCTPSGCMHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 178

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 179 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRIIDASWLKPGAVVIDVGINRIEDQ--G 236

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           ++ LVGDV  D   SV  AITPVPGGVGPMTIA LM NTV AA +
Sbjct: 237 RSRLVGDVDFDSALSVASAITPVPGGVGPMTIAFLMKNTVTAARQ 281


>gi|322376378|ref|ZP_08050871.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. M334]
 gi|321282185|gb|EFX59192.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. M334]
          Length = 292

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 197/293 (67%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTARLKEETALVPGLVVILVGDNPASQVYVRNKERSALAT 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   NK+ + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GFRSEVVRVPETITQEELLDLIAKYNKNLAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDAN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L +K
Sbjct: 244 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDIK 292


>gi|330898041|gb|EGH29460.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 300

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 191/296 (64%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++   V  LK E G++  LAV+LVGND AS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLQQVRHDVNTLKAE-GIEPALAVILVGNDAASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D SQ  L   +  LN D++++GIL+QLPLP+ + E  ++Q+I P KDVDG H
Sbjct: 64  SLEHRLPADSSQARLLALIAELNADNTVNGILLQLPLPAHLEENRVLQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCLHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSHDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIEDH--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           +  LVGDV  D    V  AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RNRLVGDVDFDSAIEVAAAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|296333412|ref|ZP_06875865.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305675082|ref|YP_003866754.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296149610|gb|EFG90506.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305413326|gb|ADM38445.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 283

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/288 (49%), Positives = 195/288 (67%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LKK+ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAREKREQLAKEVEELKKQ-GVTPGLAVILIGDDPASHSYVRGKKKAAETMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +     F   +++ +L + +   N+D   HGILVQLPLP  +SE+++I+ I P+KDVDG 
Sbjct: 63  NFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHISEKAVIERISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTP G + L+++    DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPHGIVELLKK-TNIDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+T+N+ E  + ADILVVAVGR   +  D IK G++VIDVG+NR+ S   
Sbjct: 180 NENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKEGAVVIDVGVNRLES--- 236

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  E  K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LCGDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRTL 282


>gi|52080964|ref|YP_079755.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           licheniformis ATCC 14580]
 gi|52786340|ref|YP_092169.1| hypothetical protein BLi02602 [Bacillus licheniformis ATCC 14580]
 gi|319645078|ref|ZP_07999311.1| methenyltetrahydrofolate cyclohydrolase [Bacillus sp. BT1B_CT2]
 gi|81385107|sp|Q65HI8|FOLD_BACLD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|52004175|gb|AAU24117.1| methylenetetrahydrofolate dehydrogenase and
           methenyltetrahydrofolate cyclohydrolase [Bacillus
           licheniformis ATCC 14580]
 gi|52348842|gb|AAU41476.1| FolD [Bacillus licheniformis ATCC 14580]
 gi|317392887|gb|EFV73681.1| methenyltetrahydrofolate cyclohydrolase [Bacillus sp. BT1B_CT2]
          Length = 284

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 197/290 (67%), Gaps = 10/290 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A     ++A+ V  LKK+ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAKEKRGQLAKEVEELKKQ-GVTPGLAVILIGDDPASLSYVRGKKKAAEAMGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
                +F    ++ +L   +   N++D  HGILVQLPLP  +SEQ++I+ I PEKDVDG 
Sbjct: 63  RFQLDHFDASFTEQELLEVIDQYNQNDDFHGILVQLPLPDHISEQAVIERISPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTPAG + L+++ +  DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPAGIVELLKKTE-IDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+T ++    + ADIL+VAVG+   ++ D IK G++VIDVG+NR+++   
Sbjct: 180 NENATVTYCHSRTADITAHTKKADILIVAVGKANFIKADQIKEGAVVIDVGVNRLDN--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           GK  L GDV  +E K     ITPVPGGVGPMTI ML  NTV +A R++ +
Sbjct: 237 GK--LAGDVDFEEAKEKASYITPVPGGVGPMTITMLAHNTVKSAKRTIQL 284


>gi|167748880|ref|ZP_02421007.1| hypothetical protein ANACAC_03654 [Anaerostipes caccae DSM 14662]
 gi|317470278|ref|ZP_07929672.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Anaerostipes sp.
           3_2_56FAA]
 gi|167651850|gb|EDR95979.1| hypothetical protein ANACAC_03654 [Anaerostipes caccae DSM 14662]
 gi|316902251|gb|EFV24171.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Anaerostipes sp.
           3_2_56FAA]
          Length = 282

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 190/283 (67%), Gaps = 10/283 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +++ + D++ + VA +K E G ++ LAV+ VG DPAS  YV  K +  ++ 
Sbjct: 1   MTQIIDGKKISAEIKDELKQEVAAMKAE-GKEIALAVIQVGEDPASSVYVRNKKKACEYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV Y  P D +Q +L + V   NKD  I+GILVQLPLP  + E ++I +I P+KDVD
Sbjct: 60  GITSVSYEIPEDSTQQELLDLVEKCNKDPKINGILVQLPLPPHMDEDAVIHAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H V+ G ++IG+   G +PCTPAG I L+++  G ++ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFHPVSVGNMVIGN--DGFLPCTPAGIIELLKR-SGVEIGGKECVVVGRSNIVGKPMSML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS+T+NL E+C  ADILVVAVGRP+ +   ++K G+++IDVGI+R  + 
Sbjct: 177 LLRENGTVTVCHSRTRNLREVCSRADILVVAVGRPKFIDASYVKEGAVIIDVGIHRNENN 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           +     L GDV  D  K    AITPVPGGVGPMTIAMLM N V
Sbjct: 237 K-----LCGDVDFDAVKEKTSAITPVPGGVGPMTIAMLMKNCV 274


>gi|146297145|ref|YP_001180916.1| methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|190359423|sp|A4XLE0|FOLD_CALS8 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|145410721|gb|ABP67725.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 279

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/267 (50%), Positives = 182/267 (68%), Gaps = 7/267 (2%)

Query: 27  KETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLN 86
           KE G++  LAVV+VGNDPAS SYV++K R     G +SV+Y      +Q  LEN +  LN
Sbjct: 17  KEKGIESTLAVVIVGNDPASRSYVNSKKRTCLELGINSVEYALDTTTTQEQLENLIEKLN 76

Query: 87  KDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIG-DFTTGLVPCTPA 145
           +D  I+GILVQLPLP+ + E  + + I+P+KDVDG H +N G +  G DF   + PCTP 
Sbjct: 77  QDPKINGILVQLPLPNGLDESRVCKKILPQKDVDGFHPMNVGMLATGIDFEYSIKPCTPF 136

Query: 146 GAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTA 205
           G I L+++ +  ++ G+HAVVIGRSN+ GKP+  LLL  NATVT+ HS T++L +IC+TA
Sbjct: 137 GVIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALLLLRENATVTICHSYTRDLKDICKTA 195

Query: 206 DILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADEC-KSVVGAITP 264
           DILV AVG+P+ V  D +K G++VIDVGINR  + +     +VGDV  E  + V   ITP
Sbjct: 196 DILVAAVGKPKFVTADMVKEGAVVIDVGINRDETTK----KIVGDVDFETVRRVASYITP 251

Query: 265 VPGGVGPMTIAMLMANTVIAAYRSLGM 291
           VPGGVGPMT+AMLM NT+ A     G+
Sbjct: 252 VPGGVGPMTVAMLMKNTLFATLLQNGL 278


>gi|332203977|gb|EGJ18044.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA47368]
          Length = 285

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|169834442|ref|YP_001694280.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae Hungary19A-6]
 gi|183603804|ref|ZP_02721420.2| bifunctional protein FolD [Streptococcus pneumoniae MLV-016]
 gi|194397920|ref|YP_002037462.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae G54]
 gi|225856492|ref|YP_002738003.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae P1031]
 gi|225861277|ref|YP_002742786.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|168996944|gb|ACA37556.1| bifunctional protein FolD [Streptococcus pneumoniae Hungary19A-6]
 gi|183578609|gb|EDT99137.1| bifunctional protein FolD [Streptococcus pneumoniae MLV-016]
 gi|194357587|gb|ACF56035.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus
           pneumoniae G54]
 gi|225725850|gb|ACO21702.1| bifunctional protein FolD [Streptococcus pneumoniae P1031]
 gi|225726485|gb|ACO22336.1| bifunctional protein FolD [Streptococcus pneumoniae Taiwan19F-14]
 gi|301799827|emb|CBW32398.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus pneumoniae OXC141]
 gi|301801658|emb|CBW34358.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus pneumoniae INV200]
          Length = 292

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+AHS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|229543900|ref|ZP_04432959.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           coagulans 36D1]
 gi|229325039|gb|EEN90715.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           coagulans 36D1]
          Length = 283

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 190/289 (65%), Gaps = 11/289 (3%)

Query: 1   MGS-LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKH 59
           MG+ +IDGK +A  L  +I      L ++ G+  GLAV+LVGNDPAS +YV  K +  + 
Sbjct: 1   MGAEIIDGKQLAEALRKEIKAEAEQLTQQ-GIIPGLAVILVGNDPASRTYVKNKEKACRA 59

Query: 60  CGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDV 119
            G  SV    P D+S+  L   + +LN+D  IHGILVQLPLP  ++ Q I+++I PEKDV
Sbjct: 60  LGMKSVLIELPEDVSEQALLGHIATLNEDPDIHGILVQLPLPPHINAQKIVEAISPEKDV 119

Query: 120 DGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQ 179
           DG H +N G++M G  T   +PCTP G IL + + KG  + G+H VVIGRSN+ GKP GQ
Sbjct: 120 DGFHPINIGRMMTGQDT--FLPCTPHG-ILKMVKSKGIRIEGKHVVVIGRSNIVGKPCGQ 176

Query: 180 LLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           L L+ NATVT  HSKT +L    R ADILV AVG+ + ++ D++K G+ VIDVG+NR  S
Sbjct: 177 LFLNENATVTYCHSKTADLKSFTRQADILVSAVGKAKFIKADFVKAGAAVIDVGMNRDAS 236

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
              GK  L GDV  DE K     ITPVPGGVGPMTI ML++NTV AA R
Sbjct: 237 ---GK--LCGDVDFDEVKEKASYITPVPGGVGPMTITMLLSNTVKAAKR 280


>gi|315646328|ref|ZP_07899448.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           vortex V453]
 gi|315278527|gb|EFU41843.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           vortex V453]
          Length = 286

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 197/290 (67%), Gaps = 10/290 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++I GK ++  +   IA  V  L K+  V+ GLAVVLVG+DPAS  YV  K +  +  G+
Sbjct: 5   TIISGKQISEEIRKGIALEVEQLSKQN-VRPGLAVVLVGDDPASHVYVRNKEKACQDLGY 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S  +    + SQ ++   V  LN  DSIHGILVQLPLP  + E+++I +I  +KDVDG 
Sbjct: 64  YSEVHRLSAESSQEEVLALVDKLNAQDSIHGILVQLPLPKHIHEKAVIDAISVKKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G ++IGD +  L+PCTPAG I +I++  G +++G+HAVVIGRSN+ GKP+  LL 
Sbjct: 124 HPVNVGNLVIGDDS--LLPCTPAGVIEMIKR-TGIEIAGKHAVVIGRSNIVGKPVSLLLQ 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVTM HS+T N+ EI R ADILVVA+GR  M+   ++K G++VIDVG+NR+ +   
Sbjct: 181 RENATVTMCHSRTANMVEIARQADILVVAIGRANMIDASYVKPGAVVIDVGMNRLEN--- 237

Query: 243 GKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           GK  L GDV  E  K V G ITPVPGGVGPMTI MLM NT++AA R  G+
Sbjct: 238 GK--LAGDVDFESVKQVSGPITPVPGGVGPMTITMLMQNTLLAAKRLNGL 285


>gi|154149155|ref|YP_001406595.1| bifunctional protein FolD [Campylobacter hominis ATCC BAA-381]
 gi|190359424|sp|A7I254|FOLD_CAMHC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|153805164|gb|ABS52171.1| bifunctional protein FolD [Campylobacter hominis ATCC BAA-381]
          Length = 284

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/286 (47%), Positives = 195/286 (68%), Gaps = 8/286 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK +++ + +++    A L  E GV   LAV+LVG+D AS +YV++K +  K CG  
Sbjct: 3   LIDGKAISAKVKEEVKNEAAQLT-EKGVVPCLAVILVGDDKASQTYVNSKEKACKACGIR 61

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S++Y    + S+  L + + SLN++D + GILVQLPLP  + E  I++ I  EKDVDG H
Sbjct: 62  SLKYTLEANTSESALIDLIQSLNENDEVDGILVQLPLPKHIDENKILEKISCEKDVDGFH 121

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G+++ G    G VPCTP G + L +++   ++SG++AVVIGRSN+ GKPM  LLL+
Sbjct: 122 AVNVGRLVSG--LDGFVPCTPCGIMRLFKEY-DIEISGKNAVVIGRSNIVGKPMANLLLN 178

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+ HSKT+NL +I + ADI+VVA+G+P  ++ D +K G++VIDVGINR+ + +L 
Sbjct: 179 ANATVTVTHSKTQNLAKITKDADIIVVAIGKPNFLKADMVKNGAVVIDVGINRLENNKLV 238

Query: 244 KTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
                 +VA++C      ITPVPGGVGPMTIAML+ NT+ +A   L
Sbjct: 239 GDADFENVANKC----SFITPVPGGVGPMTIAMLLKNTIKSAKNRL 280


>gi|330981685|gb|EGH79788.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 300

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 191/296 (64%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++   V  LK E G++  LAV+LVGND AS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLQQVKHDVNTLKAE-GIEPALAVILVGNDAASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D SQ  L   +  LN D++++GIL+QLPLP+ + E  ++Q+I P KDVDG H
Sbjct: 64  SLEHRLPADSSQARLLALIAELNADNTVNGILLQLPLPAHLEENRVLQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCLHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSHDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIEDH--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           +  LVGDV  D    V  AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RNRLVGDVDFDSVIEVASAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|148986055|ref|ZP_01819076.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP3-BS71]
 gi|148990334|ref|ZP_01821520.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP6-BS73]
 gi|148997099|ref|ZP_01824753.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP11-BS70]
 gi|237650816|ref|ZP_04525068.1| bifunctional protein FolD [Streptococcus pneumoniae CCRI 1974]
 gi|237821578|ref|ZP_04597423.1| bifunctional protein FolD [Streptococcus pneumoniae CCRI 1974M2]
 gi|303254037|ref|ZP_07340155.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus
           pneumoniae BS455]
 gi|303260288|ref|ZP_07346259.1| bifunctional protein FolD [Streptococcus pneumoniae SP-BS293]
 gi|303261494|ref|ZP_07347442.1| bifunctional protein FolD [Streptococcus pneumoniae SP14-BS292]
 gi|303264162|ref|ZP_07350083.1| bifunctional protein FolD [Streptococcus pneumoniae BS397]
 gi|303267028|ref|ZP_07352900.1| bifunctional protein FolD [Streptococcus pneumoniae BS457]
 gi|303269210|ref|ZP_07354987.1| bifunctional protein FolD [Streptococcus pneumoniae BS458]
 gi|307067423|ref|YP_003876389.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus
           pneumoniae AP200]
 gi|147756799|gb|EDK63839.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP11-BS70]
 gi|147921889|gb|EDK73015.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP3-BS71]
 gi|147924363|gb|EDK75454.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP6-BS73]
 gi|302599017|gb|EFL66045.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus
           pneumoniae BS455]
 gi|302637628|gb|EFL68115.1| bifunctional protein FolD [Streptococcus pneumoniae SP14-BS292]
 gi|302638612|gb|EFL69076.1| bifunctional protein FolD [Streptococcus pneumoniae SP-BS293]
 gi|302641274|gb|EFL71644.1| bifunctional protein FolD [Streptococcus pneumoniae BS458]
 gi|302643422|gb|EFL73697.1| bifunctional protein FolD [Streptococcus pneumoniae BS457]
 gi|302646567|gb|EFL76793.1| bifunctional protein FolD [Streptococcus pneumoniae BS397]
 gi|306408960|gb|ADM84387.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus
           pneumoniae AP200]
 gi|332076104|gb|EGI86570.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA41301]
          Length = 285

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+AHS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|327390178|gb|EGE88521.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA04375]
          Length = 285

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE +A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKIAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDSAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     +VP TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MVPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + +   ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLTSHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|306830865|ref|ZP_07464027.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
 gi|304426888|gb|EFM29998.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
          Length = 284

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 193/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A     ++ E V  LK ETGV  GL V+LVG+DPAS  YV  K R AK  
Sbjct: 1   MATIIDGKALAVKKQTELVEKVEKLKAETGVVPGLVVILVGDDPASQVYVRNKERSAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        IS+ +L   +   N+DD  HGILVQLPLP  ++++ +I +I P+KDVD
Sbjct: 61  GFLSETVRLSESISEEELIQVIEQYNEDDRFHGILVQLPLPVHINDKRVILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + L+ ++   DL G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPINTGHLWNGRPV--MVPCTPAGIMELLREYD-IDLEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHS+T++L  + + AD+L+VA+G+   V  +++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLAHSRTRHLARVTKQADVLIVAIGQGHFVTKEFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVPGGVGPMTI MLM  T  +A RS+
Sbjct: 237 --GK--LIGDVKFDEVEPLASFITPVPGGVGPMTITMLMEQTYQSALRSV 282


>gi|291545041|emb|CBL18150.1| methenyltetrahydrofolate cyclohydrolase
           /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Ruminococcus sp. 18P13]
          Length = 285

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 149/294 (50%), Positives = 199/294 (67%), Gaps = 13/294 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK V++ + +++ E  A LK  TG+QVGLAVV+VGN+PAS  YV+ K +  +  
Sbjct: 1   MAKIIDGKEVSAQVKEQVKEEAAQLKAATGLQVGLAVVIVGNNPASRVYVNNKKKACEAV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S +Y      +Q +L   V  LN++  ++GILVQLPLP  + E++II +I P+KDVD
Sbjct: 61  GFQSFEYALDEGTTQEELLELVEVLNENPQVNGILVQLPLPKQIDEKAIINAISPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H  N G++MIG +    +PCTPAG + LI    G  +SG++ VVIGRSN+ GKPM  L
Sbjct: 121 AFHPSNVGRIMIGSYA--FLPCTPAGVMELIAS-TGVSVSGKNCVVIGRSNIVGKPMAML 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +N TVT+ HS+T+NL EIC  ADILV AVG+   V  D +K G++VIDVG+NR+++ 
Sbjct: 178 LLHQNGTVTICHSRTQNLKEICAQADILVAAVGKANFVTADMVKEGAVVIDVGMNRLDN- 236

Query: 241 QLGKTVLVGDV---ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
             GK  L GDV   A E K+  G ITPVPGGVGPMTIAMLM NT+ AA +  G+
Sbjct: 237 --GK--LCGDVDFAAVEPKA--GYITPVPGGVGPMTIAMLMRNTLTAAKQQNGL 284


>gi|332363433|gb|EGJ41216.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK355]
          Length = 284

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|182683736|ref|YP_001835483.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae CGSP14]
 gi|182629070|gb|ACB90018.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae CGSP14]
          Length = 306

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 82  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+AHS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 199 LLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 258 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 306


>gi|328945564|gb|EGG39715.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK1087]
          Length = 284

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQIPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRNEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVQFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|190571146|ref|YP_001975504.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018550|ref|ZP_03334358.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|226704415|sp|B3CLT4|FOLD_WOLPP RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|190357418|emb|CAQ54852.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995501|gb|EEB56141.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 295

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 196/299 (65%), Gaps = 5/299 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +I+GK  A+ L +++++ +  LKKE  V   L V+LVG++PAS  YV  K R A+  
Sbjct: 1   MSIIINGKKTANDLCEELSKKIDILKKEYNVFPCLKVILVGSNPASQVYVRNKQRKAESI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   V +LN+D S+HGILVQLPLP  +S   II ++  EKDVD
Sbjct: 61  GISSETIVLPDSISEDELIEKVNTLNEDSSVHGILVQLPLPKHISASRIINTVSVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G+++ G+    L+PCTP G++ LI+  +  +LSG++AV+IGRSN+ GKPM  L
Sbjct: 121 GFHDENVGRLVKGE-KNCLIPCTPKGSLHLIKSVEN-NLSGKNAVIIGRSNIVGKPMFHL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS++++L + C  ADI+V AVG+P  VQ DWIK G++VIDVGIN IN  
Sbjct: 179 LLQENCTVTILHSQSRDLADYCSKADIVVAAVGKPNFVQPDWIKKGAIVIDVGINSINIG 238

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
              K  LVGDV  E  K  V AITPVPGGVGPMTIA LM NT++AA    G+    F A
Sbjct: 239 NQSK--LVGDVDFEGVKEKVKAITPVPGGVGPMTIAFLMINTLVAACLQKGVDPSDFIA 295


>gi|146318151|ref|YP_001197863.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus suis
           05ZYH33]
 gi|253751335|ref|YP_003024476.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus suis SC84]
 gi|253753236|ref|YP_003026376.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus suis P1/7]
 gi|253755059|ref|YP_003028199.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus suis BM407]
 gi|158705778|sp|A4VTM4|FOLD_STRSY RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|145688957|gb|ABP89463.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus suis
           05ZYH33]
 gi|251815624|emb|CAZ51210.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus suis SC84]
 gi|251817523|emb|CAZ55267.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus suis BM407]
 gi|251819481|emb|CAR45013.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus suis P1/7]
 gi|292557908|gb|ADE30909.1| methylenetetrahydrofolate dehydrogenase [Streptococcus suis GZ1]
 gi|319757620|gb|ADV69562.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus suis
           JS14]
          Length = 282

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 189/287 (65%), Gaps = 9/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK +   L   +AE  A LK+E G+  GL V+LVG +PAS  YV  K R A   GF
Sbjct: 2   TVIDGKALGVKLQAALAEKTARLKEEKGLVPGLVVILVGENPASQVYVRNKERSALAAGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S     P  IS+ DL + +   N+DD  HGILVQLPLP+ +SE+ ++ +I P+KDVDG 
Sbjct: 62  KSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHISEEKVLLAIDPDKDVDGF 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N GK   G     ++P TPAG + + ++++  +L G+ A+VIGRSN+ GKPM QLLL
Sbjct: 122 HPTNMGKFWSGHPV--MIPSTPAGIMEMFKEYQ-IELEGKSALVIGRSNIVGKPMAQLLL 178

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHS+TKNLP++ R ADILVVA+GR   V  +++K G++VIDVG+NR  +   
Sbjct: 179 DADATVTIAHSRTKNLPDLARQADILVVAIGRGHFVTKEFVKLGAVVIDVGMNRDEN--- 235

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  L+GDV  DE   V   ITPVPGGVGPMTI MLM  T  A  RS
Sbjct: 236 GK--LIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRS 280


>gi|324990653|gb|EGC22589.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK353]
          Length = 284

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|332706102|ref|ZP_08426174.1| methenyltetrahydrofolate cyclohydrolase [Lyngbya majuscula 3L]
 gi|332355194|gb|EGJ34662.1| methenyltetrahydrofolate cyclohydrolase [Lyngbya majuscula 3L]
          Length = 287

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/285 (47%), Positives = 194/285 (68%), Gaps = 5/285 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +++DGK +A  +  ++ E    L  + G   GLAV++VG++PAS +YV  K R     
Sbjct: 1   MTNILDGKTIAKKIQTQLQEQTQKLMLKHGRPPGLAVLMVGDNPASAAYVRNKERACAKV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S   +FP + SQ +LE  + SLN+D  + GIL+QLPLP  +   S++  I P+KD D
Sbjct: 61  GIASFGRHFPSNTSQTELEETINSLNQDQRVDGILLQLPLPDHLDAVSLLHQIHPDKDAD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH VN G+++ GD   GL  CTPAG + L+++++  +LSGQ  VV+GRS L GKP+  +
Sbjct: 121 GLHPVNLGRLLRGD--PGLRSCTPAGIMRLLQEYQ-INLSGQKTVVVGRSILVGKPLALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHS+T++L E+ R ADILV AVGRP+++  D +K G++VIDVGINR+ S 
Sbjct: 178 LLEANATVTIAHSRTQDLGELTRRADILVAAVGRPQLITSDMVKPGAVVIDVGINRV-SD 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q  K+ L+GDV  D  + +   ITPVPGGVGPMT+AML+ NT+++
Sbjct: 237 QQEKSRLLGDVHFDSVQEIARYITPVPGGVGPMTVAMLLNNTILS 281


>gi|327469011|gb|EGF14483.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK330]
          Length = 284

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVQFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|83590359|ref|YP_430368.1| methenyltetrahydrofolate cyclohydrolase [Moorella thermoacetica
           ATCC 39073]
 gi|119369814|sp|Q2RIB4|FOLD_MOOTA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|83573273|gb|ABC19825.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Moorella thermoacetica ATCC 39073]
          Length = 280

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DGK +A+ +  ++ E V+ LK E G+  GLAVVLVG DPAS  YV  K R  +  G 
Sbjct: 4   QILDGKKIAAEVRAEVKEEVSRLKAE-GINPGLAVVLVGEDPASQVYVRNKHRACEEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S  +  P   SQ +L   +  LNKD  IHGILVQLPLP  + E+ +I +I  EKDVDG 
Sbjct: 63  YSEVHRLPAATSQAELLKLIDQLNKDPKIHGILVQLPLPDHIDEKKVIDAIALEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
              N G ++IGD      PCTP G ++L+E+  G D  G+ AVV+GRSN+ GKP+  +LL
Sbjct: 123 SPANVGNLVIGDKC--FYPCTPHGCMVLLEK-AGIDPKGKKAVVVGRSNIVGKPVAMMLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +R+ATVT+ HS+T++L   CR ADIL+ AVG+P ++  D IK G++VIDVGINR+     
Sbjct: 180 ARHATVTICHSRTRDLAAECRQADILIAAVGKPELITGDMIKEGAVVIDVGINRV----- 234

Query: 243 GKTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           G+  LVGDV  E  +   G ITPVPGGVGPMTIAML+ NTV AA R
Sbjct: 235 GEKKLVGDVHFESAAQKAGWITPVPGGVGPMTIAMLLKNTVEAARR 280


>gi|332361753|gb|EGJ39557.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK1056]
          Length = 284

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSELASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|312793172|ref|YP_004026095.1| methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312878038|ref|ZP_07737976.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795190|gb|EFR11581.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180312|gb|ADQ40482.1| Methylenetetrahydrofolate dehydrogenase (NADP(+))
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 289

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 193/285 (67%), Gaps = 8/285 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDGK +A  + +++   V  LK+  G++  LAVV+VG+DPAS SYV++K +     G
Sbjct: 3   AKIIDGKRIAQEIKNEVKIEVEKLKQR-GIEPTLAVVIVGDDPASRSYVNSKKKACSEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +SV++    + +Q +LE+ +  LN+D+ I+GILVQLPLP+ + E+ I   I+P KDVDG
Sbjct: 62  INSVEFALSQNTTQDELESLIDRLNRDEKINGILVQLPLPNGLDEKRICTKILPHKDVDG 121

Query: 122 LHVVNAGKVMIG-DFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
            H +N G V  G +F   + PCTP G I L+++ +  ++ G+HAVVIGRSN+ GKP+  L
Sbjct: 122 FHPLNVGMVATGIEFERAIKPCTPFGIIELLKR-ENIEIKGKHAVVIGRSNIVGKPLALL 180

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK L +I R ADILV AVG+PR V  D +K G++VIDVGINR ++ 
Sbjct: 181 LLRENATVTICHSYTKGLKDISRQADILVAAVGKPRFVTSDMVKDGAVVIDVGINRDDAT 240

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           Q     LVGDV  E  + V   ITPVPGGVGPMT+AMLM NT+ A
Sbjct: 241 QK----LVGDVEFETVEKVASFITPVPGGVGPMTVAMLMKNTLFA 281


>gi|225858627|ref|YP_002740137.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae 70585]
 gi|225720732|gb|ACO16586.1| bifunctional protein FolD [Streptococcus pneumoniae 70585]
          Length = 292

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTAKLKEETTLVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+AHS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLAHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|330958763|gb|EGH59023.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 300

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 194/296 (65%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +++ + V  LK E G++  LAV+LVG DPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVRQDVRGLKAE-GIEPALAVILVGADPASEVYVRNKILRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D SQ  +   +  LN D+S++GIL+QLPLP+ + E   +Q+I P KDVDG H
Sbjct: 64  SLEHRLPADSSQARVLALIAELNADNSVNGILLQLPLPAHIEETRALQAIDPGKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+ +  G DL+G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRRV--LTPCTPSGCMHLLNETCG-DLTGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSSDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    VV AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDNVLDVVSAITPVPGGVGPMTIAFLMQNTVTAARQQAHAQRSQSEA 294


>gi|16079487|ref|NP_390311.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221310354|ref|ZP_03592201.1| methenyltetrahydrofolate cyclohydrolase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314678|ref|ZP_03596483.1| methenyltetrahydrofolate cyclohydrolase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319601|ref|ZP_03600895.1| methenyltetrahydrofolate cyclohydrolase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323877|ref|ZP_03605171.1| methenyltetrahydrofolate cyclohydrolase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321311915|ref|YP_004204202.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis BSn5]
 gi|1706886|sp|P54382|FOLD_BACSU RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|1303916|dbj|BAA12572.1| YqiA [Bacillus subtilis]
 gi|2634865|emb|CAB14362.1| methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate
           cyclohydrolase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320018189|gb|ADV93175.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           subtilis BSn5]
          Length = 283

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 195/288 (67%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LKK+ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAREKREQLAKEVEELKKQ-GVTPGLAVILIGDDPASHSYVRGKKKAAETMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +     F   +++ +L + +   N+D   HGILVQLPLP  +SE+++I+ I P+KDVDG 
Sbjct: 63  NFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHISEKAVIERISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTP G + L+++    DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPHGIVELLKK-TNIDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+T+N+ E  + ADILVVAVGR   +  D IK G++VIDVG+NR+ +   
Sbjct: 180 NENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKEGAVVIDVGVNRLEN--- 236

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  E  K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LCGDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRTL 282


>gi|229019400|ref|ZP_04176223.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH1273]
 gi|229025644|ref|ZP_04182050.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH1272]
 gi|228735642|gb|EEL86231.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH1272]
 gi|228741870|gb|EEL92047.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus cereus
           AH1273]
          Length = 286

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 190/286 (66%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA     ++ E V  LK E G+  GLAV+LVG DPAS SYV  K +  +  G +
Sbjct: 5   IIKGNEVAEKKRAQLKEEVVKLK-EQGIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P  I++  L   +  LN DD I+GILVQLPLP  + E++II+ I PEKDVDG H
Sbjct: 64  SELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ G++M G  T   +PCTP G + L+++    D+SG+H VVIGRSN+ GKP+GQL L+
Sbjct: 124 PISVGRMMTGQDT--FLPCTPHGIVELVKE-TNLDVSGKHVVVIGRSNIVGKPVGQLFLN 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT  HSKT+N+ E+ + ADIL+VAVGR +MV  D+IK G++VIDVG+NR+ +   G
Sbjct: 181 ENATVTYCHSKTQNIKELSKLADILIVAVGRAKMVTADYIKEGAVVIDVGVNRLET---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D    V G ITPVP GVGPMTI ML+ NTV +A R+
Sbjct: 238 K--LCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRA 281


>gi|146320337|ref|YP_001200048.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus suis 98HAH33]
 gi|158705776|sp|A4VZV9|FOLD_STRS2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|145691143|gb|ABP91648.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Streptococcus suis
           98HAH33]
          Length = 282

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 190/287 (66%), Gaps = 9/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK +   L   +AE  A LK+E G+  GL V+LVG +PAS  YV  K R A   GF
Sbjct: 2   TVIDGKALGVKLQAALAEKTARLKEEKGLVPGLVVILVGENPASQVYVRNKERSALAAGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S     P  IS+ DL + +   N+DD  HGILVQLPLP+ +SE+ ++ +I P+KDVDGL
Sbjct: 62  KSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHISEEKVLLAIDPDKDVDGL 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N GK   G     ++P TPAG + + ++++  +L G+ A+VIGRSN+ GKPM QLLL
Sbjct: 122 HPTNMGKFWSGHPV--MIPSTPAGIMEMFKEYQ-IELEGKSALVIGRSNIVGKPMAQLLL 178

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHS+TKNLP++ R ADI+VVA+GR   V  +++K G++VIDVG+NR  +   
Sbjct: 179 DADATVTIAHSRTKNLPDLARQADIVVVAIGRGHFVTKEFVKLGAVVIDVGMNRDEN--- 235

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  L+GDV  DE   V   ITPVPGGVGPMTI MLM  T  A  RS
Sbjct: 236 GK--LIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRS 280


>gi|254409347|ref|ZP_05023128.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Microcoleus chthonoplastes PCC 7420]
 gi|196183344|gb|EDX78327.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Microcoleus chthonoplastes PCC 7420]
          Length = 311

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 193/287 (67%), Gaps = 5/287 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            L+DGK +A  + D++   V  LK   G   GLAV++VG+ PAS +YV  K R     G 
Sbjct: 27  QLLDGKALAQRIQDQLKAEVERLKSTYGRPPGLAVLMVGDHPASAAYVRNKERACTKVGI 86

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S   +FP D+SQ ++E  +  LN+D ++ GIL+QLP+P+ ++   ++  I P+KDVDGL
Sbjct: 87  ASFGQHFPADVSQSEIEQTIDRLNQDPNVDGILLQLPVPAHLNAVYLLHKIDPDKDVDGL 146

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G+++ G+   GL  CTPAG + L+ +++  DL G++AVV+GRS L GKP+  +LL
Sbjct: 147 HPLNLGRLLRGE--RGLQSCTPAGVMRLLREYR-IDLKGKNAVVVGRSILVGKPIALMLL 203

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHS+TKNL E+ R ADIL+ AVGRP ++  D +K  ++VIDVGINR+   Q 
Sbjct: 204 EADATVTIAHSRTKNLAELTRQADILIAAVGRPNLITADQVKPNAIVIDVGINRVIDAQ- 262

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK+ LVGDV  D  + +   ITPVPGGVGPMT+ ML+ NTV +  R+
Sbjct: 263 GKSRLVGDVDFDAVREMSQFITPVPGGVGPMTVTMLLQNTVFSYTRT 309


>gi|291557878|emb|CBL34995.1| methenyltetrahydrofolate cyclohydrolase
           /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Eubacterium siraeum V10Sc8a]
          Length = 279

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 138/282 (48%), Positives = 188/282 (66%), Gaps = 11/282 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK V++ + ++I   +   K    + +GLAV++VGN+ AS  YV+ K +  + CG 
Sbjct: 2   NLIDGKAVSASVKEQIRAEIERDK----LDIGLAVIIVGNNQASRVYVNNKKKACEVCGI 57

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P D +Q +L   + +LNKDD ++GIL QLPLP  + E+ +I++I P KDVD  
Sbjct: 58  KSYEYALPEDTTQDELMELIDTLNKDDKVNGILCQLPLPKHLDEEKVIEAISPLKDVDAF 117

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           + VN GK+MIG+++   +PCTPAG + LI    G  + G+  VVIGRSN+ GKPM  LLL
Sbjct: 118 NAVNVGKIMIGNYS--FLPCTPAGVMELIHS-TGVSVEGKECVVIGRSNIVGKPMAMLLL 174

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+ HS+TK+L E+CR ADILV AVGR   V  D +K G++VIDVG+NR    +L
Sbjct: 175 HENATVTVCHSRTKDLAEVCRRADILVSAVGRADFVTADMVKDGAVVIDVGMNRNADNKL 234

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
              V   +VA +C      ITPVPGGVGPMTIAMLM NT++A
Sbjct: 235 CGDVKFDEVAPKC----SYITPVPGGVGPMTIAMLMKNTLMA 272


>gi|222153404|ref|YP_002562581.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus uberis 0140J]
 gi|254789422|sp|B9DUU0|FOLD_STRU0 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|222114217|emb|CAR42790.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus uberis 0140J]
          Length = 284

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  +  ++A+ V  LK+E G+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAQKMQSQLAKKVEDLKQEFGIVPGLVVILVGDNPASQVYVRNKERSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   NKD+SIHGILVQLPLP+ ++E+ II  I P KDVD
Sbjct: 61  GFKSETIRLSESICQEELIKIIHRYNKDESIHGILVQLPLPTHINEKRIILEIDPHKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ +++  DL G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSGRPI--MVPCTPAGIMEMLSEYQ-IDLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T+NL +I   AD+L+VA+G+   V  +++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRNLSKISSEADVLIVAIGQGHFVTEEYVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDVA +E       ITPVPGGVGPMTI ML+  T  +A R +
Sbjct: 237 --GK--LIGDVAFEEVSRKASYITPVPGGVGPMTITMLLEQTYQSALRRV 282


>gi|330991258|ref|ZP_08315209.1| protein folD [Gluconacetobacter sp. SXCC-1]
 gi|329761277|gb|EGG77770.1| protein folD [Gluconacetobacter sp. SXCC-1]
          Length = 305

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 148/292 (50%), Positives = 186/292 (63%), Gaps = 5/292 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ LT  IA  V+       +  GLAVVLVGNDPAS  YV  K       G  
Sbjct: 18  LIDGKGFAARLTQDIATEVSAFYDRHRITPGLAVVLVGNDPASEVYVRNKALQTHRAGMR 77

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P   SQ +L   +  LN D  IHGILVQLPLP  +   ++  +IVPEKDVDGL 
Sbjct: 78  SFMHMLPATTSQEELLGLIARLNVDPEIHGILVQLPLPGGLDPVAVTNAIVPEKDVDGLG 137

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ +G    G+VPCTP G +LL+  + G D+ GQHA+VIG SNL G+PM QLLL 
Sbjct: 138 VVNAGRLALG--LPGIVPCTPLGCLLLLRHYVG-DMRGQHALVIGASNLVGRPMAQLLLQ 194

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
              TVT+AH  T++   + R ADI+VVA G   +V+ DWI+ G+ VIDVGI+R++ P  G
Sbjct: 195 EGCTVTVAHIDTRDTAALARQADIVVVATGVRELVRGDWIRPGATVIDVGISRVSLPG-G 253

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP 294
           +T LVGDV  DE     G ITPVPGGVGPMTIA L+ NT+ AA   +  ++P
Sbjct: 254 RTRLVGDVKFDEVAPHAGLITPVPGGVGPMTIACLLRNTLDAARTIVEGRAP 305


>gi|291484873|dbj|BAI85948.1| methenyltetrahydrofolate cyclohydrolase [Bacillus subtilis subsp.
           natto BEST195]
          Length = 283

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 195/288 (67%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A    +++A+ V  LKK+ GV  GLAV+L+G+DPAS SYV  K + A+  G 
Sbjct: 4   TIIDGKETAREKREQLAKEVEELKKQ-GVTPGLAVILIGDDPASHSYVRGKKKAAETMGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +     F   +++ +L + +   N+D   HGILVQLPLP  +SE+++I+ I P+KDVDG 
Sbjct: 63  NFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHISEKAVIERISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK+++G+ T   +PCTP G + L+++    DLSG+  VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPLNVGKMLLGEDT--FLPCTPHGIVELLKKI-NIDLSGKEVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT  HS+T+N+ E  + ADILVVAVGR   +  D IK G++VIDVG+NR+ +   
Sbjct: 180 NENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKEGAVVIDVGVNRLEN--- 236

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  E  K     ITPVPGGVGPMTI ML  NTV +A R+L
Sbjct: 237 GK--LCGDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRTL 282


>gi|319943469|ref|ZP_08017751.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Lautropia mirabilis ATCC 51599]
 gi|319743284|gb|EFV95689.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Lautropia mirabilis ATCC 51599]
          Length = 286

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 190/289 (65%), Gaps = 9/289 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDG  +++ + +++ E+   +   TG + GLAV+LVG+  AS  YV  K R  +  GFH
Sbjct: 5   LIDGTAISAQVREEVREAAQEILNATGQRPGLAVILVGDSAASQVYVRNKIRACEAAGFH 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV  + P + ++  L   +  LNKD ++HGILVQLPLP+ +  + +I++I P+KDVDG H
Sbjct: 65  SVSEHLPEETTEAALLARLDELNKDPAVHGILVQLPLPAHIDTRRVIEAISPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V NAG +M G     LVPCTP G + L+E   G  L G  AV++G SNL GKP   LLL 
Sbjct: 125 VANAGALMTG--APQLVPCTPLGVMRLLES-TGVPLRGAEAVIVGASNLVGKPQLHLLLQ 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             ATVT+ +SKT++L    R ADILVVAVGRPRM+  D IK G++VIDVGINR+     G
Sbjct: 182 AGATVTLCNSKTRDLAAQTRRADILVVAVGRPRMITGDMIKPGAVVIDVGINRLPD---G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           K  L GDV  D  ++V G ITPVPGGVGPMTIAML+ NT+ AA R L +
Sbjct: 239 K--LTGDVDFDSARNVAGWITPVPGGVGPMTIAMLLQNTITAARRHLKL 285


>gi|307706380|ref|ZP_07643192.1| bifunctional protein folD [Streptococcus mitis SK321]
 gi|307618298|gb|EFN97453.1| bifunctional protein folD [Streptococcus mitis SK321]
          Length = 285

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 194/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE    L +ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTVKLTEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  ISQ +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GFRSEVVRVPETISQEELLDLIAKYNQDSAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTPDFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAAIRTL 282


>gi|312110279|ref|YP_003988595.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           Y4.1MC1]
 gi|311215380|gb|ADP73984.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus sp.
           Y4.1MC1]
          Length = 291

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 137/286 (47%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A     ++A+ V  LK+E G++ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 7   QIISGAELAKEKRAQLAKEVERLKRE-GIEPGLAVILVGDDPASHSYVRGKQKACAEVGI 65

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S    FP  I++  L   +  LN+D S+HGILVQLPLP  + E  +I++I PEKDVDG 
Sbjct: 66  RSTLLTFPATITEEFLLEKIKELNEDPSVHGILVQLPLPKHIDELKVIETISPEKDVDGF 125

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++M+G      +PCTP G +++++   G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 126 HPINVGRMMVGQ--DAFLPCTPYGILVMVKSI-GVDIAGKHVVVVGRSNIVGKPVGQLFL 182

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT  HS+T +L  I R ADIL+VAVG+ R +  + +K G++VIDVG+NR+ S   
Sbjct: 183 REHATVTYCHSRTNDLASITRQADILIVAVGKARFIGTEHVKQGAVVIDVGVNRLES--- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK  L GDV  +E K V   ITPVP GVGPMTI ML+ NT+ AA +
Sbjct: 240 GK--LCGDVNFEEVKEVASYITPVPKGVGPMTITMLLHNTIEAAKK 283


>gi|313890716|ref|ZP_07824341.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120817|gb|EFR43931.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus pseudoporcinus SPIN 20026]
          Length = 284

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 193/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +   +  K+A+ V  LK+E G+  GLAV+LVG++PAS  YV  K + A   
Sbjct: 1   MVTIIDGKALGQKMQGKLAKKVKDLKREFGIVPGLAVILVGDNPASQVYVRNKEKSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N+D+SIHGILVQLPLPS ++++ II  I P+KDVD
Sbjct: 61  GFKSETVRLSESICQEELIAIIHQFNQDESIHGILVQLPLPSHINDKKIILEIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +   + G DL G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPAGIMEMFSDY-GIDLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T++L E  R ADIL+VA+G+   V  +++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRHLAEFARQADILIVAIGQGHFVTEEFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDVA ++       ITPVPGGVGPMTI ML+  T  +A RS+
Sbjct: 237 --GK--LIGDVAFEQVSQKASYITPVPGGVGPMTITMLLEQTYQSALRSV 282


>gi|66541361|ref|XP_624275.1| PREDICTED: bifunctional protein FolD-like [Apis mellifera]
          Length = 289

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 185/288 (64%), Gaps = 4/288 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDGK  A+ +T KIA  V  L++E  V  GLAV+LVGNDPAS  YV  KT+     G 
Sbjct: 4   QLIDGKGFATNMTQKIALEVKQLQQEKNVTPGLAVILVGNDPASEVYVRNKTKQTHRVGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S  +  P   +Q ++ N V  LNKD  IHGILVQLPLP  ++  +IIQ+I P KDVDGL
Sbjct: 64  RSFMHLLPETTTQEEILNLVARLNKDPDIHGILVQLPLPKGLNADTIIQAITPHKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
              N GK+ +G    G +PCTP G ++L+++ +   L G HAV+IG SNL GKPM QLLL
Sbjct: 124 TAYNTGKLALG-HKDGFIPCTPLGCLMLLQK-ELSSLKGLHAVIIGASNLMGKPMAQLLL 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
               TVT+AH  T+N  ++ R ADIL+VA G   +V+  WI  G+ +IDVGINRI +   
Sbjct: 182 QEGCTVTIAHIHTRNPEKLARQADILIVATGCSELVKGSWISEGTTIIDVGINRITTKD- 240

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
            KT L+GDVA +E       ITPVPGGVGP+TIA L+ NT+ AA  ++
Sbjct: 241 NKTKLIGDVAFEEVLGKAAKITPVPGGVGPVTIACLLHNTLQAARNTI 288


>gi|228478386|ref|ZP_04062994.1| bifunctional protein FolD [Streptococcus salivarius SK126]
 gi|228250065|gb|EEK09335.1| bifunctional protein FolD [Streptococcus salivarius SK126]
          Length = 294

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 193/289 (66%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A+ + D++ E VA LK+   +  GL V++VG++PAS  YV  K R AK  
Sbjct: 11  MAIIMDGKALAAKMQDQLQEKVARLKENEWIVPGLVVIMVGDNPASQVYVRNKERAAKKA 70

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N+D   HGILVQLPLP+ ++E  I+ +I P+KDVD
Sbjct: 71  GFHSQTVNLSESISEEELIEVIEQYNQDPLFHGILVQLPLPNHINEMRILLAIDPKKDVD 130

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 131 GFHPMNTGNLWNG--RRQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 187

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  D++K G++VIDVGINR    
Sbjct: 188 LLEKNATVTLTHSRTPHLAKVCSKADVLIVAIGRAKFVTEDYVKEGAVVIDVGINR---D 244

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           + GK  L GDV  D+ K  VG ITPVPGGVGPMTI MLM  T  AA RS
Sbjct: 245 EEGK--LCGDVDFDQVKDKVGMITPVPGGVGPMTITMLMEQTYQAALRS 291


>gi|42520413|ref|NP_966328.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99036045|ref|ZP_01315082.1| hypothetical protein Wendoof_01000076 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|81652594|sp|Q73HK3|FOLD_WOLPM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|42410152|gb|AAS14262.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 292

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 145/297 (48%), Positives = 198/297 (66%), Gaps = 8/297 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L +++++ +  LK+E  +   L V+L+G++PAS  YV  K + A+  
Sbjct: 1   MTIIIDGKKIANDLCERLSQKIDILKREYNIFPCLKVILIGSNPASQVYVRNKQKKAESI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P +I + +L   +  LN+D S+HGILVQLPLP+ +S   +I ++  EKDVD
Sbjct: 61  GISSETIVLPNNILEDELIEKINELNEDPSVHGILVQLPLPNHISASRVINTVSVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N GK++ G+    L+PCTP G++ LI+  +  +LSG++AVVIGRSN+ GKPM  L
Sbjct: 121 GFHDENVGKLVKGE-KNCLIPCTPKGSLHLIKSIEE-NLSGKNAVVIGRSNIVGKPMFYL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS++K+L E C  ADI+V AVG+P  VQ DWIK G++VIDVGIN +N  
Sbjct: 179 LLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIKKGAIVIDVGINSVN-- 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKF 296
            +GK  LVGDV  E  K    A+TPVPGGVGPMTIA LM NTVIAA    G+ +  F
Sbjct: 237 -VGK--LVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACLQKGVDASDF 290


>gi|66045465|ref|YP_235306.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. syringae B728a]
 gi|75502288|sp|Q4ZUA4|FOLD2_PSEU2 RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|63256172|gb|AAY37268.1| Methenyltetrahydrofolate cyclohydrolase [Pseudomonas syringae pv.
           syringae B728a]
          Length = 300

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 141/296 (47%), Positives = 191/296 (64%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++   V  LK E G++  LAV+LVGND AS  YV  K   A   G  
Sbjct: 5   IIDGKAAAARVLQQVRHDVNILKAE-GIEPALAVILVGNDAASEVYVRNKILRAGEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D SQ  L   +  LN D++++GIL+QLPLP+ + E  ++Q+I P+KDVDG H
Sbjct: 64  SLEHRLPADSSQARLLALIAELNADNTVNGILLQLPLPAHIDENRVLQAIDPDKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+E+  G DLSG+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCLHLLEETCG-DLSGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPR++   W+K G++VIDVGINRI     G
Sbjct: 181 AHCSVTVVHSRSTDARALCQLADIVVAAVGRPRLIDASWLKRGAVVIDVGINRIEDH--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV       V  AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFASATEVASAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQPEA 294


>gi|324993390|gb|EGC25310.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK405]
 gi|332362895|gb|EGJ40688.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK49]
          Length = 284

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L   + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLGLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSELASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|307708521|ref|ZP_07644986.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Streptococcus mitis
           NCTC 12261]
 gi|307615437|gb|EFN94645.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Streptococcus mitis
           NCTC 12261]
          Length = 306

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 196/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE    LK+ETG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTKRLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 82  GFRSEVVRVPDTITQEELLDLIAKYNQDSAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG I +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIIEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L+++NATVT+ HS+T NL ++   ADILVVA+GR + V  +++K G++VIDVG+NR  + 
Sbjct: 199 LVAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTANFVKPGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 258 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAAIRTLDRK 306


>gi|325688237|gb|EGD30256.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK72]
          Length = 284

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKIERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE       ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVAETASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|295399118|ref|ZP_06809100.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978584|gb|EFG54180.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 291

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 137/286 (47%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G  +A     ++A+ V  LK+E G++ GLAV+LVG+DPAS SYV  K +     G 
Sbjct: 7   QIISGAELAKEKRAQLAKEVERLKRE-GIEPGLAVILVGDDPASHSYVRGKQKACAEVGI 65

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S    FP  I++  L   +  LN+D S+HGILVQLPLP  + E  +I++I PEKDVDG 
Sbjct: 66  RSTLLTFPATITEEFLLGKIKELNEDPSVHGILVQLPLPKHIDELKVIETISPEKDVDGF 125

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++M+G      +PCTP G +++++   G D++G+H VV+GRSN+ GKP+GQL L
Sbjct: 126 HPINVGRMMVGQ--DAFLPCTPYGILVMVKSI-GVDIAGKHVVVVGRSNIVGKPVGQLFL 182

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT  HS+T +L  I R ADIL+VAVG+ R +  + +K G++VIDVG+NR+ S   
Sbjct: 183 REHATVTYCHSRTNDLASITRQADILIVAVGKARFIGTEHVKQGAVVIDVGVNRLES--- 239

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK  L GDV  +E K V   ITPVP GVGPMTI ML+ NT+ AA +
Sbjct: 240 GK--LCGDVNFEEVKEVASYITPVPKGVGPMTITMLLHNTIEAAKK 283


>gi|69244728|ref|ZP_00602992.1| Methylenetetrahydrofolate dehydrogenase (NADP+) [Enterococcus
           faecium DO]
 gi|257879352|ref|ZP_05659005.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,230,933]
 gi|257881782|ref|ZP_05661435.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,502]
 gi|257885164|ref|ZP_05664817.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,501]
 gi|257890178|ref|ZP_05669831.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,410]
 gi|257893506|ref|ZP_05673159.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,408]
 gi|258615758|ref|ZP_05713528.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecium DO]
 gi|260558794|ref|ZP_05830983.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium C68]
 gi|293553170|ref|ZP_06673807.1| bifunctional protein FolD [Enterococcus faecium E1039]
 gi|293560489|ref|ZP_06676981.1| bifunctional protein FolD [Enterococcus faecium E1162]
 gi|293568315|ref|ZP_06679639.1| bifunctional protein FolD [Enterococcus faecium E1071]
 gi|294621588|ref|ZP_06700753.1| bifunctional protein FolD [Enterococcus faecium U0317]
 gi|314937886|ref|ZP_07845202.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133a04]
 gi|314941377|ref|ZP_07848270.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133C]
 gi|314950136|ref|ZP_07853422.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0082]
 gi|314951323|ref|ZP_07854377.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133A]
 gi|314992846|ref|ZP_07858247.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133B]
 gi|314998050|ref|ZP_07862938.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133a01]
 gi|68196319|gb|EAN10748.1| Methylenetetrahydrofolate dehydrogenase (NADP+) [Enterococcus
           faecium DO]
 gi|257813580|gb|EEV42338.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,230,933]
 gi|257817440|gb|EEV44768.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,502]
 gi|257821016|gb|EEV48150.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,501]
 gi|257826538|gb|EEV53164.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,410]
 gi|257829885|gb|EEV56492.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,231,408]
 gi|260075253|gb|EEW63566.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium C68]
 gi|291589027|gb|EFF20851.1| bifunctional protein FolD [Enterococcus faecium E1071]
 gi|291598753|gb|EFF29805.1| bifunctional protein FolD [Enterococcus faecium U0317]
 gi|291602580|gb|EFF32795.1| bifunctional protein FolD [Enterococcus faecium E1039]
 gi|291605637|gb|EFF35079.1| bifunctional protein FolD [Enterococcus faecium E1162]
 gi|313587892|gb|EFR66737.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133a01]
 gi|313592650|gb|EFR71495.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133B]
 gi|313596540|gb|EFR75385.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133A]
 gi|313599800|gb|EFR78643.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133C]
 gi|313642744|gb|EFS07324.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0133a04]
 gi|313643577|gb|EFS08157.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium TX0082]
          Length = 284

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/286 (50%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LI+GK +A  +  +IAE +  LK + G+  GL V+LVG +PAS  YV  K R+AK  
Sbjct: 1   MAELINGKELAEKMQAEIAEKIQKLK-DNGIHPGLVVLLVGENPASQIYVRNKERVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS+   +P  IS+ +L   +   N+D S HGILVQLPLP  + E+ I+ +I PEKDVD
Sbjct: 60  GIHSLVERYPETISEDELLAEIEKYNQDPSFHGILVQLPLPKHIDEEKILLAIRPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G+++ G      +PCTP G + + E +   D +G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLLAG--KPDKIPCTPYGIMKMFEAY-SIDPAGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+AHSKT+NL E+ + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 177 LLMADATVTVAHSKTENLAELAQEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L+GDV  DE + + G ITPVP GVGPMTI MLM  TV +A
Sbjct: 236 --GK--LIGDVKFDEVEPIAGWITPVPKGVGPMTITMLMYQTVKSA 277


>gi|15902773|ref|NP_358323.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae R6]
 gi|15458321|gb|AAK99533.1| Fold bifunctional protein; includes: methylenetetrahydrofolate
           dehydrogenase, methenyltetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae R6]
          Length = 306

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 82  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 199 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 258 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 306


>gi|116515868|ref|YP_816214.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae D39]
 gi|116076444|gb|ABJ54164.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae D39]
 gi|301793970|emb|CBW36367.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus pneumoniae INV104]
          Length = 292

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|327458749|gb|EGF05097.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK1057]
          Length = 284

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++V+DVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVVDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSELASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|251796319|ref|YP_003011050.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           sp. JDR-2]
 gi|247543945|gb|ACT00964.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           sp. JDR-2]
          Length = 287

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 195/287 (67%), Gaps = 10/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I GK ++ ++ ++I +  A L+ E GV  GLAVVLVG DPAS  YV +K +  +  GF
Sbjct: 5   QIIAGKKISDMIREEIQKETADLR-EKGVVPGLAVVLVGEDPASKVYVGSKEKACQQLGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S  +      S+  L   +  LN DD I+GILVQLPLP  ++E+++I +I  +KDVDG 
Sbjct: 64  YSEVHRLEESASEEQLLALIDQLNNDDKINGILVQLPLPKHINEKAVIDAIRVDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  + G ++IGD +  L+PCTPAG I LI++  G D+SG+HAVVIGRSN+ GKP+  LLL
Sbjct: 124 HPESVGNLVIGDDS--LLPCTPAGCIELIKR-SGVDISGKHAVVIGRSNIVGKPVAMLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+ HS+T N+ EI + ADILVVA+G+ + +   ++K G++VIDVGINR+     
Sbjct: 181 RENATVTICHSRTANMEEIAKQADILVVAIGKAKAIDSKYVKPGAVVIDVGINRLPD--- 237

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  L GDV  D+C    G ITPVPGGVGPMTI MLM NT+ AA R+
Sbjct: 238 GK--LCGDVDYDDCLETAGFITPVPGGVGPMTITMLMNNTITAAKRA 282


>gi|116872791|ref|YP_849572.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Listeria
           welshimeri serovar 6b str. SLCC5334]
 gi|123466250|sp|A0AIG1|FOLD_LISW6 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|116741669|emb|CAK20793.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Listeria
           welshimeri serovar 6b str. SLCC5334]
          Length = 284

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 192/291 (65%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDG+ +A  + +++   VA L K    + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGQIIDGEKLAKEIQERVTTEVAELAK-IDKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +S+  L   V  LN DD+IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPETVSEEKLLEVVEELNTDDTIHGILVQLPLPKHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG      VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIG--KDSFVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TKNLPE+ + ADILVVA G  + V+ ++IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKNLPEVAKEADILVVATGLAKFVKKEYIKPGAIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V   DV +E     G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDVDFDDVIEEA----GFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|158522044|ref|YP_001529914.1| methenyltetrahydrofolate cyclohydrolase [Desulfococcus oleovorans
           Hxd3]
 gi|226704345|sp|A8ZTQ4|FOLD_DESOH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158510870|gb|ABW67837.1| Methenyltetrahydrofolate cyclohydrolase [Desulfococcus oleovorans
           Hxd3]
          Length = 303

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 188/300 (62%), Gaps = 12/300 (4%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LI G  +   +  +I   V  +K++ G   GL  +LVG  PAS SYV+ K + A   GF
Sbjct: 4   KLIKGTEIREEILKEIEAEVKEIKEKHGKVPGLVTILVGESPASISYVTLKIQTAHRVGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
             VQ + PVDIS+ DL   +   NKDDSIHGILVQLPLP  + E+ ++ +I P+KDVDG 
Sbjct: 64  KEVQDSQPVDISEADLLALIDKYNKDDSIHGILVQLPLPKHIDEKKVLNAIDPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++MIG       PCTPAG   +I +  G + SG   VV+GRSN+ GKP+  ++L
Sbjct: 124 HPVNVGRLMIGGSEVKFPPCTPAGIQEMIVR-AGVETSGAEVVVVGRSNIVGKPIANMML 182

Query: 183 SR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            +    NATVT+ H++TKN+ E C+ ADIL+VA G P +V+ +WIK G+ VIDVG+NR+ 
Sbjct: 183 QKGPGANATVTVVHTRTKNMDEHCKRADILIVAAGVPGLVKPEWIKPGACVIDVGVNRVG 242

Query: 239 SPQLGK------TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
                K       +L GDV  D  K + G+ITPVPGGVGPMTI MLM NT+ +    LG+
Sbjct: 243 EKPSAKDPNKMVAILSGDVDFDAAKEIAGSITPVPGGVGPMTITMLMLNTLKSLKFKLGL 302


>gi|149010547|ref|ZP_01831918.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP19-BS75]
 gi|147765028|gb|EDK71957.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP19-BS75]
          Length = 285

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASYITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|119370064|sp|Q8DQD3|FOLD_STRR6 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158705929|sp|Q04L84|FOLD_STRP2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|332202682|gb|EGJ16751.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA41317]
          Length = 285

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|299822998|ref|ZP_07054884.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Listeria grayi DSM 20601]
 gi|299816527|gb|EFI83765.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Listeria grayi DSM 20601]
          Length = 285

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 146/288 (50%), Positives = 194/288 (67%), Gaps = 10/288 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A+ +  KI + VA LK E G Q GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGKVIDGKKIAAEIQAKIEKDVAVLK-ERGKQPGLAVVLVGDNQASRTYVRNKQKRTEAV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +S+ +L   V +LN DD+IHGILVQLPLP  +SE  +I +I  EKDVD
Sbjct: 60  GMKSVLIELPETVSEKELLETVETLNHDDTIHGILVQLPLPKHISEDKVIDTISSEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H ++ G + IG  T   +PCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPLSVGNLFIGKPT--FLPCTPAGIIELIKST-GESIEGKKAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHS+T++L ++   ADILVVA+G  + ++ + +K GS+VIDVG++R  + 
Sbjct: 177 LLQENATVTIAHSRTRDLEKVASEADILVVAIGIAKFIKKEAVKEGSIVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +     L GDV  D+  S  G ITPVPGGVGPMTI ML+ANT+ AA +
Sbjct: 237 K-----LCGDVDYDDVVSKAGYITPVPGGVGPMTITMLLANTLRAAKQ 279


>gi|160892569|ref|ZP_02073359.1| hypothetical protein CLOL250_00098 [Clostridium sp. L2-50]
 gi|156865610|gb|EDO59041.1| hypothetical protein CLOL250_00098 [Clostridium sp. L2-50]
          Length = 280

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 143/283 (50%), Positives = 191/283 (67%), Gaps = 10/283 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK ++  + D++ E VA L  + G+++ LAV+ VGNDPAS  YV  K +   + 
Sbjct: 1   MVQLIDGKAISKQIKDELKEQVAELSAK-GIKICLAVIQVGNDPASSVYVGNKKKACAYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y  P + ++ +L   +  LNKDD+++GILVQLP+P  + E  II++I P KDVD
Sbjct: 60  GIDSLSYELPEETTEKELLELIDKLNKDDAVNGILVQLPVPKHIDEDKIIKAISPLKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H ++ G + IG    G V CTPAG I L+++  G +++G+  VVIGRSN+ GKPM  L
Sbjct: 120 GFHPMSVGALSIG--QPGFVSCTPAGVIQLLKR-SGIEIAGKECVVIGRSNIVGKPMAML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HSKTK+L E+C+ ADILVVA+GRP+M+   +IK G+ VIDVGI+R  + 
Sbjct: 177 LLRENGTVTICHSKTKDLKEVCKRADILVVAIGRPKMIDASYIKEGATVIDVGIHRDENN 236

Query: 241 QLGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTV 282
           +     L GDV  E  S V GAITPVPGGVGPMTIAMLM N V
Sbjct: 237 K-----LCGDVDFESASKVAGAITPVPGGVGPMTIAMLMHNCV 274


>gi|91199999|emb|CAJ73041.1| strongly similar to bifunctional 5,10 methylene-tetrahydrofolate
           dehydrogenase/cyclohydrolase FolD [Candidatus Kuenenia
           stuttgartiensis]
          Length = 303

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 190/301 (63%), Gaps = 12/301 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LI G  +   + ++I   VA +KK+ GV  GL  +LVG +PAS SYV+ K + A   GF
Sbjct: 4   KLIKGTEIGEQILEEITGEVAEIKKKHGVVPGLVTILVGENPASMSYVTLKIKTAHRVGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
             VQ + P DIS+ DL   +   N DDSIHGILVQLPLP  + E+ ++ +I P+KDVDG 
Sbjct: 64  KEVQDSQPADISEKDLLALIEKYNHDDSIHGILVQLPLPKHIDEKKVLNAIDPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++MIG       PCTPAG   LI +  G +  G   VV+GRSN+ GKP+  ++L
Sbjct: 124 HPVNVGRLMIGGNEVKFPPCTPAGIQELIVR-SGVETRGAEVVVVGRSNIVGKPIANMML 182

Query: 183 SR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI- 237
            +    +ATVT+ H++T+N+ E C+ AD+L+VA G P +V+ +WIK G+ VIDVG+NR+ 
Sbjct: 183 QKGKGADATVTIVHTQTRNMAEHCKRADVLIVAAGVPGLVKPEWIKPGACVIDVGVNRVG 242

Query: 238 -----NSPQLGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
                N P     +L GDV  E  S + G ITPVPGGVGPMTI MLM NT+ +    LG+
Sbjct: 243 EKPSKNDPNKMVALLKGDVDFEAASEIAGFITPVPGGVGPMTITMLMRNTLRSLKFKLGI 302

Query: 292 K 292
           K
Sbjct: 303 K 303


>gi|323352723|ref|ZP_08087693.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis VMC66]
 gi|322121759|gb|EFX93505.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis VMC66]
          Length = 284

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P   SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEATSQEELLSLIETYNQNPDWHGILVQLPLPDHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|149021691|ref|ZP_01835722.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP23-BS72]
 gi|147930152|gb|EDK81138.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP23-BS72]
          Length = 285

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLTIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|284051540|ref|ZP_06381750.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Arthrospira
           platensis str. Paraca]
 gi|291568863|dbj|BAI91135.1| bifunctional protein FolD [Arthrospira platensis NIES-39]
          Length = 286

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 189/283 (66%), Gaps = 5/283 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +L+DGK  A  +  ++ E +   K + G   GLAV++VG++PAS  YV  K +  +  
Sbjct: 1   MANLLDGKTTAQKIQWQLREIIKSRKPQGGRPPGLAVLMVGDNPASAVYVRNKEKSCERV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S   +FP D SQ +L  A+ +LN+DD + GILVQLPLP  +   S++  I P KD D
Sbjct: 61  GIASFGQHFPADTSQEELTEAIANLNEDDRVDGILVQLPLPDHLDAVSLLYEIAPHKDAD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH +N G++  G+   GL  CTPAG + L+E+++   L+G+ AVV+GRS L GKPM  +
Sbjct: 121 GLHPMNLGRLARGE--KGLRSCTPAGVMRLLEEYQ-IPLAGKRAVVLGRSILVGKPMALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+T+NL  I   ADIL+ AVGRP MV+ ++IK G++VIDVGINR+   
Sbjct: 178 LLEANCTVTVAHSRTENLEAIASEADILIAAVGRPEMVKANYIKPGAVVIDVGINRLEDA 237

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTV 282
             GK+ LVGDV  +  + + G ITPVPGG+GPMT+AML+ NTV
Sbjct: 238 N-GKSRLVGDVDFQAAEPIAGYITPVPGGIGPMTVAMLLQNTV 279


>gi|325569745|ref|ZP_08145769.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Enterococcus casseliflavus ATCC 12755]
 gi|325157050|gb|EGC69216.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Enterococcus casseliflavus ATCC 12755]
          Length = 283

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 188/290 (64%), Gaps = 10/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG+LI+GK +A  +        A LK E GV  GL V+LVG D AS +YV  K   A   
Sbjct: 1   MGTLINGKELAEKMQAAFLSETATLK-EQGVTPGLVVLLVGEDKASQTYVKNKELAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S    +P  I++ +L   +   N DD+ HGILVQLPLP  ++E+ ++ +I PEKDVD
Sbjct: 60  GINSRVARYPESITEAELLAEIEQFNNDDAFHGILVQLPLPKHINEEKVLLAIKPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G      +PCTP G + +   + G +L G++A+VIGRSN+ GKPM  L
Sbjct: 120 GFHPINLGKLFAG--VPDRIPCTPYGIMKMFAAY-GIELEGKNALVIGRSNIVGKPMAHL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHSKTKNLPE+ + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 177 LLGANATVTIAHSKTKNLPELAKQADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVP GVGPMTI MLMA T+ AA  ++
Sbjct: 236 --GK--LIGDVKFDEVEPIASYITPVPRGVGPMTITMLMAQTIEAAKETM 281


>gi|125624490|ref|YP_001032973.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|158705740|sp|A2RLU5|FOLD_LACLM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|158705939|sp|Q030A3|FOLD_LACLS RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|124493298|emb|CAL98267.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Lactococcus
           lactis subsp. cremoris MG1363]
          Length = 285

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 145/292 (49%), Positives = 191/292 (65%), Gaps = 10/292 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +A+ +  ++   V  LK E G   GLAV+LVG DPAS  YV  K R A   G 
Sbjct: 2   NLIDGKALAAKMQAELKVKVDKLK-EAGSVPGLAVILVGEDPASQIYVRNKARQATAIGL 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P  +S+ +L   +   N+ +  HGILVQLPLP  +SE+ ++ +I PEKDVDG 
Sbjct: 61  NSSVVRLPETVSEKELLELIEQYNQSEQWHGILVQLPLPKHISEEKVLLAIDPEKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++  G+    ++P TPAG + +  ++   +LSG+ AVVIGRSN+ GKPM QLL+
Sbjct: 121 HPMNMGRLWAGNPL--MIPSTPAGIMEMFREY-NVELSGKRAVVIGRSNIVGKPMAQLLM 177

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHS+TKNL E+ + ADILVVA+GR RM++ D +K G++VIDVG+NR      
Sbjct: 178 MADATVTIAHSRTKNLRELTKEADILVVAIGRDRMIKADDVKDGAVVIDVGMNRDED--- 234

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
           GK  L GDV  DE K V   ITPVPGGVGPMTI MLM  TV AA R +   S
Sbjct: 235 GK--LHGDVDFDEVKEVASLITPVPGGVGPMTITMLMEQTVRAATRKMNENS 284


>gi|257865767|ref|ZP_05645420.1| methylenetetrahydrofolate dehydrogenase [Enterococcus casseliflavus
           EC30]
 gi|257872102|ref|ZP_05651755.1| methylenetetrahydrofolate dehydrogenase [Enterococcus casseliflavus
           EC10]
 gi|257799701|gb|EEV28753.1| methylenetetrahydrofolate dehydrogenase [Enterococcus casseliflavus
           EC30]
 gi|257806266|gb|EEV35088.1| methylenetetrahydrofolate dehydrogenase [Enterococcus casseliflavus
           EC10]
          Length = 283

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 188/290 (64%), Gaps = 10/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG+LI+GK +A  +        A LK E GV  GL V+LVG D AS +YV  K   A   
Sbjct: 1   MGTLINGKELAEKMQAAFLSEAATLK-EQGVTPGLVVLLVGEDKASQTYVKNKELAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S    +P  I++ +L   +   N DD+ HGILVQLPLP  ++E+ ++ +I PEKDVD
Sbjct: 60  GINSRVARYPESITEAELLAEIEQFNNDDAFHGILVQLPLPKHINEEKVLLAIKPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G      +PCTP G + +   + G +L G++A+VIGRSN+ GKPM  L
Sbjct: 120 GFHPINLGKLFAG--VPDRIPCTPYGIMKMFAAY-GIELEGKNALVIGRSNIVGKPMAHL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHSKTKNLPE+ + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 177 LLGANATVTIAHSKTKNLPELAKQADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVP GVGPMTI MLMA T+ AA  ++
Sbjct: 236 --GK--LIGDVKFDEVEPIASYITPVPRGVGPMTITMLMAQTIEAAKETM 281


>gi|125717526|ref|YP_001034659.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sanguinis SK36]
 gi|158705777|sp|A3CLQ4|FOLD_STRSV RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|125497443|gb|ABN44109.1| Methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase, putative [Streptococcus sanguinis SK36]
 gi|324995297|gb|EGC27209.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK678]
 gi|327461665|gb|EGF07996.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK1]
 gi|327473386|gb|EGF18806.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK408]
 gi|327489518|gb|EGF21311.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK1058]
          Length = 284

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GIELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKNFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVAEIASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|332522473|ref|ZP_08398725.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus porcinus str. Jelinkova
           176]
 gi|332313737|gb|EGJ26722.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus porcinus str. Jelinkova
           176]
          Length = 284

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 193/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +   + +K++E V+ LK+E G+  GL V+LVG++PAS  YV  K + A   
Sbjct: 1   MVTIIDGKALGQKIQNKLSEKVSDLKREYGIVPGLVVILVGDNPASQVYVRNKEKSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I Q +L   +   N+DD+IHGILVQLPLPS ++++ II  I P+KDVD
Sbjct: 61  GFKSETVRLSESICQEELIAIIHQYNQDDTIHGILVQLPLPSHINDKKIILEIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +   + G DL G+HAV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPAGIMEMFSDY-GIDLEGKHAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T++L E  + ADIL+VA+G+   V  ++IK G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTRHLAEFAKQADILIVAIGQGHFVTEEFIKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  D+       ITPVPGGVGPMTI ML+  T  +A RS+
Sbjct: 237 --GK--LIGDVDFDQVSQKASYITPVPGGVGPMTITMLLEQTYQSALRSV 282


>gi|209526714|ref|ZP_03275237.1| Methenyltetrahydrofolate cyclohydrolase [Arthrospira maxima CS-328]
 gi|209492846|gb|EDZ93178.1| Methenyltetrahydrofolate cyclohydrolase [Arthrospira maxima CS-328]
          Length = 286

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 188/283 (66%), Gaps = 5/283 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +L+DGK  A  +  ++ E +  L+ + G   GLAV++VG++PAS  YV  K +  +  
Sbjct: 1   MANLLDGKTTAQKIQSQLREKIKTLEPQRGRPPGLAVLMVGDNPASAVYVRNKEKSCERV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S   +FP D SQ +L+ A+ +LN+DD + GILVQLPLP  +   S++  I P KD D
Sbjct: 61  GIASFGQHFPADTSQEELKEAIANLNEDDRVDGILVQLPLPEHLDAVSLLYEIAPHKDAD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH +N G ++ G+   GL  CTPAG + L+E+++   L+G+ AVV+GRS L GKPM  +
Sbjct: 121 GLHPMNLGGLVRGE--KGLRSCTPAGVMRLLEEYQ-IPLAGKRAVVLGRSILVGKPMALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+T+NL  I   ADIL+ AVGRP MV  + IK G++VIDVGINR+   
Sbjct: 178 LLEANCTVTVAHSRTENLEAIASEADILIAAVGRPEMVGANCIKPGAVVIDVGINRLEDA 237

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
             GK+ LVGDV     + + G ITPVPGG+GPMT+AML+ NTV
Sbjct: 238 N-GKSRLVGDVDFQAAEPIAGYITPVPGGIGPMTVAMLLQNTV 279


>gi|320546344|ref|ZP_08040661.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus equinus ATCC 9812]
 gi|320448998|gb|EFW89724.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus equinus ATCC 9812]
          Length = 284

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +A+ + +++ E V  LK E G+  GL V+LVG+DPAS  YV  K R AK  
Sbjct: 1   MAKLIDGKALAAKMQNQLVEKVEKLKAEAGIVPGLVVILVGDDPASQVYVRNKERSAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S         S+ +L   +   N DD  HGILVQLPLPS ++++ +I +I P+KDVD
Sbjct: 61  GFLSETVRLSESTSEEELIQVIEQYNNDDRFHGILVQLPLPSHINDKRVILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G +  G     +VPCTPAG + L+ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPTNTGHLWNGRPI--MVPCTPAGIMELLAEYD-IELEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHS+T++L  + + AD+L+VA+G+   V  +++K G++VIDVG+NR  + 
Sbjct: 178 LLDKNATVTLAHSRTRDLARVTKQADVLIVAIGQGHFVTKEFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVPGGVGPMTI ML+  T  +A RS+
Sbjct: 237 --GK--LIGDVKFDEVEPLASYITPVPGGVGPMTITMLLEQTYQSALRSV 282


>gi|325697085|gb|EGD38972.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK160]
          Length = 284

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++TG   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKTGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P   SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEATSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSELASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|78222378|ref|YP_384125.1| methenyltetrahydrofolate cyclohydrolase [Geobacter metallireducens
           GS-15]
 gi|119369603|sp|Q39WH4|FOLD2_GEOMG RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|78193633|gb|ABB31400.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Geobacter
           metallireducens GS-15]
          Length = 285

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 191/289 (66%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A+ L  +IA  V  LK E G+  GLA VLVG DPAS  YV  K    +  
Sbjct: 1   MSTIIDGKAIAAKLRAEIATEVKILK-EKGIIPGLATVLVGEDPASEVYVRMKGNACQEL 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HSV++  P   ++ +L   V  LN D +IHGILVQLPLP  ++  +I+++I P KDVD
Sbjct: 60  GMHSVKHTLPATTTEAELLALVARLNSDPTIHGILVQLPLPKQINSDTILEAISPVKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G++M+G  T    PCTP G ++++ +  G DL+G+  VV+GRSN+ GKP+  +
Sbjct: 120 GFHPYNVGRLMVGKPT--FQPCTPYGVMVMLRE-AGVDLAGKEVVVVGRSNIVGKPVALM 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L ++ATVT+ HSKT++LP   + AD+++ AVG P M++ +WIK G++VIDVG+NR+   
Sbjct: 177 CLQQHATVTICHSKTRDLPSKVKEADVVIAAVGVPEMIKGEWIKEGAVVIDVGVNRV--- 233

Query: 241 QLGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             G+  LVGDV     S    AITPVPGGVGPMTI ML+ NT+ AA ++
Sbjct: 234 --GEKKLVGDVEFAAASQRASAITPVPGGVGPMTITMLLYNTLEAAKKT 280


>gi|56416494|ref|YP_153568.1| methylenetetrahydrofolate dehydrogenase [Anaplasma marginale str.
           St. Maries]
 gi|222474863|ref|YP_002563278.1| methylenetetrahydrofolate dehydrogenase (folD) [Anaplasma marginale
           str. Florida]
 gi|254994718|ref|ZP_05276908.1| methylenetetrahydrofolate dehydrogenase (folD) [Anaplasma marginale
           str. Mississippi]
 gi|255002832|ref|ZP_05277796.1| methylenetetrahydrofolate dehydrogenase (folD) [Anaplasma marginale
           str. Puerto Rico]
 gi|81359278|sp|Q5PBL6|FOLD_ANAMM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|56387726|gb|AAV86313.1| methylenetetrahydrofolate dehydrogenase [Anaplasma marginale str.
           St. Maries]
 gi|222418999|gb|ACM49022.1| methylenetetrahydrofolate dehydrogenase (folD) [Anaplasma marginale
           str. Florida]
          Length = 299

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 142/292 (48%), Positives = 189/292 (64%), Gaps = 5/292 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK+VA  L D++  SV  LK E G+   L VV+VG+DPAS  YV  K R A+  
Sbjct: 1   MREIIDGKLVARGLLDRLRVSVDRLKAEHGIVPHLVVVIVGDDPASKLYVGNKQRKAEEL 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S       D SQ +L   +  LN+D ++HGILVQLPLP  + ++ +I +I PEKDVD
Sbjct: 61  GLQSRTIALEHDTSQEELLRIIDELNRDAAVHGILVQLPLPRHIDKELVINAISPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  NAGK+  G     ++PCTP G I LI+  K  DL+G +AVV+GRSN+ GKP+  L
Sbjct: 121 GFHNANAGKLATGQLDC-MIPCTPQGCIHLIKTVKQ-DLAGSNAVVVGRSNIVGKPVALL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS ++NL E C  ADI+V AVG+ R ++  WIK G++V+DVGIN +   
Sbjct: 179 LLYENCTVTVLHSASRNLEEHCLRADIIVAAVGKARFIRASWIKPGAIVVDVGINLVE-- 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + GK   VGDV  E  + V  ++TPVPGGVGPMTIA L+ NTV+ + +  G+
Sbjct: 237 ESGKKRFVGDVEFEGLQDVPCSVTPVPGGVGPMTIAFLLVNTVLGSCKQCGV 288


>gi|325694106|gb|EGD36024.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus sanguinis SK150]
          Length = 284

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDG+ +A  L  K+AE  A LK++ G   GL V++VGN+PAS  YV  K R A   
Sbjct: 1   MAQIIDGRGLAEKLQKKLAEKTARLKEKKGQVPGLVVIVVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P + SQ +L + + + N++   HGILVQLPLP  + +++++ +I P+KDVD
Sbjct: 61  GFRSKVERLPEETSQEELLSLIETYNQNPDWHGILVQLPLPEHIDDEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGKLWSGHPV--MIPATPAGIMAMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL +  + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKTAKRADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVPGGVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSELASLITPVPGGVGPMTITMLMEQTYQAFKRSL 282


>gi|168025781|ref|XP_001765412.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683465|gb|EDQ69875.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 307

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 188/294 (63%), Gaps = 3/294 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G++IDGK +A  +  +IA  VA LK+  G   GLAVVLVG    S +YV +K +  +  G
Sbjct: 14  GAVIDGKSIAGQIRKEIAAEVANLKETVGKVPGLAVVLVGTRKDSETYVRSKKKACEEVG 73

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
           F S     P D +Q ++ N V   N D  +HGILVQLPLP  ++E++++ ++  EKDVDG
Sbjct: 74  FASFGVTLPEDATQEEIVNCVNQFNDDPEVHGILVQLPLPKHINEEAVVGAVSFEKDVDG 133

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H +N G + +       VPCTP G I L+ +  G +L G+ AVVIGRSN+ G P  QLL
Sbjct: 134 FHPINVGTLCMQGRKPLFVPCTPKGCIELLLR-SGVELKGKRAVVIGRSNIVGTPAAQLL 192

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
             +NATVT+ HS T N  EI R ADI+V A+G+   V+ DW+K G++VIDVGIN ++ P 
Sbjct: 193 QRQNATVTVVHSATTNPAEIVREADIVVAALGKAEFVRGDWLKPGAVVIDVGINAVDDPS 252

Query: 242 LGKTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
             K   LVGDV   E   V   ITPVPGGVGPMTIAML+ANT+ AA RS G+++
Sbjct: 253 TKKGYRLVGDVCYKEASQVASMITPVPGGVGPMTIAMLLANTLDAAKRSFGVEN 306


>gi|225868947|ref|YP_002744895.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus equi subsp. zooepidemicus]
 gi|259647305|sp|C0MD36|FOLD_STRS7 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|225702223|emb|CAW99962.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus equi subsp. zooepidemicus]
          Length = 284

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 139/291 (47%), Positives = 189/291 (64%), Gaps = 11/291 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  +   +A+ V  LK E G+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MVQIIDGKALAQKMQAALAKKVESLKAEKGIVPGLVVILVGDNPASQVYVRNKERAALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        + Q +L   +   N+DD+IHGILVQLPLP  ++++SII +I P+KDVD
Sbjct: 61  GFKSETVRLSDSVCQEELIELIEQYNQDDTIHGILVQLPLPHHINDKSIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +   + G +L G++AV++GRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPNMVPCTPAGIMEMFHDY-GIELEGKNAVIVGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINR-INS 239
           LL +NATVT+ HS+T+ L  ICR ADIL+VA+G+   +  D++K G++VIDVG+NR +N 
Sbjct: 178 LLDKNATVTLTHSRTRQLAAICRRADILIVAIGQGHFITKDFVKEGAVVIDVGMNRDVNG 237

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
                  L+GDVA DE   +   ITPVPGGVGPMTI ML+  T  AA R +
Sbjct: 238 R------LIGDVAFDEVSELASMITPVPGGVGPMTITMLLEQTYQAALRRV 282


>gi|88657832|ref|YP_507145.1| FolD bifunctional protein [Ehrlichia chaffeensis str. Arkansas]
 gi|119369791|sp|Q2GHD8|FOLD_EHRCR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|88599289|gb|ABD44758.1| FolD bifunctional protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 300

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 144/292 (49%), Positives = 183/292 (62%), Gaps = 4/292 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++I+GKV+A  +T  +A  +  LK +  V   L V+LVG+DPAS  YV  K R A+  G 
Sbjct: 4   NIINGKVIAEDITSTLAVCINDLKVQHNVTPCLIVILVGDDPASHLYVRNKQRKAEMLGL 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S     P   S+  L + +  LN DDS+HGILVQLP+P  + +  II +I P KDVDG 
Sbjct: 64  RSETMLLPSTTSESSLIDTIRRLNNDDSVHGILVQLPVPKHIDKNLIINTIDPRKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N G++  G     L+PCTP G + LI+     +LSG  AVVIGRSN+ GKPM  LLL
Sbjct: 124 HNENVGRLFTGQKKDCLIPCTPRGCLYLIKTVTR-NLSGSDAVVIGRSNIVGKPMACLLL 182

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TVT  HS T+NLP+ C  AD+LV AVG P  V+  WIK G++VIDVGIN I    +
Sbjct: 183 GENCTVTTVHSATRNLPDYCSKADVLVAAVGIPHFVKSSWIKPGAIVIDVGINAIEEGGV 242

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
            K   VGDV   E +++  AITPVPGGVGPMTIA LM NTVIAA    G+++
Sbjct: 243 KK--FVGDVDFSEARNIASAITPVPGGVGPMTIAFLMVNTVIAACNQAGIEN 292


>gi|291542568|emb|CBL15678.1| methenyltetrahydrofolate cyclohydrolase
           /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Ruminococcus bromii L2-63]
          Length = 283

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 188/282 (66%), Gaps = 7/282 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK V++ +  ++      LK+   +  GLAVV+VG+DPAS  YV+ K +  +  GF
Sbjct: 2   QIIDGKKVSAQVKKEVKRQTLELKETHKITPGLAVVIVGDDPASRVYVNNKKKACEFVGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S +Y  P + +Q +L N V +LN    I+GILVQLPLP  + ++++I++I P KDVD  
Sbjct: 62  KSEEYALPAETTQEELLNLVETLNNKKDINGILVQLPLPKHLDDKAVIEAISPLKDVDAF 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN GK+M+G++    +PCTPAG + ++  +   +++G++ VVIGRSN+ GKPM  LLL
Sbjct: 122 HAVNVGKIMLGEYD--FLPCTPAGVMEMLHSY-NIEVNGKNCVVIGRSNIVGKPMAMLLL 178

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TVT+ HS+TKNL EIC  ADILV AVGRP+ V  D +K G++VIDVG++R  + +L
Sbjct: 179 HENGTVTICHSRTKNLAEICSQADILVAAVGRPKFVTADMVKEGAVVIDVGMDRDENGKL 238

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
              V   +V D+C      ITPVPGGVGPMTI+ LM NT+ A
Sbjct: 239 CGDVDFENVKDKC----SFITPVPGGVGPMTISTLMKNTLKA 276


>gi|269959093|ref|YP_003328882.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Anaplasma centrale str. Israel]
 gi|269848924|gb|ACZ49568.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Anaplasma centrale str. Israel]
          Length = 299

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 143/292 (48%), Positives = 188/292 (64%), Gaps = 5/292 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK+VA  L D++  SV  LK E G+   L VV+VG+DPAS  YV  K R A+  
Sbjct: 1   MREIIDGKLVARGLLDRLRVSVDRLKAEHGIVPHLVVVIVGDDPASKLYVGNKQRKAEEL 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S       D SQ +L   +  LN+D ++HGILVQLPLP  + ++ +I +I PEKDVD
Sbjct: 61  GLQSRTIALEHDTSQEELLRIIDELNRDAAVHGILVQLPLPRHIDKELVINAISPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  NAGK+  G     ++PCTP G I LI+  K  DL+G +AVV+GRSN+ GKP+  L
Sbjct: 121 GFHNANAGKLATGQLDC-MIPCTPQGCIHLIKTVKQ-DLAGSNAVVVGRSNIVGKPVALL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS ++NL E C  ADI+V AVG+ R ++  WIK G+ V+DVGIN +   
Sbjct: 179 LLHENCTVTVLHSASRNLEEHCLRADIIVAAVGKARFIKASWIKPGATVVDVGINLVE-- 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           + GK   VGDV  E  + V  ++TPVPGGVGPMTIA L+ NTV+ A +  G+
Sbjct: 237 ESGKKRFVGDVEFEGLQDVPCSVTPVPGGVGPMTIAFLLVNTVLGACKQCGV 288


>gi|195977750|ref|YP_002122994.1| FolD bifunctional protein [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|226704405|sp|B4U1W4|FOLD_STREM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|195974455|gb|ACG61981.1| FolD bifunctional protein [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 284

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 139/291 (47%), Positives = 189/291 (64%), Gaps = 11/291 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  +   +A+ V  LK E G+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MVQIIDGKALAQKMQAALAKKVESLKAEKGIVPGLVVILVGDNPASQVYVRNKERAALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        + Q +L   +   N+DD+IHGILVQLPLP  ++++SII +I P+KDVD
Sbjct: 61  GFKSETVRLSDSVCQEELIELIEQYNQDDTIHGILVQLPLPHHINDKSIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +   + G +L G++AV++GRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPNMVPCTPAGIMEMFRDY-GIELEGKNAVIVGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINR-INS 239
           LL +NATVT+ HS+T+ L  ICR ADIL+VA+G+   +  D++K G++VIDVG+NR +N 
Sbjct: 178 LLDKNATVTLTHSRTRQLAAICRRADILIVAIGQGHFITKDFVKEGAVVIDVGMNRDVNG 237

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
                  L+GDVA DE   +   ITPVPGGVGPMTI ML+  T  AA R +
Sbjct: 238 R------LIGDVAFDEVSELASMITPVPGGVGPMTITMLLEQTYQAALRRV 282


>gi|183603436|ref|ZP_02717123.2| bifunctional protein FolD [Streptococcus pneumoniae CDC3059-06]
 gi|221231614|ref|YP_002510766.1| FolD bifunctional protein [Streptococcus pneumoniae ATCC 700669]
 gi|225854332|ref|YP_002735844.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae JJA]
 gi|183576863|gb|EDT97391.1| bifunctional protein FolD [Streptococcus pneumoniae CDC3059-06]
 gi|220674074|emb|CAR68589.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus pneumoniae ATCC 700669]
 gi|225722597|gb|ACO18450.1| bifunctional protein FolD [Streptococcus pneumoniae JJA]
          Length = 292

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASYITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|116511675|ref|YP_808891.1| methenyltetrahydrofolate cyclohydrolase [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107329|gb|ABJ72469.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Lactococcus
           lactis subsp. cremoris SK11]
 gi|300071279|gb|ADJ60679.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 295

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 145/292 (49%), Positives = 192/292 (65%), Gaps = 10/292 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +A+ +  ++   V  LK E G   GLAV+LVG DPAS  YV  K R A   G 
Sbjct: 12  NLIDGKALAAKMQAELKVKVDKLK-EAGSVPGLAVILVGEDPASQIYVRNKARQATAIGL 70

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P  +S+ +L   +   N+ +  HGILVQLPLP  +SE+ ++ +I PEKDVDG 
Sbjct: 71  NSSVVRLPETVSEKELLELIEQYNQSEQWHGILVQLPLPKHISEEKVLLAIDPEKDVDGF 130

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++  G+    ++P TPAG + +  ++   +LSG+ AVVIGRSN+ GKPM QLL+
Sbjct: 131 HPMNMGRLWAGNPL--MIPSTPAGIMEMFREY-NVELSGKRAVVIGRSNIVGKPMAQLLM 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHS+TKNL E+ + ADILVVA+GR RM++ D +K G++VIDVG+NR    + 
Sbjct: 188 MADATVTIAHSRTKNLRELTKEADILVVAIGRDRMIKADDVKDGAVVIDVGMNR---DED 244

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
           GK  L GDV  DE K V   ITPVPGGVGPMTI MLM  TV AA R +   S
Sbjct: 245 GK--LHGDVDFDEVKEVASLITPVPGGVGPMTITMLMEQTVRAATRKMNENS 294


>gi|298503169|ref|YP_003725109.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae TCH8431/19A]
 gi|298238764|gb|ADI69895.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae TCH8431/19A]
          Length = 306

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 22  MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 81

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 82  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 141

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 142 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 198

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 199 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 257

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 258 --GK--LCGDVDYEAVAPLASYITPVPGGVGPMTITMLMEQTYQAALRTLDRK 306


>gi|183603295|ref|ZP_02713996.2| bifunctional protein FolD [Streptococcus pneumoniae SP195]
 gi|183571775|gb|EDT92303.1| bifunctional protein FolD [Streptococcus pneumoniae SP195]
          Length = 292

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 194/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 8   MTQIIDGKALAVKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 68  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 128 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 184

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 185 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 243

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 244 --GK--LCGDVDYEAVAPLASYITPVPGGVGPMTITMLMEQTYQAALRTLDRK 292


>gi|167770672|ref|ZP_02442725.1| hypothetical protein ANACOL_02018 [Anaerotruncus colihominis DSM
           17241]
 gi|167667267|gb|EDS11397.1| hypothetical protein ANACOL_02018 [Anaerotruncus colihominis DSM
           17241]
          Length = 280

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 188/283 (66%), Gaps = 10/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK +++ L  ++ + VA L  E G+  GLAVV+VG+DPAS  YV  K +  +  G +
Sbjct: 5   LIDGKTISAELRAQMKKEVAALA-EDGITPGLAVVIVGDDPASKVYVRNKKKACEELGIY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S +Y  P + +Q +L   +  LN    I GILVQLPLP  + E+++I++I P+KDVD   
Sbjct: 64  SEEYALPAETTQDELLALIRKLNTKPDIDGILVQLPLPKQLDEKAVIEAISPDKDVDAFS 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N GK+MIGD+   L+PCTPAG + LI    G ++ G+  VVIGRSN+ GKPM  LLL 
Sbjct: 124 AANVGKIMIGDYK--LLPCTPAGIMELI-HASGVEVKGKECVVIGRSNIVGKPMAMLLLH 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+ HS+T++L E+ R ADIL+VA+G+ + V  D +K G++VIDVG+NR  +   G
Sbjct: 181 EHGTVTICHSRTRDLSEVTRRADILIVAIGKAKFVTADMVKPGAVVIDVGMNRDEN---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           K  L GDV  D    V GAITPVPGGVGPMTI MLM NT+ AA
Sbjct: 238 K--LCGDVDFDSVSEVAGAITPVPGGVGPMTITMLMKNTITAA 278


>gi|149007233|ref|ZP_01830897.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP18-BS74]
 gi|298230610|ref|ZP_06964291.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254379|ref|ZP_06977965.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|147761271|gb|EDK68238.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP18-BS74]
          Length = 285

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 195/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIELEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASYITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|148992492|ref|ZP_01822187.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP9-BS68]
 gi|147928809|gb|EDK79822.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus pneumoniae SP9-BS68]
 gi|332073153|gb|EGI83632.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Streptococcus pneumoniae GA17570]
          Length = 285

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 143/293 (48%), Positives = 194/293 (66%), Gaps = 9/293 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  L  ++AE  A LK+ET +  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MTQIIDGKALAVKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  I+Q +L + +   N+D + HGILVQLPLP  + E++++ +I PEKDVD
Sbjct: 61  GSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G DL G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GIDLEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T NL ++   ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             GK  L GDV  E  + + + ITPVPGGVGPMTI MLM  T  AA R+L  K
Sbjct: 237 --GK--LCGDVDYEAVAPLASYITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285


>gi|154502751|ref|ZP_02039811.1| hypothetical protein RUMGNA_00565 [Ruminococcus gnavus ATCC 29149]
 gi|153796634|gb|EDN79054.1| hypothetical protein RUMGNA_00565 [Ruminococcus gnavus ATCC 29149]
          Length = 279

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  + DK+ E V+ LK E G ++ LAV+ VG D AS  YV+ K +   + 
Sbjct: 1   MAQIIDGKRIAKEIKDKLKEEVSVLK-ERGTKICLAVIQVGQDAASSVYVNNKKKACAYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV Y      ++ +L   +  LN  + +HGILVQLPLP+ + E  II++I P+KDVD
Sbjct: 60  GIDSVSYELKEATTEAELVELIEKLNHTEKVHGILVQLPLPAHIDEDRIIRTISPDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G++ +G+  TG V CTPAG I L+ ++ G +++G+  VVIGRSN+ GKPM  L
Sbjct: 120 GFHPVNVGRLWLGE--TGFVSCTPAGIIQLL-KYSGIEIAGKECVVIGRSNIVGKPMAAL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+T +L E+ R ADIL+ AVG+ +M+  ++IK G++VIDVG++R    
Sbjct: 177 LLRENGTVTVAHSRTADLKEVTRRADILIAAVGQTKMITAEYIKEGAVVIDVGMHRD--- 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
              +  L GDV  ++  S   AITPVPGGVGPMTIAMLM N V AA
Sbjct: 234 --AQNHLCGDVDFEDVYSRASAITPVPGGVGPMTIAMLMNNCVQAA 277


>gi|261206504|ref|ZP_05921204.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium TC 6]
 gi|289565414|ref|ZP_06445863.1| bifunctional protein folD [Enterococcus faecium D344SRF]
 gi|294614728|ref|ZP_06694630.1| bifunctional protein FolD [Enterococcus faecium E1636]
 gi|294618976|ref|ZP_06698471.1| bifunctional protein FolD [Enterococcus faecium E1679]
 gi|260079214|gb|EEW66905.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium TC 6]
 gi|289162743|gb|EFD10594.1| bifunctional protein folD [Enterococcus faecium D344SRF]
 gi|291592466|gb|EFF24073.1| bifunctional protein FolD [Enterococcus faecium E1636]
 gi|291594637|gb|EFF26019.1| bifunctional protein FolD [Enterococcus faecium E1679]
          Length = 284

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 191/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LI+GK +A  +  +IAE +  LK + G+  GL V+LVG +PAS  YV  K R+AK  
Sbjct: 1   MAELINGKELAEKMQAEIAEKIQKLK-DNGIHPGLVVLLVGENPASQIYVRNKERVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS+   +P  IS+ +L   +   N+D S HGILVQLPLP  + E+ I+ +I PEKDVD
Sbjct: 60  GIHSLVERYPETISEDELLAEIEKYNQDPSFHGILVQLPLPKHIDEEKILLAIRPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G+++ G      +PCTP G + + E +   + +G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLLAG--KPDKIPCTPYGIMKMFEAY-SINPAGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+AHSKT+NL E+ + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 177 LLMADATVTVAHSKTENLAELAQEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L+GDV  DE + + G ITPVP GVGPMTI MLM  TV +A
Sbjct: 236 --GK--LIGDVKFDEVEPIAGWITPVPKGVGPMTITMLMYQTVKSA 277


>gi|225870045|ref|YP_002745992.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus equi subsp. equi 4047]
 gi|254789421|sp|C0M7V0|FOLD_STRE4 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|225699449|emb|CAW92951.1| FolD bifunctional protein [includes: methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase]
           [Streptococcus equi subsp. equi 4047]
          Length = 284

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 190/291 (65%), Gaps = 11/291 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  +   +A+ V  LK E G+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MVQIIDGKALAQKMQAALAKKVESLKAEKGIVPGLVVILVGDNPASQVYVRNKERAALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        + Q +L   +   N+DD+IHGILVQLPLP  ++++SII +I P+KDVD
Sbjct: 61  GFKSETVRLSDSVCQEELIELIEQYNQDDTIHGILVQLPLPHHINDKSIILAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +   + G +L G++AV++GRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPNMVPCTPAGIMEMFHDY-GIELEGKNAVIVGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINR-INS 239
           LL +NATVT+ HS+T+ L +ICR ADIL+VA+G+   +  +++K G++VIDVG+NR +N 
Sbjct: 178 LLDKNATVTLTHSRTRRLADICRRADILIVAIGQGHFITKEFVKEGAVVIDVGMNRDVNG 237

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
                  L+GDVA DE   +   ITPVPGGVGPMTI ML+  T  AA R +
Sbjct: 238 R------LIGDVAFDEVSELASMITPVPGGVGPMTITMLLEQTYQAALRRV 282


>gi|313633360|gb|EFS00203.1| bifunctional protein FolD [Listeria seeligeri FSL N1-067]
          Length = 284

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 192/291 (65%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  +  K+   VA L K  G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGQIIDGKKLAKEIQGKVTTEVAELAK-NGKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +S+  L   V  LN D++IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLMELPETVSEEKLLEVVEKLNIDETIHGILVQLPLPKHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG  +   VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIGKDS--FVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LPE+ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPEVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V      D+   V G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDV----DFDDVVDVAGFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|302383241|ref|YP_003819064.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193869|gb|ADL01441.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 290

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/278 (49%), Positives = 187/278 (67%), Gaps = 6/278 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DG+ +A+ +T ++AE VA L  + G+  GLAVVLVG D AS  YV  K    +  G  
Sbjct: 7   ILDGRAIAAEVTTRVAEDVAGLIAD-GITPGLAVVLVGEDAASLVYVGRKVAETRRVGMR 65

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  PV+ +Q  L + V  LN D ++HGILVQLPLPS +   +++ +I P KDVDG H
Sbjct: 66  SIEHRLPVETTQAALLDLVADLNADPAVHGILVQLPLPSQIDAAAVLDAIDPAKDVDGFH 125

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++  G    GL+PCTP G ++L+E+    D  G +AVVIG+SN+ GKP+  LLL 
Sbjct: 126 PVNVGRLSTGG---GLIPCTPLGCMMLLERVID-DFRGLNAVVIGKSNIVGKPVALLLLE 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           R  TVT+ H  T+ LPEI R ADILVVA G P +V+ DW+K G++VIDVGINR+     G
Sbjct: 182 RECTVTVTHILTRGLPEIARRADILVVAAGSPGLVRGDWVKPGAIVIDVGINRVQGDD-G 240

Query: 244 KTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANT 281
           K+ LVGDVA +  +    +TPVPGGVGPMTIA L++NT
Sbjct: 241 KSRLVGDVAADEVAHAAWLTPVPGGVGPMTIACLLSNT 278


>gi|257899152|ref|ZP_05678805.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           Com15]
 gi|257837064|gb|EEV62138.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           Com15]
          Length = 284

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LI+GK +A  +   IAE +  LK + G+  GL V+LVG +PAS +YV  K R+AK  
Sbjct: 1   MAELINGKELAEKMQADIAEKIQKLK-DNGIHPGLVVLLVGENPASQTYVRNKERVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS    +P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I PEKDVD
Sbjct: 60  GIHSSVERYPETISENELLAEIEKYNQDPRFHGILVQLPLPKHIDEEKILLAIRPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G+++ G      +PCTP G + + E +   D +G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLLAG--KPDKIPCTPYGIMKIFEAY-SIDPAGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+AHSKT+NL E+ + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 177 LLMADATVTVAHSKTENLAELAQEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L+GDV  DE + + G ITPVP GVGPMTI MLM  TV +A
Sbjct: 236 --GK--LIGDVKFDEVEPIAGWITPVPKGVGPMTITMLMYQTVKSA 277


>gi|319938726|ref|ZP_08013090.1| methenyltetrahydrofolate cyclohydrolase [Streptococcus anginosus
           1_2_62CV]
 gi|319811776|gb|EFW08042.1| methenyltetrahydrofolate cyclohydrolase [Streptococcus anginosus
           1_2_62CV]
          Length = 284

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/290 (48%), Positives = 187/290 (64%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  L  ++AE V  LK +TG+  GL V+LVGN+PAS  YV  K R A   
Sbjct: 1   MAKIIDGKALAEKLQAQLAEKVRKLKDQTGLVPGLVVILVGNNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P   SQ +L   +   N+D + HGILVQLPLP  + E++++ +I P+KDVD
Sbjct: 61  GLRSEVVRLPETTSQEELLALIDQYNQDSAWHGILVQLPLPKHIDEEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPMNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L EI + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLSEITKKADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE       ITPVP GVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSETASLITPVPRGVGPMTITMLMEQTYRACKRSL 282


>gi|227550443|ref|ZP_03980492.1| Methenyltetrahydrofolate cyclohydrolase [Enterococcus faecium
           TX1330]
 gi|257888471|ref|ZP_05668124.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,141,733]
 gi|257897154|ref|ZP_05676807.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           Com12]
 gi|227180344|gb|EEI61316.1| Methenyltetrahydrofolate cyclohydrolase [Enterococcus faecium
           TX1330]
 gi|257824525|gb|EEV51457.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           1,141,733]
 gi|257833719|gb|EEV60140.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecium
           Com12]
          Length = 284

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 143/286 (50%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LI+GK +A  +  +IAE +  LK + G+  GL V+LVG +PAS  YV  K R+AK  
Sbjct: 1   MAELINGKELAEKMQAEIAEKIQKLK-DNGIHPGLVVLLVGENPASQIYVRNKERVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS    +P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I PEKDVD
Sbjct: 60  GIHSSVERYPETISEDELLAEIEKYNQDPRFHGILVQLPLPKHIDEEKILLAIRPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G+++ G      +PCTP G + + E +   D +G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLLAG--KPDKIPCTPYGIMKMFEAY-SIDPTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+AHSKT+NL E+ + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 177 LLMADATVTVAHSKTENLAELAQEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L+GDV  DE + V G ITPVP GVGPMTI MLM  TV +A
Sbjct: 236 --GK--LIGDVKFDEVEPVAGWITPVPKGVGPMTITMLMYQTVKSA 277


>gi|328956983|ref|YP_004374369.1| methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate
           cyclohydrolase [Carnobacterium sp. 17-4]
 gi|328673307|gb|AEB29353.1| methylenetetrahydrofolate dehydrogenase; methenyltetrahydrofolate
           cyclohydrolase [Carnobacterium sp. 17-4]
          Length = 292

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 193/286 (67%), Gaps = 10/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +++ GK +A  +T ++   V  LK E G+  GL V+LVG DPAS +YV  K + AK  GF
Sbjct: 8   TIMSGKTLADEMTIEMQNDVNQLK-EKGITPGLVVLLVGEDPASQTYVRNKEKRAKALGF 66

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HS+   +P DI++ +L N V   N+D + HGILVQLPLP  +    ++ +I   KDVDG 
Sbjct: 67  HSLVKRYPADITEEELLNEVNHYNEDPAFHGILVQLPLPKQIDSDKVVNAIDSIKDVDGF 126

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N GK++IG      +PCTP G + L+E+++  ++ G+ AV+IGRSN+ GKPM QLL+
Sbjct: 127 HPINMGKLLIG--KPDKIPCTPYGIMKLLERYQ-VEIDGKTAVMIGRSNIVGKPMAQLLM 183

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            +NATVT+AHS+TK+L  + RTADILVVA+GR   V  ++IK G+ VIDVG+NR  +   
Sbjct: 184 MKNATVTIAHSRTKDLAALARTADILVVAIGRGHFVTKEFIKPGAAVIDVGMNRDKN--- 240

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK  L+GDV +DE   V G +TPVP GVGPMTI ML+  T+ +A +
Sbjct: 241 GK--LIGDVKSDEVAEVAGYLTPVPKGVGPMTITMLLYQTIESAKK 284


>gi|260881523|ref|ZP_05404625.2| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Mitsuokella multacida DSM 20544]
 gi|260848668|gb|EEX68675.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Mitsuokella multacida DSM 20544]
          Length = 287

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 144/289 (49%), Positives = 186/289 (64%), Gaps = 11/289 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +++GKV A    +   +  A L+++ GVQ GLAV++VG++PAS  YV  K +  +  G +
Sbjct: 5   ILEGKVFAQAFREDAQKKAAALREQYGVQPGLAVIIVGSNPASQVYVRNKHKSCEALGIY 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVS--EQSIIQSIVPEKDVDG 121
           S     P   ++ +L   + +LN D  IHGILVQLPLP  ++  E  I++ I PEKDVDG
Sbjct: 65  SEVIEMPETTTKDELIAKIDALNADSKIHGILVQLPLPEQIAAHESEILERIRPEKDVDG 124

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN G+++ G    GLVPCTP G + ++E   G  + GQ AV+IGRSN+ GKPM  LL
Sbjct: 125 FHPVNVGRLVTGQ--PGLVPCTPFGCLRMLE-LAGIPIDGQRAVIIGRSNIVGKPMLHLL 181

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L +NATVT+ HS TK+LP + R ADILV AVGRP  V  D +K G+ VIDVGINRI   +
Sbjct: 182 LGKNATVTICHSHTKDLPAVTREADILVAAVGRPNFVTADMVKPGATVIDVGINRIAPKK 241

Query: 242 LGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
                LVGDV  E  K V GAITPVPGGVG +T+AMLM N V AA   L
Sbjct: 242 -----LVGDVDFEAVKDVAGAITPVPGGVGLLTVAMLMENVVRAAEMQL 285


>gi|162147100|ref|YP_001601561.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544161|ref|YP_002276390.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|190359427|sp|A9HEL1|FOLD_GLUDA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|161785677|emb|CAP55248.1| putative FolD bifunctional protein [Includes:
           Methylenetetrahydrofolat dehydrogenase (EC 1.5.1.5);
           Methenyltetrahydrofolate cyclohydrolas (EC 3.5.4.9)]
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531838|gb|ACI51775.1| Methenyltetrahydrofolate cyclohydrolase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 311

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 183/288 (63%), Gaps = 5/288 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ LT  IA  V        V  GLAVVLVGNDPAS  YV  K       G  
Sbjct: 23  LIDGKAFAANLTQTIARDVQSFHDRYRVTPGLAVVLVGNDPASEVYVRNKALQTHRAGMR 82

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P   SQ +L   +  LN D  IHGILVQLPLP+ +   ++  +I+P+KDVDGL 
Sbjct: 83  SFMHMLPATTSQAELLALIGRLNADPEIHGILVQLPLPAGLDPVAVTNAILPDKDVDGLG 142

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VNAG++ +G    G+VPCTP G ++L++   G DL G HAV+IG SNL G+PM +LLL+
Sbjct: 143 EVNAGRLALGQ--PGIVPCTPLGCLMLLKSELG-DLRGLHAVIIGASNLVGRPMARLLLA 199

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
              TVT+ H  T++   + R  DILVVA G   +V+ DWIK G+ VIDVGI RI+ P  G
Sbjct: 200 EGCTVTVGHIDTRDPAALARQGDILVVATGCHGLVRGDWIKPGAAVIDVGITRISLPS-G 258

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           KT LVGDVA DE  +  G ITPVPGGVGPMTIA L+ NT+ AA R +G
Sbjct: 259 KTRLVGDVAFDEAVTRAGCITPVPGGVGPMTIACLLNNTLAAARRIVG 306


>gi|87162643|gb|ABD28438.1| Tetrahydrofolate dehydrogenase/cyclohydrolase [Medicago truncatula]
          Length = 351

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 191/286 (66%), Gaps = 3/286 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA  + D+IA  V+ +++  GV  GLAV+LVG+   S +YV  K +  +  G +
Sbjct: 62  VIDGKTVAKQIRDEIAVEVSRMREAAGVIPGLAVILVGDRKDSATYVRNKKKACETVGIN 121

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S++ N P D ++ ++ N +   N D S+HGILVQLPLPS ++EQ+++ ++  EKDVDG H
Sbjct: 122 SLEVNLPEDSTEEEVLNHIAGYNDDPSVHGILVQLPLPSHMNEQNVLNAVRIEKDVDGFH 181

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G I L+ ++ G  + G+ AVVIGRSN+ G P   LL  
Sbjct: 182 PLNIGRLAMRGREPLFVPCTPKGCIELLHRY-GVSIKGKRAVVIGRSNIVGMPAALLLQR 240

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATV++ HS+T N  EI R ADI++ AVG+P MV+  WIK G+++IDVGIN ++ P   
Sbjct: 241 EDATVSIVHSRTTNPEEIIRQADIIIAAVGQPNMVKGSWIKPGAVIIDVGINPVDDPSSS 300

Query: 244 KTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +   LVGDV  +E   V  AITPVPGGVGPMTIAML+ NT+I+A R
Sbjct: 301 RGYKLVGDVCYEEAVKVASAITPVPGGVGPMTIAMLLQNTLISAKR 346


>gi|163790199|ref|ZP_02184632.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Carnobacterium sp. AT7]
 gi|159874474|gb|EDP68545.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Carnobacterium sp. AT7]
          Length = 287

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 139/287 (48%), Positives = 192/287 (66%), Gaps = 10/287 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            +++ GK++A  +T ++  +V  LK E G+  GL V+LVG DPAS +YV  K + A   G
Sbjct: 3   ATIMSGKLLADEMTVEMQNNVNKLK-EKGITPGLVVLLVGEDPASQTYVKNKEKRALALG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
           FHS+   +P DI++  L N V   N+D   HGILVQLPLP  +    I+ +I  EKDVDG
Sbjct: 62  FHSLIKRYPADITEKQLLNEVKQYNEDPLFHGILVQLPLPKHIDSDKIVNAIDSEKDVDG 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN GK+ IG      +PCTP G + ++E+++  ++ G+ AVVIGRSN+ GKP+ QLL
Sbjct: 122 FHPVNMGKLFIG--KPDKIPCTPYGIMKMLERYE-VEIEGKTAVVIGRSNIVGKPIAQLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           + +NATVTMAHS+TK+L  + RTADILVVA+G+   V  ++IK G+ VIDVG+NR  +  
Sbjct: 179 MMKNATVTMAHSRTKDLAAVARTADILVVAIGKGHFVTKEFIKPGAAVIDVGMNRDEN-- 236

Query: 242 LGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
            GK  L+GDV +DE   V G +TPVP GVGPMTI ML+  T+ +A +
Sbjct: 237 -GK--LIGDVKSDEVAEVAGYLTPVPKGVGPMTITMLLYQTIESANK 280


>gi|257459666|ref|ZP_05624775.1| bifunctional protein FolD [Campylobacter gracilis RM3268]
 gi|257443091|gb|EEV18225.1| bifunctional protein FolD [Campylobacter gracilis RM3268]
          Length = 285

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 192/291 (65%), Gaps = 7/291 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +++ + D+I  + + L  + GV+  LAV+LVG D AS +YV++K +    CG 
Sbjct: 2   TLIDGKSISAKVKDEIKAAASDLAAK-GVEPALAVILVGEDAASKTYVASKEKACATCGI 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV +    D+S+  L   + +LN D+SI GILVQLPLP  +    I++ I P+KDVDG 
Sbjct: 61  RSVAHRLSSDVSEAALLELIENLNDDESIDGILVQLPLPKHIDTNKILEKISPQKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
             +N GK+  G  + G VPCTP G + L+E++ G  ++G++AVV+GRSN+ GKPM  LLL
Sbjct: 121 SAINVGKLTSG-LSDGFVPCTPLGVMRLLEEY-GVQIAGKNAVVLGRSNIVGKPMASLLL 178

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + +ATVT+AHSKTK+L  +C  ADILV AVGR   V  D +K G++VIDVGINR    +L
Sbjct: 179 NADATVTIAHSKTKDLKRLCADADILVAAVGRAHFVGADMVKQGAVVIDVGINRGGDGKL 238

Query: 243 GKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
              V    VA +C      ITPVPGGVGPMTIAML++NT+ +A   L  ++
Sbjct: 239 RGDVDFDAVAPKCSF----ITPVPGGVGPMTIAMLLSNTIKSAKNRLRQRA 285


>gi|81299588|ref|YP_399796.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Synechococcus elongatus PCC 7942]
 gi|119370071|sp|Q5N421|FOLD_SYNP6 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370072|sp|Q31Q60|FOLD_SYNE7 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|81168469|gb|ABB56809.1| Methenyltetrahydrofolate cyclohydrolase [Synechococcus elongatus
           PCC 7942]
          Length = 289

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 191/289 (66%), Gaps = 9/289 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +++DG+ +A+    ++ E V  +    G + GLAV++VG++PAS  YV  K R  +  G 
Sbjct: 4   AILDGRALAAQRRQQLREQVEAIAPAVGRRPGLAVIMVGDNPASAVYVRNKERACEQTGI 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S   + P D S+ ++   +  LN+DD + GILVQLPLPS +    ++ +I PEKD DGL
Sbjct: 64  VSFGKHLPGDSSEAEIRALIEELNQDDRVDGILVQLPLPSHLDAVPLLLAIDPEKDADGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G+++ G+   GL  CTPAG + L+   +  D +G+ AVVIGRS L GKP+  +LL
Sbjct: 124 HPLNLGRLLRGE--EGLRSCTPAGVMELLAANQ-IDPAGKKAVVIGRSILVGKPLAMMLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVT+AHS+T NLPE+CR ADI+V AVGRP +V  DWIK G++V+DVGINR+   + 
Sbjct: 181 EANATVTIAHSRTPNLPEVCRQADIVVAAVGRPELVGADWIKPGAVVVDVGINRLEDGR- 239

Query: 243 GKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
               LVGDV  E  S + + ITPVPGGVGPMT+AML+ NTV++  R  G
Sbjct: 240 ----LVGDVDYEAASAITSWITPVPGGVGPMTVAMLLHNTVLSYCRRSG 284


>gi|121604680|ref|YP_982009.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Polaromonas naphthalenivorans CJ2]
 gi|158705756|sp|A1VN60|FOLD_POLNA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|120593649|gb|ABM37088.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Polaromonas naphthalenivorans CJ2]
          Length = 281

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 190/286 (66%), Gaps = 10/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG  ++  L  ++A+  A L+   G+  GLAVVLVG++PAS  YV  K +  +  G 
Sbjct: 4   QLIDGNALSRQLRTEVAQRAALLRAR-GITPGLAVVLVGDNPASQVYVRNKVKACEDNGL 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV   +P ++S+ DL   V +LN D +IHGILVQLPLP+ +  Q +I++I P KDVDG 
Sbjct: 63  HSVLERYPAEMSEADLLARVEALNNDPAIHGILVQLPLPAHIDAQKVIEAISPAKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV +AG +M+G    G  PCTP G + ++E   G DL G+HAVVIGRSN+ GKPM  +LL
Sbjct: 123 HVGSAGALMVGQ--PGFWPCTPYGCMKMLESI-GYDLRGKHAVVIGRSNIVGKPMALMLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            +NATVT+ HS T +L  +   AD++V AVG+  +++ D +K G++VIDVG+NR    + 
Sbjct: 180 QKNATVTICHSATADLKAMTLQADVIVAAVGKRNVLRADMVKPGAVVIDVGMNR---NEE 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ AA R
Sbjct: 237 GK--LCGDVDFDGVKEVAGYITPVPGGVGPMTITMLLVNTLEAAER 280


>gi|322517160|ref|ZP_08070043.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus vestibularis ATCC 49124]
 gi|322124219|gb|EFX95735.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus vestibularis ATCC 49124]
          Length = 284

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 193/289 (66%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + D++ E VA LK++  +  GL V++VG++PAS  YV  K R AK  
Sbjct: 1   MAIMMDGKALAVKMQDQLQEKVARLKEKEWIVPGLVVIMVGDNPASQVYVRNKERAAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N+D   HGILVQLPLP+ ++E  I+ +I P+KDVD
Sbjct: 61  GFHSKTVNLSESISEEELIEVIEKYNQDPLFHGILVQLPLPNHINEMRILLAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 178 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 234

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           + GK  L GDV  D+ K  VG ITPVPGGVGPMTI MLM  T  AA RS
Sbjct: 235 EEGK--LCGDVDFDQVKEKVGMITPVPGGVGPMTITMLMEQTYQAALRS 281


>gi|222054896|ref|YP_002537258.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacter sp.
           FRC-32]
 gi|254789406|sp|B9M769|FOLD_GEOSF RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|221564185|gb|ACM20157.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacter sp.
           FRC-32]
          Length = 280

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 135/288 (46%), Positives = 189/288 (65%), Gaps = 10/288 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ +  +I   VA L  + G+  GLAVVLVG DPAS  YVS K +  K  
Sbjct: 1   MAKIIDGKAIAAKIRGEITAEVAKLAAQ-GITPGLAVVLVGEDPASKVYVSMKEKACKDV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S +Y  P + ++ +L   +  LNKD  IHGILVQLPLP  ++ + ++++I PEKD D
Sbjct: 60  GIFSDEYKLPAETTEEELLQLIDKLNKDRKIHGILVQLPLPKQINTEKVLEAISPEKDAD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G+++IG       PCTP G ++++++  G DL+G+  VV+GRSN+ GKP+  +
Sbjct: 120 GFHPYNVGRLVIGKPL--FQPCTPYGVMVMLKE-TGVDLAGKEVVVVGRSNIVGKPVAFM 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L +NATVT+ HSKT++L      AD+++ AVG+P M++  WIK G++VIDVG+NR+   
Sbjct: 177 CLQQNATVTLCHSKTRDLAAKVAMADVVIAAVGQPEMIKGAWIKKGAVVIDVGVNRV--- 233

Query: 241 QLGKTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYR 287
             G+  LVGDV  E  S    AITPVPGGVGPMTI ML+ NT+ +A R
Sbjct: 234 --GEKKLVGDVEYEAASARASAITPVPGGVGPMTITMLLYNTLESAKR 279


>gi|312863008|ref|ZP_07723246.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus vestibularis F0396]
 gi|311100544|gb|EFQ58749.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus vestibularis F0396]
          Length = 284

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 193/289 (66%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + D++ E VA LK++  +  GL V++VG++PAS  YV  K R AK  
Sbjct: 1   MAIIMDGKALAVKMQDQLQEKVARLKEKEWIVPGLVVIMVGDNPASQVYVRNKERAAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N+D   HGILVQLPLP+ ++E  I+ +I P+KDVD
Sbjct: 61  GFHSKTVNLSESISEEELIEVIEKYNQDPLFHGILVQLPLPNHINEMRILLAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 178 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 234

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           + GK  L GDV  D+ K  VG ITPVPGGVGPMTI MLM  T  AA RS
Sbjct: 235 EEGK--LCGDVDFDQVKEKVGMITPVPGGVGPMTITMLMEQTYQAALRS 281


>gi|225567909|ref|ZP_03776934.1| hypothetical protein CLOHYLEM_03982 [Clostridium hylemonae DSM
           15053]
 gi|225163197|gb|EEG75816.1| hypothetical protein CLOHYLEM_03982 [Clostridium hylemonae DSM
           15053]
          Length = 279

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 191/288 (66%), Gaps = 10/288 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK +++ + +++ +  A L +E G  V LAVV VG DPAS  YV  K +     
Sbjct: 1   MAMLIDGKAISAQIKEELKKETALLAEE-GRHVCLAVVQVGGDPASSIYVGNKKKACDQV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y      S+ +L + +  LN+DD ++GILVQLPLP  ++E ++I++I P+KDVD
Sbjct: 60  GIESLSYELEEQTSEAELLSLIDRLNRDDKVNGILVQLPLPGHINEDAVIRAIHPDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + G++ IG+   G VPCTPAG I ++++  G ++ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFHPESVGRLCIGE--KGFVPCTPAGIIQMLKR-SGIEIEGKECVVVGRSNIVGKPMAML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+TK L E+ + ADILV AVG+P+ +  ++IK G++V+DVGI+R  + 
Sbjct: 177 LLRENGTVTVAHSRTKQLREVTKRADILVAAVGKPKFITAEYIKEGAVVVDVGIHRNENN 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +     L GDV  D  K    AITPVPGGVGPMTIAMLM+N V AA +
Sbjct: 237 K-----LCGDVDFDGVKEKAAAITPVPGGVGPMTIAMLMSNCVEAARK 279


>gi|153816440|ref|ZP_01969108.1| hypothetical protein RUMTOR_02693 [Ruminococcus torques ATCC 27756]
 gi|317500193|ref|ZP_07958425.1| methenyltetrahydrofolate cyclohydrolase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087579|ref|ZP_08336509.1| folD protein [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846228|gb|EDK23146.1| hypothetical protein RUMTOR_02693 [Ruminococcus torques ATCC 27756]
 gi|316898408|gb|EFV20447.1| methenyltetrahydrofolate cyclohydrolase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330400450|gb|EGG80083.1| folD protein [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 284

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 137/282 (48%), Positives = 187/282 (66%), Gaps = 8/282 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK ++  + D++ + V  L  E G+   LAV+ VGNDPAS  YV+ K +   + 
Sbjct: 1   MPYIIDGKAISKQIKDELRDEVEKLT-EAGINACLAVIQVGNDPASTVYVNNKKKACAYV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S  Y  P D S+  L + V  LN+D  ++GILVQLPLP  + E  +I++I P+KDVD
Sbjct: 60  GINSRSYELPEDTSEQTLLDLVQKLNEDPEVNGILVQLPLPKQIDEDKVIRTISPDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H V+ G++ IG+   G + CTPAG I L+++  G ++ G+  V+IGRSN+ GKPM  L
Sbjct: 120 GFHPVSVGRLWIGE--KGFLSCTPAGVIQLLKR-SGIEIEGKECVIIGRSNIVGKPMAAL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHSKTK+L  I + ADIL+VA+G+ + +  D+IK G++VIDVG++R    
Sbjct: 177 LLRENATVTVAHSKTKDLKSIAKRADILIVAIGKAKFITKDYIKEGAVVIDVGMHRDEQN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTV 282
            L   V   DV+    SVV AITPVPGGVGPMTIAMLM N V
Sbjct: 237 HLCGDVDCEDVS----SVVSAITPVPGGVGPMTIAMLMNNCV 274


>gi|322372537|ref|ZP_08047073.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. C150]
 gi|321277579|gb|EFX54648.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Streptococcus sp. C150]
          Length = 284

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 139/286 (48%), Positives = 188/286 (65%), Gaps = 9/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK +A  + +++ E VA LK+   +  GL V++VG++PAS  YV  K R A   GFH
Sbjct: 4   MMDGKALALKMQNQLQEKVARLKESEWIVPGLVVIMVGDNPASQVYVRNKERAAIKAGFH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S   N    IS+ +L   +   N+D   HGILVQLPLP+ ++E  I+ +I P+KDVDG H
Sbjct: 64  SKTVNLSERISEEELIEVIEKYNQDPLFHGILVQLPLPNHINEMRILLAIDPKKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QLLL 
Sbjct: 124 PMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQLLLE 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           +NATVT+ HS+T +L  +C  AD+L+VA+GR + V  D++K G++VIDVGINR    + G
Sbjct: 181 KNATVTLTHSRTPHLANVCNKADVLIVAIGRAKFVTEDFVKEGAVVIDVGINR---DEEG 237

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  E  K  VG ITPVPGGVGPMTI MLM  T  AA RS
Sbjct: 238 K--LCGDVDFEGVKDKVGMITPVPGGVGPMTITMLMEQTYQAALRS 281


>gi|269468682|gb|EEZ80314.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [uncultured SUP05
           cluster bacterium]
          Length = 276

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 190/282 (67%), Gaps = 13/282 (4%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  L  KI + V+ L ++ G    LAV+LVG+DPAS  YV  K    K  GF+
Sbjct: 2   IIDGKQIAKELRVKITDKVSTLDRKPG----LAVILVGDDPASAVYVRNKDNACKEVGFY 57

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S + N P +I+Q +L + V  LN DD I GILVQLPLPS +    ++++I P KDVDG H
Sbjct: 58  SEKINKPANITQAELLSEVDRLNHDDKIDGILVQLPLPSHLDTNQVVEAINPSKDVDGFH 117

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N GK+M       L PCTP G + L+ Q  G DL+G++ VV+G SN+ G+PM   LL+
Sbjct: 118 SENIGKLM--QNRAFLRPCTPKGVMTLL-QITGIDLAGKNCVVVGASNIVGRPMAIELLN 174

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT+ +SKTKNL +  + AD+LVVAVGRP+M+Q +WIK G+ VIDVGINR+++   G
Sbjct: 175 ASATVTICNSKTKNLSDKIKQADVLVVAVGRPKMIQGNWIKEGATVIDVGINRLDN---G 231

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           K  LVGDV  D  K  V  ITPVPGGVGPMTIA L+ NT++A
Sbjct: 232 K--LVGDVDFDATKDKVAWITPVPGGVGPMTIATLLENTLMA 271


>gi|160933788|ref|ZP_02081176.1| hypothetical protein CLOLEP_02649 [Clostridium leptum DSM 753]
 gi|156867665|gb|EDO61037.1| hypothetical protein CLOLEP_02649 [Clostridium leptum DSM 753]
          Length = 284

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK V++ +     + V  LK + G+Q GLAVV+VG+DPAS  YV+ K +     
Sbjct: 1   MAKIIDGKAVSAAVRAGAKQEVEALKAQ-GIQPGLAVVIVGDDPASRVYVNNKKKACAEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS +Y  P + +Q +L + V  LN    I+GILVQLPLP  + E+ +I++I P KDVD
Sbjct: 60  GIHSEEYALPKETTQEELLDLVCRLNDKKDINGILVQLPLPKGLDEKEVIETISPLKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H  N G++MIGD+    +PCTPAG + L++     ++ G+  VVIGRSN+ GKPM  L
Sbjct: 120 AFHPQNVGRIMIGDYH--FLPCTPAGVMELLKSAD-VEICGRDCVVIGRSNIVGKPMAML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL ++ TVT+ HSKT+NL E+CR ADILV AVG P+ V  D +K G++VIDVG++R  + 
Sbjct: 177 LLHQSGTVTICHSKTQNLKEVCRRADILVAAVGIPKFVTADMVKPGAVVIDVGMDRDEN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L GDV     + V  AITPVPGGVGPMTIAMLM NT+ AA
Sbjct: 236 --GK--LCGDVDFQNVEPVASAITPVPGGVGPMTIAMLMKNTIRAA 277


>gi|319651492|ref|ZP_08005620.1| methylenetetrahydrofolate dehydrogenase [Bacillus sp. 2_A_57_CT2]
 gi|317396807|gb|EFV77517.1| methylenetetrahydrofolate dehydrogenase [Bacillus sp. 2_A_57_CT2]
          Length = 291

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 187/288 (64%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDGK +A    D I   V  LK E G+  GLAV+L GN+ AS +YV  K +     G 
Sbjct: 4   ELIDGKEIARKKQDHIGSEVQKLKAE-GITPGLAVILAGNNQASRTYVKNKQKTCDKLGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S+    P  +S+ +L   +  LN+ + IHGILVQLPLPS ++E++II++I P+KDVDG 
Sbjct: 63  NSMLIELPESVSEQELIRKITELNESEDIHGILVQLPLPSHINEKAIIEAISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++M        +PCTPAG I +++   G D+SG+H VVIGRSN+ GKP GQL L
Sbjct: 123 HPINIGRMMTAQ--DAFIPCTPAGIIEMLDSI-GTDISGKHVVVIGRSNIVGKPAGQLFL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + +ATVT  HSKT +L E  + ADILV A G+ +++  D +K G++VIDVG+NR    + 
Sbjct: 180 NEDATVTYCHSKTADLKEYTKRADILVAAAGKAKLITKDHVKNGAIVIDVGMNR---NEG 236

Query: 243 GKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  E  K   G ITPVPGGVGPMTI MLM NT+ AA  S+
Sbjct: 237 GK--LCGDVDFEAVKHKAGFITPVPGGVGPMTITMLMHNTLKAAKLSI 282


>gi|293571748|ref|ZP_06682767.1| bifunctional protein FolD [Enterococcus faecium E980]
 gi|291608205|gb|EFF37508.1| bifunctional protein FolD [Enterococcus faecium E980]
          Length = 284

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 188/286 (65%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LI+GK +A  +   IAE +  LK + G+  GL V+LVG +PAS  YV  K R+AK  
Sbjct: 1   MAELINGKELAEKMQADIAEKIQKLK-DNGIHPGLVVLLVGENPASQIYVRNKERVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS    +P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I PEKDVD
Sbjct: 60  GIHSSVERYPETISENELLAEIEKYNQDPRFHGILVQLPLPKHIDEEKILLAIRPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G+++ G      +PCTP G + + E +   D +G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLLAG--KPDKIPCTPYGIMKMFEAY-SIDPAGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+AHSKT+NL E+ + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 177 LLMADATVTVAHSKTENLAELAQEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L+GDV  DE + + G ITPVP GVGPMTI MLM  TV +A
Sbjct: 236 --GK--LIGDVKFDEVEPIAGWITPVPKGVGPMTITMLMYQTVKSA 277


>gi|329574369|gb|EGG55941.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX1467]
          Length = 282

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 189/289 (65%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  +  + G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTTQQGIQPGLVVLLVGENPASQTYVRNKERAAAKI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 61  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 178 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 234

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 235 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 281


>gi|312864648|ref|ZP_07724879.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus downei F0415]
 gi|311099775|gb|EFQ57988.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus downei F0415]
          Length = 285

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 136/291 (46%), Positives = 194/291 (66%), Gaps = 9/291 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDGK +A  +  ++AE VA LK + G+  GL V+LVG++PAS  YV  K R A   G
Sbjct: 3   AKIIDGKALAKKMQGQLAEKVAQLKDQHGIVPGLVVILVGDNPASQVYVRNKERSALAAG 62

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
           F S        ISQ +L   +   N+D + HGILVQLPLPS ++++ +I +I P+KDVDG
Sbjct: 63  FTSETVRLSDSISQEELLALIEKYNQDPAFHGILVQLPLPSHINDKRVILAIDPKKDVDG 122

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H +N G +  G     +VPCTPAG + ++ +++  DL G++AV++GRSN+ GKPM QLL
Sbjct: 123 FHPMNTGHLWSG--RPLMVPCTPAGIMEMLREYE-VDLEGKNAVIVGRSNIVGKPMAQLL 179

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L +NATVT+ HS+T++L  +C+ A++L+VA+G+   V  D++K G++VIDVG+NR +   
Sbjct: 180 LDKNATVTLTHSRTRHLDRVCKRANLLIVAIGQRNFVTKDYVKEGAVVIDVGMNRDDD-- 237

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            GK  L+GDV  DE   +   ITPVPGGVGPMTI ML+  T  AA RS+ +
Sbjct: 238 -GK--LIGDVKFDEVAQLASLITPVPGGVGPMTITMLLEQTYQAALRSVSL 285


>gi|293377379|ref|ZP_06623583.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium PC4.1]
 gi|292644071|gb|EFF62177.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecium PC4.1]
          Length = 284

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 189/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LI+GK +A  +  +IAE +  LK + G+  GL V+LVG +PAS  YV  K R+AK  
Sbjct: 1   MAELINGKELAEKMQAEIAEKIQKLK-DNGIHPGLVVLLVGENPASQIYVRNKERVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G HS    +P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I PEKDVD
Sbjct: 60  GIHSSVERYPETISEDELLAEIEKYNQDPRFHGILVQLPLPKHIDEEKILLAIRPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G+++ G      +PCTP G + + E +   D +G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLLAG--KPDKIPCTPYGIMKMFEAY-SIDPTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  +ATVT+AHSKT+NL ++ + ADILVVA+GR   V  +++K G++VIDVG+NR  + 
Sbjct: 177 LLMADATVTVAHSKTENLAKLAQEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L+GDV  DE + V G ITPVP GVGPMTI MLM  TV +A
Sbjct: 236 --GK--LIGDVKFDEVEPVAGWITPVPKGVGPMTITMLMYQTVKSA 277


>gi|148263240|ref|YP_001229946.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacter
           uraniireducens Rf4]
 gi|189044534|sp|A5GAM5|FOLD_GEOUR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|146396740|gb|ABQ25373.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Geobacter uraniireducens Rf4]
          Length = 280

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 137/288 (47%), Positives = 187/288 (64%), Gaps = 10/288 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ +  +I   VA L  + GV  GLAVVLVG DPAS  YVS K +  K  
Sbjct: 1   MAKIIDGKAIAAKIRGEITAEVAKLASK-GVTPGLAVVLVGEDPASKVYVSMKEKACKDV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S +Y  PVD S+ DL   +  LN D  IHGIL+QLPLP  +  + ++++I PEKD D
Sbjct: 60  GIFSDEYKLPVDTSEADLLLLIHKLNSDPKIHGILIQLPLPKQIDTEKVLEAISPEKDAD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G+++IG       PCTP G ++++++  G +L+G+  VV+GRSN+ GKP+  +
Sbjct: 120 GFHPYNVGRLVIGKPL--FQPCTPYGVMVMLKE-AGVELAGKEVVVVGRSNIVGKPVAFM 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L +NATVT+ HSKT++L      AD+++ AVG+P M++  WIK G++VIDVG+NR+   
Sbjct: 177 CLQQNATVTLCHSKTRDLAAKVGMADVVIAAVGQPEMIKGAWIKEGAVVIDVGVNRV--- 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
             G+  LVGDV  D       AITPVPGGVGPMTI ML+ NT+ AA R
Sbjct: 234 --GEKKLVGDVEFDAAAERASAITPVPGGVGPMTITMLLYNTLEAAKR 279


>gi|320353945|ref|YP_004195284.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+);
           methenyltetrahydrofolate cyclohydrolase [Desulfobulbus
           propionicus DSM 2032]
 gi|320122447|gb|ADW17993.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+);
           methenyltetrahydrofolate cyclohydrolase [Desulfobulbus
           propionicus DSM 2032]
          Length = 316

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 189/295 (64%), Gaps = 8/295 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I G   A  + ++IA  VA LK   G+  GL  +LVG DPAS SYV+AK + A   G 
Sbjct: 25  QIISGSETAKAIREEIAAEVARLKTAHGLVPGLVTILVGEDPASQSYVAAKNKTAHALGI 84

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HS Q   P   S+ +L   V   N++ +IHGILVQLPLP  + E  ++ +I P+KDVDG 
Sbjct: 85  HSEQVTLPAATSEAELLGIVADYNRNPAIHGILVQLPLPRHIDEAKVLFAIDPDKDVDGF 144

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN GK+M+G+     +PCTP G IL + Q  G + SG   VV+GRSN+ GKP+  L+L
Sbjct: 145 HPVNVGKMMLGERC--FLPCTPHG-ILELLQRSGTETSGAEVVVVGRSNIVGKPIANLML 201

Query: 183 SR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            +    NATVT+ H++T+++    R ADIL+VA G  +M++ D IK G+++IDVG+NRI 
Sbjct: 202 QKRAGGNATVTICHTRTRDMAFHTRRADILIVAAGVAKMIKGDQIKEGAVIIDVGVNRIG 261

Query: 239 SPQLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
             + GK +L GDV  D      GAITPVPGGVGPMTI MLM NT+ AA ++ G++
Sbjct: 262 QTESGKALLAGDVDFDSVVGKAGAITPVPGGVGPMTITMLMKNTLQAAKQAAGIE 316


>gi|88607272|ref|YP_504799.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Anaplasma phagocytophilum HZ]
 gi|119369618|sp|Q2GLF2|FOLD_ANAPZ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|88598335|gb|ABD43805.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Anaplasma phagocytophilum HZ]
          Length = 304

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 141/294 (47%), Positives = 191/294 (64%), Gaps = 5/294 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK  A+ L  ++   +  LK+E G+   L V++VG+DPAS  YV  K R A+  G 
Sbjct: 7   NIIDGKAAAADLLGRLKVVMEGLKEEHGLFPSLVVIIVGDDPASRLYVGNKQRKAEELGI 66

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P + +Q +L   +  LN+D+++HGILVQLPLP  + +  II +I PEKDVDG 
Sbjct: 67  NSKTIALPYETTQEELLGIIQELNEDENVHGILVQLPLPKHIDKILIINAIDPEKDVDGF 126

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  NAGK++ G+    +VPCTP G I LI++     LS + AVVIGRSN+ GKP+  LL+
Sbjct: 127 HNANAGKLLTGEMDC-MVPCTPQGCIYLIKKVMPV-LSSKRAVVIGRSNIVGKPVALLLM 184

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TV++ HS T N+ E CR A+I++ AVG+ RMV+ +W+  G++VIDVGIN I S   
Sbjct: 185 YENCTVSILHSATANIEEHCRDAEIIIAAVGKARMVKSEWVSPGAVVIDVGINLITSES- 243

Query: 243 GKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
            K   VGDV  E  +  V AITPVPGGVGPMTIA L+ NTV+ A R  G+K  K
Sbjct: 244 -KNRFVGDVDFESVRDKVAAITPVPGGVGPMTIAFLLVNTVLGACRQKGIKQYK 296


>gi|84468380|dbj|BAE71273.1| putative tetrahydrofolate synthase [Trifolium pratense]
          Length = 350

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 190/289 (65%), Gaps = 3/289 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +  +IDGK+VA  + D+IA  V+ +K+  GV  GLAV+LVG+   S +YV  K +  +  
Sbjct: 58  VAKVIDGKLVAKQIRDEIAAEVSRMKEAVGVIPGLAVILVGDRKDSATYVRNKKKACESV 117

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S++ N P D ++  + N +   N D S+HGILVQLPLPS ++EQ+++ ++  EKDVD
Sbjct: 118 GINSLEVNLPADTTEEQVLNYISGYNDDPSVHGILVQLPLPSHMNEQNVLNAVRIEKDVD 177

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +       VPCTP G I L+ ++ G  + G+ AVVIGRSN+ G P   L
Sbjct: 178 GFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRY-GISIKGKRAVVIGRSNIVGMPAALL 236

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L   +ATV++ HS+T N  EI R ADI++ AVG+P MV+  WIK  +++IDVGIN ++ P
Sbjct: 237 LQREDATVSVVHSRTSNPEEITRQADIIIAAVGQPNMVRGSWIKPDAVIIDVGINPVDDP 296

Query: 241 QLGKTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
              +   LVGDV  +E   V  AITPVPGGVGPMTIAML+ NT+ +A R
Sbjct: 297 SSSRGYKLVGDVCYEEAIKVASAITPVPGGVGPMTIAMLLQNTLTSAKR 345


>gi|213971223|ref|ZP_03399340.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas syringae pv. tomato T1]
 gi|301383928|ref|ZP_07232346.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. tomato Max13]
 gi|302061525|ref|ZP_07253066.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. tomato K40]
 gi|302131039|ref|ZP_07257029.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213923976|gb|EEB57554.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas syringae pv. tomato T1]
          Length = 300

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 195/296 (65%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +++ + V  LK E G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVRDDVHTLKAE-GIEPALAVILVGNDPASEVYVRNKIARAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S+  L   +  LN D S++GIL+QLPLP+ ++E   +Q+I   KDVDG H
Sbjct: 64  SLEHRLPADCSEARLLALIAELNTDRSVNGILLQLPLPAHINEAHALQAIAAAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+++  G DL+G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCMHLLKETCG-DLTGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    VV AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDNALDVVSAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|291522429|emb|CBK80722.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Coprococcus catus GD/7]
          Length = 284

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 138/284 (48%), Positives = 187/284 (65%), Gaps = 8/284 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK ++S + D++   +A +KK+ G +V LAV+ VGNDPAS  YV  K +   + 
Sbjct: 1   MAFLIDGKKISSQIKDELKTEIAEMKKK-GTEVTLAVIQVGNDPASSVYVGNKKKACAYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y  P   S+++L   +  LN    ++GILVQLP+P+ ++E+ II++I P KDVD
Sbjct: 60  GIRSLAYELPESTSEMELLTLIDELNNRKDVNGILVQLPVPAHINEKHIIEAIHPLKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G ++ G+   G V CTPAG I L+++    D+ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFHPRNVGALVTGE--DGFVSCTPAGIIQLLKR-SNIDIDGKECVVVGRSNIVGKPMAIL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS TK+L E+C+ ADILV A+G+P+    D+IK G++VIDVGI+R    
Sbjct: 177 LLRENATVTICHSHTKDLKEVCKRADILVAAIGKPKFFNRDYIKEGAVVIDVGIHRNEQN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           +L   V   DV D    +V AITPVPGGVGPMTIAMLM N V A
Sbjct: 237 KLCGDVDRDDVMD----LVSAITPVPGGVGPMTIAMLMYNCVEA 276


>gi|328953949|ref|YP_004371283.1| Bifunctional protein folD [Desulfobacca acetoxidans DSM 11109]
 gi|328454273|gb|AEB10102.1| Bifunctional protein folD [Desulfobacca acetoxidans DSM 11109]
          Length = 299

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 141/296 (47%), Positives = 187/296 (63%), Gaps = 10/296 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LI G  VA+ + +++ + VA LK +  +  GL  +LVG DP S SYV+AK + A   GF
Sbjct: 4   TLIKGAEVAAQIREELKQEVADLKAKHNIVPGLVTILVGEDPGSVSYVTAKQKTAHELGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +SVQ + P  IS+ DL   +   NKD  +HGILVQLPLP ++    ++ +I P KDVD  
Sbjct: 64  YSVQDSQPPTISEADLLALIDKYNKDPKLHGILVQLPLPKSIDTNKVLYAIDPNKDVDAF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G+++IG +    +PCTPAG   LI +  G D  G+  VV+GRSN+ GKPM  +++
Sbjct: 124 HPVNVGRILIGQY--AFLPCTPAGCQELIVRATG-DPKGKELVVVGRSNIVGKPMVAIMI 180

Query: 183 SR----NATVTMAHSKT--KNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINR 236
            +    N TVT  H+ T    + E CR ADILVVA G P+ VQ DW+K G++VIDVG+NR
Sbjct: 181 QKLPGANCTVTCVHTGTPKDKMIEHCRRADILVVAAGVPKYVQADWVKEGAVVIDVGVNR 240

Query: 237 INSPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           I   + GK  L GDV  D  K     ITPVPGGVGPMTI MLM NTV+AA  + G+
Sbjct: 241 IGMTESGKAKLAGDVDFDTVKEKASFITPVPGGVGPMTITMLMKNTVMAAKLAAGL 296


>gi|292669957|ref|ZP_06603383.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Selenomonas noxia ATCC 43541]
 gi|292648369|gb|EFF66341.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Selenomonas noxia ATCC 43541]
          Length = 284

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 183/288 (63%), Gaps = 12/288 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++ GK  A+ +    AE  A   +  G+   LAV++VG+DPAS  YV  K +  +  
Sbjct: 1   MARILYGKEFAARIKAS-AEHEALALRARGIYPRLAVIIVGSDPASEVYVRNKQKTCEEL 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTV--SEQSIIQSIVPEKD 118
           G  S     P + ++ +L   + +LN DD +HGILVQLPLP+ +  SE+ ++  I P KD
Sbjct: 60  GILSDHIPMPEETTKEELLARIDALNADDHVHGILVQLPLPAALAGSEEEVLSRIDPRKD 119

Query: 119 VDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMG 178
           VDG H VN G + IG  T GL PCTPAG I ++E + G  + G HAV+IGRSN+ GKPM 
Sbjct: 120 VDGFHPVNVGHLFIG--TPGLRPCTPAGCIRMLE-YAGIPMEGAHAVIIGRSNIVGKPMA 176

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LLL R+ATVT+ HS+T +L EI R ADILV AVGRPR V  D +K G+ VIDVGINRI 
Sbjct: 177 HLLLERHATVTLCHSRTAHLAEITRAADILVAAVGRPRFVTADMVKPGATVIDVGINRIA 236

Query: 239 SPQLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             Q     LVGDV  D    V GAITPVPGGVG +T+AMLM N V AA
Sbjct: 237 PKQ-----LVGDVDFDAAAEVAGAITPVPGGVGLLTVAMLMENVVQAA 279


>gi|55820690|ref|YP_139132.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus thermophilus LMG 18311]
 gi|55736675|gb|AAV60317.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Streptococcus thermophilus LMG 18311]
          Length = 288

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + +++ E VA LK++  +  GL V++VG +PAS  YV  K R AK  
Sbjct: 5   MAIIMDGKALAVNMQEQLQEKVARLKEKEWIVPGLVVIMVGENPASQVYVRNKERAAKKA 64

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N+D   HGILVQLPLP+ +SE  I+ +I P+KDVD
Sbjct: 65  GFHSKTVNLSESISEEELIEVIEKYNQDPLFHGILVQLPLPNHISEMRILLAIDPKKDVD 124

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 125 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 181

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 182 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 238

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           + GK  L GDV  D+ K  V  ITPVPGGVGPMTI MLM  T  AA RSL
Sbjct: 239 EEGK--LCGDVDFDQVKEKVSMITPVPGGVGPMTITMLMEQTYQAALRSL 286


>gi|189423579|ref|YP_001950756.1| Methenyltetrahydrofolate cyclohydrolase [Geobacter lovleyi SZ]
 gi|189419838|gb|ACD94236.1| Methenyltetrahydrofolate cyclohydrolase [Geobacter lovleyi SZ]
          Length = 284

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 134/287 (46%), Positives = 191/287 (66%), Gaps = 10/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK +A+ + ++I  +V+ LK++ G+  GLAVVLVG+DPAS  YV  K +M    G 
Sbjct: 4   QIIDGKAIAAKVRERIGSTVSTLKQQ-GITPGLAVVLVGDDPASRVYVGMKKKMCVELGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S  +  P   S+ +L   +  LN D  +HGILVQLPLP  +    ++++I P+KD DG 
Sbjct: 63  YSADHELPASTSEAELLTLIGQLNADPRVHGILVQLPLPDHIDTDKVLEAISPDKDADGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N G++ IG  T    PCTP G ++++++  G DL G+  VV+GRSN+ GKP+  + L
Sbjct: 123 HPYNVGRLAIGKPT--FQPCTPYGVMVMLDEI-GYDLKGKEVVVVGRSNIVGKPVALMCL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           SR+ATVT+ HS+TK+L ++ R AD+++ AVG+  MV+ DWIK G++VIDVGINR+     
Sbjct: 180 SRHATVTICHSRTKDLADVVRRADVVIAAVGKAEMVKGDWIKPGAVVIDVGINRV----- 234

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           G+  LVGDV          AITPVPGGVGPMTIAML+ NT+ +A R+
Sbjct: 235 GEKKLVGDVEYAAAAERASAITPVPGGVGPMTIAMLLQNTLESAQRA 281


>gi|281355670|ref|ZP_06242164.1| Methenyltetrahydrofolate cyclohydrolase [Victivallis vadensis ATCC
           BAA-548]
 gi|281318550|gb|EFB02570.1| Methenyltetrahydrofolate cyclohydrolase [Victivallis vadensis ATCC
           BAA-548]
          Length = 292

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 188/290 (64%), Gaps = 8/290 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK +A ++ ++    V  LK   G   GLAVVL+G+DPAS  YV++K +     G 
Sbjct: 4   KIIDGKAIARMVNEETLARVEKLK-AAGKTPGLAVVLIGDDPASQVYVNSKAKKCAELGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S +   P D S  D+ + +  LN+D  I GILVQ P P  + E+ +I +I P+KDVD  
Sbjct: 63  YSDKRVLPADASMSDVLDLIDKLNRDPKIDGILVQSPPPPQIDEEKVIAAIDPDKDVDCF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N GK++IG  T G  PCTP G ++L+E+  G D +G+HAVVIGRSN+ GKP+  +L+
Sbjct: 123 HERNVGKLLIGK-TDGFRPCTPYGVLVLLEK-SGIDPAGRHAVVIGRSNIVGKPLAAMLM 180

Query: 183 SR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            +    NATVT+ HS T ++ +  R ADIL+ A+G+P  V  D IK G+ VIDVGINRI 
Sbjct: 181 QKAKGANATVTVVHSGTPDIAKYTRDADILIAAIGKPEFVTGDMIKPGAAVIDVGINRIP 240

Query: 239 SPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +P+ GK  LVGDV   E   V GAITPVPGGVGPMTIA+LM+N V A  R
Sbjct: 241 NPETGKNKLVGDVNFQEAVEVAGAITPVPGGVGPMTIAILMSNAVTACER 290


>gi|197303371|ref|ZP_03168410.1| hypothetical protein RUMLAC_02093 [Ruminococcus lactaris ATCC
           29176]
 gi|197297369|gb|EDY31930.1| hypothetical protein RUMLAC_02093 [Ruminococcus lactaris ATCC
           29176]
          Length = 279

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/282 (47%), Positives = 183/282 (64%), Gaps = 8/282 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK ++  + D++   V  LK + G  + LAV+ VG+DPAS  YV  K R   + 
Sbjct: 1   MAQLIDGKAISQQIKDELKAEVEALKND-GTDICLAVIQVGDDPASSVYVRNKKRACAYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S  Y  P D ++  L   V  LN DD+++GILVQLPLP+ + E  II++I  +KDVD
Sbjct: 60  GVESRAYELPEDTTEEQLVELVKELNADDTVNGILVQLPLPAQIDEDKIIRTISADKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + GK+ IG+   G + CTPAG I L+++  G +++G+  V+IGRSN+ GKPM  L
Sbjct: 120 GFHPESVGKLWIGE--KGFLSCTPAGVIQLLKR-SGIEIAGKECVIIGRSNIVGKPMAAL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+TKNL ++ R ADIL+VA+G+ R +  D++K G++VIDVG++R    
Sbjct: 177 LLRENGTVTIAHSRTKNLADVTRRADILIVAIGKERFITSDYVKEGAVVIDVGMHRDAEN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTV 282
            L   V   DV    + V  AITPVPGGVGPMTIAMLM N V
Sbjct: 237 HLCGDVDFADV----EPVASAITPVPGGVGPMTIAMLMNNCV 274


>gi|167766693|ref|ZP_02438746.1| hypothetical protein CLOSS21_01199 [Clostridium sp. SS2/1]
 gi|317497521|ref|ZP_07955840.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Lachnospiraceae
           bacterium 5_1_63FAA]
 gi|167711630|gb|EDS22209.1| hypothetical protein CLOSS21_01199 [Clostridium sp. SS2/1]
 gi|291558364|emb|CBL37164.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [butyrate-producing
           bacterium SSC/2]
 gi|316895204|gb|EFV17367.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Lachnospiraceae
           bacterium 5_1_63FAA]
          Length = 281

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 137/281 (48%), Positives = 185/281 (65%), Gaps = 10/281 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +IDGK ++  + D++ E VA LK E G  + LAV+ VG DPAS  YV  K R  ++ G 
Sbjct: 2   QIIDGKKISQEIKDEVKEEVAQLKAE-GKDIALAVIQVGADPASSVYVRNKKRACEYVGI 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV Y  P + +Q +L   V   NKD  I+GILVQLPLP  + E  ++ +I P+KDVDG 
Sbjct: 61  ESVSYELPEETTQEELMAIVDKCNKDPKINGILVQLPLPKHLDEDEVLLAIDPKKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H V+ G ++IG+   G +PCTPAG I L+++  G ++ G+  VV+GRSN+ GKPM  LLL
Sbjct: 121 HPVSVGNMVIGE--KGFLPCTPAGVIQLLKR-SGVEIDGKECVVVGRSNIVGKPMAMLLL 177

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             N TVT+ HS TK+L E+C+ ADILVVA+G+P+ +   ++K G++VIDVGI+R  + + 
Sbjct: 178 RENGTVTVCHSHTKDLKEVCKRADILVVAIGKPKFIDDSYVKDGAVVIDVGIHRNENNK- 236

Query: 243 GKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTV 282
               L GDV  D+      AITPVPGGVGPMTIAMLM N V
Sbjct: 237 ----LCGDVDYDKVAPKTSAITPVPGGVGPMTIAMLMKNCV 273


>gi|225028440|ref|ZP_03717632.1| hypothetical protein EUBHAL_02714 [Eubacterium hallii DSM 3353]
 gi|224954238|gb|EEG35447.1| hypothetical protein EUBHAL_02714 [Eubacterium hallii DSM 3353]
          Length = 290

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 139/287 (48%), Positives = 187/287 (65%), Gaps = 8/287 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M   IDGK ++S + +++ E V  LK+E G+ V LAV+ VG+DPAS  YV+ K +   + 
Sbjct: 8   MSLRIDGKKISSDIKEELKEQVKLLKEE-GISVCLAVIQVGSDPASSVYVNNKKKACAYI 66

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S  Y  P + +Q +L + +  LNKDD ++GILVQLP+P+ + E+ IIQ+I P KDVD
Sbjct: 67  GIESQAYELPEETTQEELLSLISRLNKDDHVNGILVQLPVPAHMDEKEIIQAISPAKDVD 126

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + G +  G+   G V CTPAG I L+++  G  + G+  VV+GRSN+ GKPM  L
Sbjct: 127 GFHPQSVGALSTGE--PGFVSCTPAGIIQLLKR-SGISIDGKDCVVVGRSNIVGKPMSML 183

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS TKNL E+C+ ADILV A+G+P+     ++K G++VIDVGI+R    
Sbjct: 184 LLRENGTVTICHSHTKNLKEVCQRADILVAAIGKPKFFDDSYVKDGAVVIDVGIHRNEEN 243

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +L   V    V D+    V AITPVPGGVGPMTIAMLM N V AA R
Sbjct: 244 KLCGDVDYDKVVDK----VSAITPVPGGVGPMTIAMLMNNCVEAALR 286


>gi|226311924|ref|YP_002771818.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Brevibacillus brevis NBRC 100599]
 gi|254789390|sp|C0ZC05|FOLD_BREBN RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|226094872|dbj|BAH43314.1| probable methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           [Brevibacillus brevis NBRC 100599]
          Length = 284

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 143/287 (49%), Positives = 196/287 (68%), Gaps = 10/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +++ GK VA  +  ++A  V  LKK+ GV  GL VV+VG+DPAS SYV  K +  +  G 
Sbjct: 4   TILQGKEVAQSIRAELANEVVELKKQ-GVVPGLTVVIVGDDPASHSYVRGKAKGCEEVGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S       DI++ +L   +  LN++ +++GILVQLPLP+ +SE ++I++I PEKDVDG 
Sbjct: 63  SSEIIRKDADITEEELLVIIQQLNENPNVNGILVQLPLPAHISEHAVIEAIAPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H ++ G +++G+ T  ++PCTP G I LI++  G  ++G+HAVVIGRSN+ GKP+  LL 
Sbjct: 123 HPISIGNMVLGNDT--MLPCTPHGIIELIKR-TGTQMAGKHAVVIGRSNIVGKPVSLLLQ 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             NATVTM HS+T+NL E  + ADILVVA GR  M+  + +K G++VIDVG+NRI +   
Sbjct: 180 QENATVTMCHSRTQNLEEYTQKADILVVATGRAHMIGKEHVKPGAVVIDVGVNRIET--- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  LVGDV  DE K V   ITPVPGGVGPMTI ML+ NTV AA + 
Sbjct: 237 GK--LVGDVKFDEVKDVASFITPVPGGVGPMTITMLLKNTVAAAKKQ 281


>gi|303239199|ref|ZP_07325728.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Acetivibrio
           cellulolyticus CD2]
 gi|302593244|gb|EFL62963.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Acetivibrio
           cellulolyticus CD2]
          Length = 286

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 194/283 (68%), Gaps = 10/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +++GK +A+ +  ++ ++V  +KK+  +  GLAVV+VGNDPAS  YV++K +  +  G  
Sbjct: 5   VLNGKELATKIKGELKQTVDDIKKQN-IHPGLAVVIVGNDPASRVYVNSKKKACEEIGIE 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S +Y    ++ + +L + +  LN DD ++GILVQLPLP  ++E+ II +I   KDVD  H
Sbjct: 64  SFEYALDENVKEAELLDLIQKLNNDDKVNGILVQLPLPKHINEEKIILAISSSKDVDAFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G++M G+     +PCTPAG + LI++  G +++G+  V++GRSN+ GKP   LLL+
Sbjct: 124 PENVGRLMTGN--PQFLPCTPAGVMELIKE-SGIEIAGKECVIVGRSNIVGKPQSMLLLA 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+ HSKTKN+ E+ + ADILV AVGRP M++ + IK G++VIDVGINR+ + +  
Sbjct: 181 EHGTVTICHSKTKNIEEVIKRADILVAAVGRPEMIKGNSIKPGAVVIDVGINRLENKK-- 238

Query: 244 KTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAA 285
              LVGDV  E  S V  AITPVPGGVGPMTIAMLM NTV AA
Sbjct: 239 ---LVGDVEYESASQVASAITPVPGGVGPMTIAMLMKNTVRAA 278


>gi|119370066|sp|Q5M583|FOLD_STRT2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
          Length = 284

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/290 (48%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + +++ E VA LK++  +  GL V++VG +PAS  YV  K R AK  
Sbjct: 1   MAIIMDGKALAVNMQEQLQEKVARLKEKEWIVPGLVVIMVGENPASQVYVRNKERAAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N+D   HGILVQLPLP+ +SE  I+ +I P+KDVD
Sbjct: 61  GFHSKTVNLSESISEEELIEVIEKYNQDPLFHGILVQLPLPNHISEMRILLAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 178 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 234

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           + GK  L GDV  D+ K  V  ITPVPGGVGPMTI MLM  T  AA RSL
Sbjct: 235 EEGK--LCGDVDFDQVKEKVSMITPVPGGVGPMTITMLMEQTYQAALRSL 282


>gi|320168842|gb|EFW45741.1| mthfd1 protein [Capsaspora owczarzaki ATCC 30864]
          Length = 932

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 186/290 (64%), Gaps = 4/290 (1%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKET-GVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           +++DG+V+A  L D++A  VA LK E  G   GLA+V VG    S  Y+  KTR A   G
Sbjct: 4   TILDGRVIAKALRDEVAADVAKLKAENDGYTPGLAIVQVGGREDSNVYIRMKTRAAAEAG 63

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
                 +FP  I Q DL + +  LN D ++HGILVQLPLP  +  +++  +I   KDVDG
Sbjct: 64  VAFRHLHFPESIPQADLLDEIERLNNDAAVHGILVQLPLPKHIDVEAVTDAIDFHKDVDG 123

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H +N GK+     T   VPCTP G + L+++  G  +SG++AVV+GRSN+ G P+  LL
Sbjct: 124 FHTLNVGKLAKSGETPLFVPCTPKGCMELLKR-AGVQISGKNAVVVGRSNIVGHPVADLL 182

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L +NATVT+ HS+T+NLPE+    DI++ AVGRP M++ DW+K G++VIDVGIN I   +
Sbjct: 183 LRQNATVTICHSRTQNLPEVVARGDIVIAAVGRPEMIKGDWLKPGAVVIDVGINSIKDEK 242

Query: 242 LGK-TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
               T LVGDV    C    G ITPVPGGVGPMT+AML+ +TV +A R L
Sbjct: 243 TASGTKLVGDVDFASCVGKAGIITPVPGGVGPMTVAMLIESTVESAKRHL 292


>gi|58584334|ref|YP_197907.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|75498121|sp|Q5GTK9|FOLD_WOLTR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|58418650|gb|AAW70665.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 295

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 189/286 (66%), Gaps = 5/286 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +AS L +K+++ +  LK+E  +   L V+ VGN+PAS  YV  K + A+  
Sbjct: 1   MTIIIDGKKIASGLCEKLSQRIDVLKREHSIFPCLKVIFVGNNPASQVYVRNKQKKAESI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P +I + +L   +  LN D  ++GILVQLPLP+ ++   +I ++  EKDVD
Sbjct: 61  GISSETIVLPDNILENELIEKINELNNDRFVNGILVQLPLPNHINASKVINTVSVEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H  N GK++ G+    LVPCTP GA+ LI+  +  +LSG++AVVIGRSN+ GKPM  L
Sbjct: 121 AFHRENVGKLVKGE-KNCLVPCTPKGALHLIKLVE-TNLSGKNAVVIGRSNIVGKPMFHL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS++K+L E C  AD++V AVG+P  VQ  WIK G++VIDVGIN ++  
Sbjct: 179 LLQENCTVTILHSQSKDLAEYCSKADVVVTAVGKPNFVQEGWIKEGAIVIDVGINSVSIE 238

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GKT L+GDV  D  K    AITPVPGGVGPMTIA LM NTVIAA
Sbjct: 239 --GKTKLIGDVDFDRVKEKTKAITPVPGGVGPMTIAFLMINTVIAA 282


>gi|332981365|ref|YP_004462806.1| 5,10-methylenetetrahydrofolate dehydrogenase [Mahella australiensis
           50-1 BON]
 gi|332699043|gb|AEE95984.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+);
           methenyltetrahydrofolate cyclohydrolase [Mahella
           australiensis 50-1 BON]
          Length = 284

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 145/287 (50%), Positives = 188/287 (65%), Gaps = 11/287 (3%)

Query: 1   MGS-LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKH 59
           MG+ +IDGK ++S +  +I + V  L+++TG   GLAVVLVG DPAS  YV  K +  + 
Sbjct: 1   MGAQIIDGKAISSAIRQQIKQQVMELQQKTGKSPGLAVVLVGEDPASQIYVRNKEKACQE 60

Query: 60  CGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDV 119
            G +S  Y  P + SQ  L + V  LN+   I+GILVQLPLP  + E ++++ I P+KDV
Sbjct: 61  VGIYSEVYRLPQETSQQQLLDLVHQLNERQEINGILVQLPLPDHLDEMTVLRDISPDKDV 120

Query: 120 DGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQ 179
           DG H VNAGK++ G+   G VPCTP G I LI+     D+ G+ AVV+GRSN+ GKP+  
Sbjct: 121 DGFHAVNAGKLLNGE--KGFVPCTPKGIITLIKSTN-VDIKGKDAVVVGRSNIVGKPVSI 177

Query: 180 LLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           LLL+ NATVT+ HSKT +L    + ADILVVA G+P ++  D +K GS+VIDVG  R+  
Sbjct: 178 LLLNENATVTICHSKTADLKSHTQRADILVVATGKPNLITGDMVKPGSVVIDVGTTRVE- 236

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
              GK  L GDV     K V G ITPVPGGVGPMTI ML+ NTV AA
Sbjct: 237 ---GK--LTGDVHFASAKEVAGWITPVPGGVGPMTITMLLQNTVEAA 278


>gi|94984806|ref|YP_604170.1| methenyltetrahydrofolate cyclohydrolase [Deinococcus geothermalis
           DSM 11300]
 gi|119369600|sp|Q1J0I3|FOLD2_DEIGD RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|94555087|gb|ABF45001.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Deinococcus geothermalis DSM 11300]
          Length = 289

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/251 (50%), Positives = 172/251 (68%), Gaps = 3/251 (1%)

Query: 35  LAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGI 94
           L ++ +G DPAS SYV  K R A+  G  S  Y  P   SQ +L + +  LN DD+++GI
Sbjct: 32  LVMLRLGEDPASVSYVRGKDRKAREVGLKSTVYALPETTSQAELLDLIARLNADDTVNGI 91

Query: 95  LVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQF 154
           LVQLPLP  + EQ+++ +I P KDVDG H +N G++  G     L PCTPAG + L++ +
Sbjct: 92  LVQLPLPLHIQEQAVLHAIDPRKDVDGFHPLNVGELWAG--RPALRPCTPAGILYLLDHY 149

Query: 155 KGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGR 214
            G  ++GQ AVV+GRS++ G+P+  LLL R+ATVT+AHS+T +L  + R AD+L VAVGR
Sbjct: 150 -GIPVAGQRAVVVGRSSIVGRPLAGLLLHRDATVTVAHSRTPDLGAVTREADLLCVAVGR 208

Query: 215 PRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTI 274
           P ++  D ++ G+ V+DVGINR+     GK  L GDVA E   V GAITPVPGGVGPMTI
Sbjct: 209 PHLITPDMVRPGATVVDVGINRVLGEGGGKAQLTGDVAPEVAQVAGAITPVPGGVGPMTI 268

Query: 275 AMLMANTVIAA 285
           A L+ANTV+AA
Sbjct: 269 AQLLANTVLAA 279


>gi|42525532|ref|NP_970630.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Treponema denticola ATCC 35405]
 gi|81570752|sp|Q73RS2|FOLD_TREDE RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|41815543|gb|AAS10511.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Treponema denticola ATCC 35405]
 gi|325475347|gb|EGC78532.1| methenyltetrahydrofolate cyclohydrolase [Treponema denticola F0402]
          Length = 293

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 144/296 (48%), Positives = 196/296 (66%), Gaps = 10/296 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             +IDG  +A+ L   IA+ V  +K + GVQ  LAV+LVGNDPAS SYV  KT      G
Sbjct: 3   AKIIDGARIAADLRADIAKDVEKIKAK-GVQPTLAVILVGNDPASQSYVKGKTNALHEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +   +  P   +Q +L   +  LN D  I+GILVQLPLP  +   ++I++I PEKDVDG
Sbjct: 62  MNDRTFRLPETTTQDELLKLIKELNADKLINGILVQLPLPKQIDPDAVIEAINPEKDVDG 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN GK+++G  T   +PCTP G I L+++  G +  G   V++GRSN+ GKP+  L+
Sbjct: 122 FHPVNVGKLLLGHDT--FIPCTPHGVIHLLKR-TGVETKGAKVVIVGRSNIVGKPLSVLM 178

Query: 182 LSR--NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI-N 238
           +++  NATVT+ HS TKNL E+ + ADILV A+G+PR ++ D IK G++VIDVG+NRI +
Sbjct: 179 MNKDVNATVTVCHSGTKNLTEVTKEADILVAAMGKPRFIKADMIKKGAVVIDVGVNRIDD 238

Query: 239 SPQLGKTVLVGDVADE--CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           S +     LVGDV  E  C+ +  AITPVP GVGPMTIAML+ANT+IAA R  G++
Sbjct: 239 STKKSGFRLVGDVDFEPACE-IASAITPVPKGVGPMTIAMLVANTLIAAKRQNGLE 293


>gi|297584559|ref|YP_003700339.1| methylenetetrahydrofolate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297143016|gb|ADH99773.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Bacillus
           selenitireducens MLS10]
          Length = 287

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 189/284 (66%), Gaps = 10/284 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            +I GK +A    +++ +  A LK E+G+  GLAV+LVG DPAS SYV AK +  +  G 
Sbjct: 4   EIISGKELAKSKREEMKKETARLK-ESGIVPGLAVILVGEDPASQSYVKAKQKACEETGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S   +    IS+ +L   + +LNK D IHGILVQLPLP  +SE+ +I++I PEKDVDG 
Sbjct: 63  LSEMDHVTTSISEEELLTKIENLNKADHIHGILVQLPLPDHISEKKVIETIDPEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++M G      +PCTP G + +I+  K  D+ G+H VV+GRSN+ GKP+GQLLL
Sbjct: 123 HPINIGRMMTGQ--QAFLPCTPFGIVEMIKS-KNIDIQGKHVVVVGRSNIVGKPVGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + +ATVT  HS+TKN+ E  R+ADIL+VAVGR   +  D IK G++VIDVG+NR    + 
Sbjct: 180 NEHATVTYCHSRTKNMQEYTRSADILIVAVGREHFIAGDDIKEGAVVIDVGVNR---NKE 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GK  L GDV     +     +TPVPGGVGPMTI ML+ NT+++A
Sbjct: 237 GK--LTGDVDFASAEQKASYLTPVPGGVGPMTITMLLHNTILSA 278


>gi|260583697|ref|ZP_05851445.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Granulicatella elegans ATCC 700633]
 gi|260158323|gb|EEW93391.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Granulicatella elegans ATCC 700633]
          Length = 282

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 194/288 (67%), Gaps = 13/288 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  +  ++ + V    +E  V+ GL V+LVG DPAS  YV  K R A   
Sbjct: 1   MTIVLDGKSLALKIRQELKQKV----EEQAVKPGLVVLLVGEDPASQIYVRNKERAANEV 56

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHSV    P   +Q +L   + +LN+DD+IHGILVQLPLP  +  Q+++++I+PEKDVD
Sbjct: 57  GFHSVVERLPETTTQEELLEKIKTLNEDDAIHGILVQLPLPKQIDSQTVLEAIIPEKDVD 116

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN GK++  D +  +VPCTP G I L+E++K  DL+G+  VVIG+S + G+PM  L
Sbjct: 117 GFHPVNLGKLLQKDES--IVPCTPKGIIRLLEEYK-IDLTGKEMVVIGQSTIVGRPMALL 173

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L+R ATVT+ HS+TK+L +    ADI++ AVG+P +V  + +K G++++DVGINR+ S 
Sbjct: 174 GLNRGATVTVCHSRTKDLEKQIARADIIISAVGKPNLVLREHVKKGAVIVDVGINRLES- 232

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
             GK  +VGDV  D  K  V AITPVPGGVGPMTIAML+  T + A +
Sbjct: 233 --GK--IVGDVDFDGVKDQVSAITPVPGGVGPMTIAMLLEQTYLNACK 276


>gi|23099335|ref|NP_692801.1| methenyltetrahydrofolate cyclohydrolase [Oceanobacillus iheyensis
           HTE831]
 gi|81746195|sp|Q8EQ43|FOLD_OCEIH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|22777564|dbj|BAC13836.1| methylenetetrahydrofolate dehydrogenase (NADP+) :
           methenyltetrahydrofolate cyclohydrolase [Oceanobacillus
           iheyensis HTE831]
          Length = 285

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 183/286 (63%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +L++GK ++  L  K+   V  LK E G+   L V+LVG++PAS SYV  K +     
Sbjct: 1   MATLLNGKELSEELKQKMKIEVDELK-EKGLTPHLTVILVGDNPASKSYVKGKEKACAVT 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P +ISQ +L   +   N DDS+HGILVQLPLP  + EQ II +I P KDVD
Sbjct: 60  GISSNLIELPENISQDELLQIIDEQNNDDSVHGILVQLPLPDQMDEQKIIHAISPAKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+M G+ T   +PCTP G IL + + K   L G+HAV+IGRSN+ GKP+G L
Sbjct: 120 GFHPINVGKMMTGEDT--FIPCTPYG-ILTMLRSKDISLEGKHAVIIGRSNIVGKPIGLL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT  HS+TKNL EI + ADIL+VA+GR   +  D+IK  ++VIDVGINR +  
Sbjct: 177 LLQENATVTYTHSRTKNLQEITKQADILIVAIGRAHAINADYIKEDAVVIDVGINRKDD- 235

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L GDV  E  +     ITPVP GVGPMTI ML+ NT+ AA
Sbjct: 236 --GK--LTGDVDFESAEQKASYITPVPRGVGPMTITMLLKNTIKAA 277


>gi|268316515|ref|YP_003290234.1| Methenyltetrahydrofolate cyclohydrolase [Rhodothermus marinus DSM
           4252]
 gi|262334049|gb|ACY47846.1| Methenyltetrahydrofolate cyclohydrolase [Rhodothermus marinus DSM
           4252]
          Length = 293

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/296 (46%), Positives = 194/296 (65%), Gaps = 17/296 (5%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVG-----LAVVLVGNDPASCSYVSAKTR 55
           M  +IDGK +A+ +  ++   V     +  VQ G     LAV+LVG++PAS SYV  KT+
Sbjct: 1   MAQIIDGKAIAAQVRAEVKAEV-----DAWVQAGNRPPYLAVILVGDNPASASYVRGKTK 55

Query: 56  MAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVP 115
            A   G  S   +F   IS+ +L   +  LN+DD + GILVQLPLP  ++   ++ +I P
Sbjct: 56  AAAEVGIASDTLHFDTSISEAELLAEIARLNEDDGVDGILVQLPLPDHINPSRVLNAIRP 115

Query: 116 EKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGK 175
           +KDVDG H VNAG++++G+   G VP TPAG + L+ +  G + +G+HAVV+GRSN+ G+
Sbjct: 116 DKDVDGFHPVNAGRLLLGE--PGFVPATPAGILELLRR-SGIETTGKHAVVVGRSNIVGR 172

Query: 176 PMGQLLLSR--NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVG 233
           P+  LLL R  +ATVT+ HS+T++L  + RTADILV A+GRPR +  D ++ G++VIDVG
Sbjct: 173 PLAALLLHRGIDATVTVCHSRTRDLAALTRTADILVAAIGRPRYITADMVREGAVVIDVG 232

Query: 234 INRINSPQLGKTV-LVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           INR++ P   +   LVGDV  E        ITPVPGGVGPMTIA+L+ NT+ AA R
Sbjct: 233 INRVDDPSHPRGYRLVGDVDFEAVAEKASWITPVPGGVGPMTIALLLRNTLYAAQR 288


>gi|331019499|gb|EGH99555.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 300

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/296 (47%), Positives = 195/296 (65%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +++ + V  LK E G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVRDDVHTLKAE-GIEPALAVILVGNDPASEVYVRNKIVRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S+  L   +  LN D S++GIL+QLPLP+ ++E   +Q+I   KDVDG H
Sbjct: 64  SLEHRLPADCSEARLLALIAELNTDRSVNGILLQLPLPAHINEAHALQAIAAAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+++  G DL+G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCMHLLKETCG-DLTGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    VV AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDNALDVVSAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|281491348|ref|YP_003353328.1| bifunctional methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase
           [Lactococcus lactis subsp. lactis KF147]
 gi|281375089|gb|ADA64607.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Lactococcus
           lactis subsp. lactis KF147]
          Length = 284

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 191/288 (66%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +A+ +  ++   V  LK+   V  GLAV+LVG DPAS  YV  K R A   G 
Sbjct: 2   NLIDGKALAAKMQAELKVKVDKLKEADNVP-GLAVILVGEDPASQIYVRNKARQATAIGL 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P  +S+ +L + +   N+ +  HGILVQLPLP  +SE+ ++ +I PEKDVDG 
Sbjct: 61  NSSVVRLPETVSEQELLDLIEQYNQSEQWHGILVQLPLPEHISEEKVLLAIDPEKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++  G+    ++P TPAG + +  ++   +LSG+ AVVIGRSN+ GKPM QLL+
Sbjct: 121 HPMNMGRLWSGNPL--MIPSTPAGIMEMFREY-NVELSGKRAVVIGRSNIVGKPMAQLLM 177

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHSKT+NL E+ + AD+LVVA+GR RM++ + +K G++VIDVG+NR      
Sbjct: 178 MADATVTIAHSKTENLRELTKEADVLVVAIGRDRMIKAEDVKEGAVVIDVGMNRDED--- 234

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  DE K V   ITPVPGGVGPMTI MLM  TV AA R +
Sbjct: 235 GK--LHGDVDFDEVKDVASLITPVPGGVGPMTITMLMEQTVRAASRKI 280


>gi|119369802|sp|Q9CH85|FOLD_LACLA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|326406400|gb|ADZ63471.1| bifunctional methylenetetrahydrofolate dehydrogenase
           NADP+/methenyltetrahydrofolate [Lactococcus lactis
           subsp. lactis CV56]
          Length = 284

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 191/288 (66%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +A+ +  ++   V  LK+   V  GLAV+LVG DPAS  YV  K R A   G 
Sbjct: 2   NLIDGKALAAKMQAELKVKVDKLKEADNVP-GLAVILVGEDPASQIYVRNKARQATAIGL 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P  +S+ +L + +   N+ +  HGILVQLPLP  +SE+ ++ +I PEKDVDG 
Sbjct: 61  NSSVVRLPETVSEQELLDLIEQYNQSEQWHGILVQLPLPEHISEEKVLLAIDPEKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++  G+    ++P TPAG + +  ++   +LSG+ AVVIGRSN+ GKPM QLL+
Sbjct: 121 HPMNMGRLWSGNPL--MIPSTPAGIMEMFREYD-VELSGKRAVVIGRSNIVGKPMAQLLM 177

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHSKT+NL E+ + AD+LVVA+GR RM++ + +K G++VIDVG+NR      
Sbjct: 178 MADATVTIAHSKTENLRELTKEADVLVVAIGRDRMIKAEDVKEGAVVIDVGMNRDED--- 234

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  DE K V   ITPVPGGVGPMTI MLM  TV AA R +
Sbjct: 235 GK--LHGDVDFDEVKDVASLITPVPGGVGPMTITMLMEQTVRAASRKM 280


>gi|319790233|ref|YP_004151866.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Thermovibrio
           ammonificans HB-1]
 gi|317114735|gb|ADU97225.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Thermovibrio
           ammonificans HB-1]
          Length = 284

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 188/285 (65%), Gaps = 8/285 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK ++  +  +I E V  LK+  G    LAVVLVGN+PAS  YV  K +  +  
Sbjct: 1   MAVILDGKALSEKIRAQIKEEVEALKERFGRAPTLAVVLVGNNPASEIYVRNKEKACQKV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +SV    P  ++Q +L   V  LN+D+++ GI+VQLPLP  +S + ++  I PEKDVD
Sbjct: 61  GINSVVLKLPETVTQEELNERVFKLNEDETVDGIIVQLPLPEHLSCREVLNYISPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VNAGK M+G +  GL+PCTPAG +   E++   +L G++AV++G SN+ GKP+  +
Sbjct: 121 GFHPVNAGKCMLGLYDEGLMPCTPAGVMKFFEEY-NIELQGKNAVMVGHSNIVGKPLANM 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATV++ H  TK+L    R ADIL VA G P +++ D +K G++VID+GI+R+N  
Sbjct: 180 LLNANATVSVCHVYTKDLAAYTRQADILCVATGVPHLIKADMVKEGAVVIDIGISRVN-- 237

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
             GK  +VGDV  ++ K    AITPVPGGVGPMTI ML+ NTV A
Sbjct: 238 --GK--IVGDVDFEKVKEKAAAITPVPGGVGPMTITMLLFNTVKA 278


>gi|15672835|ref|NP_267009.1| cyclohydrolase [Lactococcus lactis subsp. lactis Il1403]
 gi|12723780|gb|AAK04951.1|AE006319_5 tetrahydrofolate dehydrogenase/cyclohydrolase [Lactococcus lactis
           subsp. lactis Il1403]
          Length = 294

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 192/288 (66%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDGK +A+ +  ++   V  LK+   V  GLAV+LVG DPAS  YV  K R A   G 
Sbjct: 12  NLIDGKALAAKMQAELKVKVDKLKEADNVP-GLAVILVGEDPASQIYVRNKARQATAIGL 70

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P  +S+ +L + +   N+ +  HGILVQLPLP  +SE+ ++ +I PEKDVDG 
Sbjct: 71  NSSVVRLPETVSEQELLDLIEQYNQSEQWHGILVQLPLPEHISEEKVLLAIDPEKDVDGF 130

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G++  G+    ++P TPAG + +  ++   +LSG+ AVVIGRSN+ GKPM QLL+
Sbjct: 131 HPMNMGRLWSGNPL--MIPSTPAGIMEMFREYD-VELSGKRAVVIGRSNIVGKPMAQLLM 187

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             +ATVT+AHSKT+NL E+ + AD+LVVA+GR RM++ + +K G++VIDVG+NR    + 
Sbjct: 188 MADATVTIAHSKTENLRELTKEADVLVVAIGRDRMIKAEDVKEGAVVIDVGMNR---DED 244

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  L GDV  DE K V   ITPVPGGVGPMTI MLM  TV AA R +
Sbjct: 245 GK--LHGDVDFDEVKDVASLITPVPGGVGPMTITMLMEQTVRAASRKM 290


>gi|315223300|ref|ZP_07865161.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus anginosus F0211]
 gi|315187732|gb|EFU21486.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus anginosus F0211]
          Length = 284

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 187/290 (64%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  L  ++AE V  LK +TG+  GL V+LVG++PAS  YV  K R A   
Sbjct: 1   MAKIIDGKALAEKLQAQLAEKVRKLKDQTGLVPGLVVILVGHNPASQIYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P   +Q +L   +   N+D   HGILVQLPLP  + E++++ +I P+KDVD
Sbjct: 61  GLRSEVVRLPETTTQEELLILIEKYNQDPDWHGILVQLPLPKHIDEEAVLLAIDPDKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G     ++P TPAG + +  ++ G +L G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPMNMGRLWSGHPV--MIPSTPAGIMEMFHEY-GVELEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L EI + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLSEITKKADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE   +   ITPVP GVGPMTI MLM  T  A  RSL
Sbjct: 237 --GK--LIGDVKFDEVSEIASLITPVPRGVGPMTITMLMEQTYRACKRSL 282


>gi|319947474|ref|ZP_08021706.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus australis ATCC 700641]
 gi|319746414|gb|EFV98675.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus australis ATCC 700641]
          Length = 284

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 190/290 (65%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  L  ++AE  A LK ETG   GL V+LVG +PAS  YV  K R A   
Sbjct: 1   MTHVIDGKALAVKLQGELAEKTARLKAETGQVPGLVVILVGENPASQVYVRNKERSALAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  ISQ DL   +   N+D   HGILVQLPLP+ + +++++ +I P KDVD
Sbjct: 61  GFRSEVVRVPESISQEDLLALIDCYNQDPLWHGILVQLPLPAHIDDEAVLLAIDPNKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G+    +VP TPAG + +  ++   D+ G++AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGHLWAGNPV--MVPSTPAGIMEMFREYD-IDVEGKNAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +L +I R ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLAKIARKADILVVAIGRAKFVTADFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  ++   +   ITPVPGGVGPMTI MLM+ T  AA R+L
Sbjct: 237 --GK--LCGDVDYEQVAPLASYITPVPGGVGPMTITMLMSQTYEAAVRAL 282


>gi|315171916|gb|EFU15933.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX1342]
          Length = 281

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIAPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|257875395|ref|ZP_05655048.1| methylenetetrahydrofolate dehydrogenase [Enterococcus casseliflavus
           EC20]
 gi|257809561|gb|EEV38381.1| methylenetetrahydrofolate dehydrogenase [Enterococcus casseliflavus
           EC20]
          Length = 283

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 187/290 (64%), Gaps = 10/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG+LI+GK +A  +        A LK + GV  GL V+LVG D AS +YV  K   A   
Sbjct: 1   MGTLINGKELAEKMQAAFLSETATLKDQ-GVTPGLVVLLVGEDKASQTYVKNKELAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S    +P  I++ +L   +   N DD+ HGILVQLPLP  ++E+ ++ +I PEKDVD
Sbjct: 60  GINSRVARYPESITEAELLAEIEQFNNDDAFHGILVQLPLPKHINEEKVLLAIKPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G      +PCTP G + +   + G +L G++A+VIGRSN+ GKPM  L
Sbjct: 120 GFHPINLGKLFAG--VPDRIPCTPYGIMKMFAAY-GIELEGKNALVIGRSNIVGKPMAHL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+AHSKTKNLP + + ADILVVA+GR   V  D++K G++VIDVG+NR  + 
Sbjct: 177 LLGANATVTIAHSKTKNLPVLAKQADILVVAIGRGHFVTKDFVKEGAVVIDVGMNRDAN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  DE + +   ITPVP GVGPMTI MLMA T+ AA  ++
Sbjct: 236 --GK--LIGDVKFDEVEPIASYITPVPRGVGPMTITMLMAQTIEAAKETM 281


>gi|304407045|ref|ZP_07388699.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           curdlanolyticus YK9]
 gi|304344032|gb|EFM09872.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Paenibacillus
           curdlanolyticus YK9]
          Length = 286

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 201/293 (68%), Gaps = 11/293 (3%)

Query: 1   MGS-LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKH 59
           MG+ +I+GK+++  + +++    A L+++ G+  GLAVVLVG DPAS  YV +K +  + 
Sbjct: 1   MGAQVINGKLISDTIREEVKVEAAKLQQQ-GIVPGLAVVLVGEDPASKVYVGSKEKACQQ 59

Query: 60  CGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDV 119
            GF+S  +    D ++  L   +  LN   SI+GILVQLPLP  ++E+++I +I  +KDV
Sbjct: 60  LGFYSEVHRLGADTTEQQLLALIDKLNNQASINGILVQLPLPKHINEKAVIDAIRVDKDV 119

Query: 120 DGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQ 179
           DG H  + G ++IGD +  L+PCTPAG I LI++  G ++SG+HAV+IGRSN+ GKP+  
Sbjct: 120 DGFHPESVGNLVIGDDS--LLPCTPAGVIELIKR-SGTEISGKHAVIIGRSNIVGKPVAM 176

Query: 180 LLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           LLL  NATV++ HS+T NL EI   ADI+V A+G+P  +   +IK G++VIDVGINR+  
Sbjct: 177 LLLRENATVSICHSRTANLKEIASQADIVVAAIGKPNAIDRSYIKPGAVVIDVGINRLPD 236

Query: 240 PQLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
              GK  LVGDV  ++C    GAITPVPGGVGPMTI MLM NT+ AA ++ G+
Sbjct: 237 ---GK--LVGDVHYEDCLETAGAITPVPGGVGPMTITMLMQNTLKAAKKAHGL 284


>gi|73748501|ref|YP_307740.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Dehalococcoides sp. CBDB1]
 gi|289432549|ref|YP_003462422.1| Methenyltetrahydrofolate cyclohydrolase [Dehalococcoides sp. GT]
 gi|119369670|sp|Q3ZX43|FOLD_DEHSC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|73660217|emb|CAI82824.1| methylenetetrahydrofolate dehydrogenase [Dehalococcoides sp. CBDB1]
 gi|288946269|gb|ADC73966.1| Methenyltetrahydrofolate cyclohydrolase [Dehalococcoides sp. GT]
          Length = 296

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/293 (46%), Positives = 190/293 (64%), Gaps = 8/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I+G  +A+ + ++I   V  LK + G+  GLA VLVG+DPAS SYV +K +M ++ G +
Sbjct: 5   IINGTEIAAAIREEIRSEVTALKTKAGIVPGLATVLVGDDPASHSYVDSKIKMCQNLGIY 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P + +  DL   +  LN D  I GILVQ+PLP+ +SE  ++ +I P+KDVDG H
Sbjct: 65  SEHHPLPQNATNEDLLTLIAKLNADPKISGILVQVPLPAQISESLVLNAINPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++ +G+     +PCTP G   L+ +  G  + G H V++GRSNL GKP+  +LL 
Sbjct: 125 PVNVGRMCLGE--PCFLPCTPHGVQELLIR-SGIKIEGTHVVIVGRSNLVGKPLANILLQ 181

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ HS TKNLPEI R ADILV A+G+P+ +  D ++ G++VIDVG   I  
Sbjct: 182 KAPGANATVTICHSGTKNLPEITRQADILVAAMGKPKFITADMVREGAVVIDVGTTCIGY 241

Query: 240 PQLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
              GK +L GDV  +E K    AITPVP GVGPMTI MLM NT+ AA R++G+
Sbjct: 242 TPEGKRILSGDVDFEEVKEKAFAITPVPKGVGPMTIIMLMLNTLTAAKRAVGL 294


>gi|116627499|ref|YP_820118.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Streptococcus thermophilus LMD-9]
 gi|122267903|sp|Q03LK0|FOLD_STRTD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|116100776|gb|ABJ65922.1| Methenyltetrahydrofolate cyclohydrolase [Streptococcus thermophilus
           LMD-9]
          Length = 284

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 139/290 (47%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + +++ E VA LK++  +  GL V++VG +PAS  YV  K R AK  
Sbjct: 1   MAIIMDGKALAVNMQEQLQEKVARLKEKEWIVPGLVVIMVGENPASQVYVRNKERAAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N+D   HGILVQLPLP+ ++E  I+ ++ P+KDVD
Sbjct: 61  GFHSKTVNLSESISEEELIEVIEKYNQDPLFHGILVQLPLPNHINEMRILLAVDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 178 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 234

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           + GK  L GDV  D+ K  V  ITPVPGGVGPMTI MLM  T  AA RSL
Sbjct: 235 EEGK--LCGDVDFDQVKEKVSMITPVPGGVGPMTITMLMEQTYQAALRSL 282


>gi|295113844|emb|CBL32481.1| methenyltetrahydrofolate cyclohydrolase
           /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Enterococcus sp. 7L76]
          Length = 281

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTIINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|229589806|ref|YP_002871925.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas fluorescens SBW25]
 gi|229361672|emb|CAY48553.1| folD bifunctional protein [Pseudomonas fluorescens SBW25]
          Length = 301

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 182/280 (65%), Gaps = 7/280 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +  ++ E VA L  +  +Q  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 6   LIDGKAAAARVLLQVREDVARLHGQA-IQPALAVILVGNDPASQVYVRNKILRAEEVGIR 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV++  P D S   L   +  LN D +IHGIL+QLPLP+ + E   +++I P+KDVDG H
Sbjct: 65  SVEHRLPSDTSTEQLLILIGQLNADPAIHGILLQLPLPAQMDELRALEAIAPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+E   G DL G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 125 SQNVGGLSQGRAV--LTPCTPSGCLYLLEHTCG-DLRGKHAVVIGRSNIVGKPMAALLLK 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +CR ADI++ AVGR R++   W+K G++VIDVGINRI+    G
Sbjct: 182 ADCSVTVLHSRSHDAQALCRQADIVIAAVGRARLIDASWLKPGAVVIDVGINRIDDD--G 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           ++ LVGDV  D     V AITPVPGGVGPMTIA LM NTV
Sbjct: 240 RSRLVGDVDFDSALPHVAAITPVPGGVGPMTIAFLMKNTV 279


>gi|28869648|ref|NP_792267.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|81731271|sp|Q883B5|FOLD2_PSESM RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|28852890|gb|AAO55962.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 300

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 141/296 (47%), Positives = 194/296 (65%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ +  ++ + V  LK E G++  LAV+LVGNDPAS  Y+  K   A+  G  
Sbjct: 5   IIDGKAAAARVLGQVRDDVHTLKAE-GIEPALAVILVGNDPASEVYIRNKIVRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S+  L   +  LN D S++GIL+QLPLP+ ++E   +Q+I   KDVDG H
Sbjct: 64  SLEHRLPADCSEARLLALIAELNTDRSVNGILLQLPLPAHINEAHALQAIAAAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+++  G DL+G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCMHLLKETCG-DLTGKHAVVIGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    VV AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDNALDVVSAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|327439756|dbj|BAK16121.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Solibacillus silvestris
           StLB046]
          Length = 287

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 137/287 (47%), Positives = 188/287 (65%), Gaps = 10/287 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I+GK +   +   +A  V  LK E G+  GLAV+LVG++PAS +YV+ K +  +  G +
Sbjct: 5   IINGKEIGQEIRTGVATRVQALK-EQGITPGLAVILVGDNPASKTYVANKQKSCEQIGMY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P +IS+  L   +  LN+  SIHGILVQLPLP  ++E  +IQ+I PEKDVDG  
Sbjct: 64  SELVKLPEEISEQALLEQIRELNERASIHGILVQLPLPKHINEDKVIQTISPEKDVDGFS 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            ++ GK+M+G  T   +PCTP G + ++E   G D++G+HAV++GRS++ GKPMGQLLL 
Sbjct: 124 PISVGKMMLGQDT--YLPCTPYGVMKMLEH-AGIDVAGKHAVIVGRSHIVGKPMGQLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           ++ATVT  HSKT +LP   + ADIL+ AVGR   +  + IK G++VIDVGINR    +  
Sbjct: 181 KDATVTYTHSKTPDLPYFTKQADILIAAVGRANFITSEHIKEGAVVIDVGINRNEDNR-- 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
              L GDV  D+   +   ITPVPGGVGPMTI ML+ NTV AA + L
Sbjct: 239 ---LCGDVDFDDVLGIASHITPVPGGVGPMTITMLLENTVQAAEKEL 282


>gi|225018873|ref|ZP_03708065.1| hypothetical protein CLOSTMETH_02823 [Clostridium methylpentosum
           DSM 5476]
 gi|224948343|gb|EEG29552.1| hypothetical protein CLOSTMETH_02823 [Clostridium methylpentosum
           DSM 5476]
          Length = 286

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 190/291 (65%), Gaps = 10/291 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +++ +   +AE VA LK E G+  GLAVVLVG++PAS  YV +K +  +  
Sbjct: 1   MSKIIDGKQISAQVKQAVAEEVAQLKTE-GIHPGLAVVLVGDNPASKVYVGSKEKACEQL 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S +Y  P + ++ +L   V  LN    I+GILVQLPLP  ++E++II +I P KDVD
Sbjct: 60  GIYSEKYLLPGETTEEELLELVEKLNHKPEINGILVQLPLPEQINEETIINAIDPIKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H  N GK+MIGDF    +PCTPAG + LI    G  + G++ VVIGRSN+ GKPM  L
Sbjct: 120 AFHPNNVGKIMIGDFD--FLPCTPAGIMDLIAS-TGVSIEGKNCVVIGRSNIVGKPMSML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +N TVT+ HS+T+NL EI R ADILV AVGRP  V  D +K G++VIDVG+NR+ + 
Sbjct: 177 LLHKNGTVTICHSRTQNLAEITRKADILVAAVGRPNFVTGDMVKEGAVVIDVGMNRLEN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
             GK  L GDV   E       ITPVPGGVGPMTIA LM NTV AA    G
Sbjct: 236 --GK--LCGDVNFAEASERASYITPVPGGVGPMTIATLMRNTVTAAKLQAG 282


>gi|50085630|ref|YP_047140.1| bifunctional protein 5,10-methylene-tetrahydrofolate
           dehydrogenase/5,10-methylene-tetrahydrofolate
           cyclohydrolase [Acinetobacter sp. ADP1]
 gi|81392632|sp|Q6F9E6|FOLD1_ACIAD RecName: Full=Bifunctional protein FolD 1; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|49531606|emb|CAG69318.1| bifunctional protein [Includes: 5, 10-methylene-tetrahydrofolate
           dehydrogenase; 5, 10-methylene-tetrahydrofolate
           cyclohydrolase] [Acinetobacter sp. ADP1]
          Length = 297

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 137/282 (48%), Positives = 186/282 (65%), Gaps = 6/282 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  + +++   V   K + G++  LAVVLVG DPAS  YV  K + A   G  
Sbjct: 13  IIDGKAIAQSVLEEVKLEVERYKAQ-GIEPCLAVVLVGEDPASQVYVRNKVQKAAFVGIR 71

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++ F  D+S+ +L   +  LN +  +HGILVQLPLP  ++E  +++ I P+KDVDG H
Sbjct: 72  SLEFRFDADLSEDELLTQIDRLNTERGVHGILVQLPLPKQINETRVLERIHPQKDVDGFH 131

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP G I L++   G DLSG HAVVIGRSN+ GKPM  LLL 
Sbjct: 132 SENVGGLSQGRDV--LTPCTPTGCIRLLKDSLGDDLSGLHAVVIGRSNIVGKPMAALLLK 189

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+ HSKT+N+ ++C+ ADI+V AVG+  M+   ++K  ++VIDVGINRI + +  
Sbjct: 190 ESCTVTVVHSKTRNIEQVCQQADIVVAAVGKANMINASYLKADAVVIDVGINRIMTHE-- 247

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           KT LVGDV  ++   +V AITPVPGGVGPMTIA LM NT+ A
Sbjct: 248 KTRLVGDVDFEDALPMVSAITPVPGGVGPMTIAYLMKNTLQA 289


>gi|29375560|ref|NP_814714.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Enterococcus faecalis V583]
 gi|227517901|ref|ZP_03947950.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis TX0104]
 gi|227555088|ref|ZP_03985135.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis HH22]
 gi|229546825|ref|ZP_04435550.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis TX1322]
 gi|229548919|ref|ZP_04437644.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis ATCC 29200]
 gi|255971432|ref|ZP_05422018.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T1]
 gi|255974045|ref|ZP_05424631.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T2]
 gi|256761734|ref|ZP_05502314.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T3]
 gi|256852631|ref|ZP_05558002.1| folD protein [Enterococcus faecalis T8]
 gi|256957070|ref|ZP_05561241.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis DS5]
 gi|256960160|ref|ZP_05564331.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           Merz96]
 gi|256962597|ref|ZP_05566768.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           HIP11704]
 gi|257077866|ref|ZP_05572227.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis JH1]
 gi|257086337|ref|ZP_05580698.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis D6]
 gi|257415596|ref|ZP_05592590.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           AR01/DG]
 gi|257418569|ref|ZP_05595563.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T11]
 gi|257421227|ref|ZP_05598217.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           foldD [Enterococcus faecalis X98]
 gi|293382528|ref|ZP_06628462.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis R712]
 gi|293387872|ref|ZP_06632411.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis S613]
 gi|294780568|ref|ZP_06745931.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis PC1.1]
 gi|300859630|ref|ZP_07105718.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Enterococcus faecalis TUSoD Ef11]
 gi|307268059|ref|ZP_07549447.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX4248]
 gi|307271989|ref|ZP_07553256.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0855]
 gi|307278972|ref|ZP_07560031.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0860]
 gi|307289419|ref|ZP_07569373.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0109]
 gi|307290059|ref|ZP_07569983.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0411]
 gi|312900449|ref|ZP_07759756.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0470]
 gi|312906869|ref|ZP_07765866.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis DAPTO 512]
 gi|312952749|ref|ZP_07771611.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0102]
 gi|312978876|ref|ZP_07790602.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis DAPTO 516]
 gi|81437165|sp|Q836W7|FOLD_ENTFA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|29343021|gb|AAO80784.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis V583]
 gi|227074655|gb|EEI12618.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis TX0104]
 gi|227175756|gb|EEI56728.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis HH22]
 gi|229305940|gb|EEN71936.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis ATCC 29200]
 gi|229307990|gb|EEN73977.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis TX1322]
 gi|255962450|gb|EET94926.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T1]
 gi|255966917|gb|EET97539.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T2]
 gi|256682985|gb|EEU22680.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T3]
 gi|256711976|gb|EEU27013.1| folD protein [Enterococcus faecalis T8]
 gi|256947566|gb|EEU64198.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis DS5]
 gi|256950656|gb|EEU67288.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           Merz96]
 gi|256953093|gb|EEU69725.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           HIP11704]
 gi|256985896|gb|EEU73198.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis JH1]
 gi|256994367|gb|EEU81669.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis D6]
 gi|257157424|gb|EEU87384.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           ARO1/DG]
 gi|257160397|gb|EEU90357.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis T11]
 gi|257163051|gb|EEU93011.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methenyltetrahydrofolate cyclohydrolase
           foldD [Enterococcus faecalis X98]
 gi|291080076|gb|EFE17440.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis R712]
 gi|291082719|gb|EFE19682.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Enterococcus faecalis S613]
 gi|294452395|gb|EFG20834.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis PC1.1]
 gi|300850448|gb|EFK78197.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Enterococcus faecalis TUSoD Ef11]
 gi|306498901|gb|EFM68395.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0411]
 gi|306499674|gb|EFM69037.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0109]
 gi|306504359|gb|EFM73570.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0860]
 gi|306511336|gb|EFM80339.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0855]
 gi|306515700|gb|EFM84227.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX4248]
 gi|310627123|gb|EFQ10406.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis DAPTO 512]
 gi|310629265|gb|EFQ12548.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0102]
 gi|311288313|gb|EFQ66869.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis DAPTO 516]
 gi|311292425|gb|EFQ70981.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0470]
 gi|315026955|gb|EFT38887.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX2137]
 gi|315029668|gb|EFT41600.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX4000]
 gi|315031735|gb|EFT43667.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0017]
 gi|315034208|gb|EFT46140.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0027]
 gi|315144362|gb|EFT88378.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX2141]
 gi|315147930|gb|EFT91946.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX4244]
 gi|315153055|gb|EFT97071.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0031]
 gi|315156827|gb|EFU00844.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0043]
 gi|315157614|gb|EFU01631.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0312]
 gi|315162958|gb|EFU06975.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0645]
 gi|315165156|gb|EFU09173.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX1302]
 gi|315168056|gb|EFU12073.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX1341]
 gi|315574277|gb|EFU86468.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0309B]
 gi|315581568|gb|EFU93759.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0309A]
 gi|323480218|gb|ADX79657.1| folD [Enterococcus faecalis 62]
          Length = 281

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|120611130|ref|YP_970808.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Acidovorax citrulli AAC00-1]
 gi|158705704|sp|A1TPZ6|FOLD_ACIAC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|120589594|gb|ABM33034.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Acidovorax citrulli AAC00-1]
          Length = 283

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 186/289 (64%), Gaps = 10/289 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG  ++  L   +A   A LK E G   GLAVVLVG++PAS  YV  K +  +  G 
Sbjct: 4   QLIDGNALSRQLRADVARRAALLK-ERGTTPGLAVVLVGDNPASQVYVRNKVKACEESGL 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV   +   +S+ +L   V +LN D SIHGILVQLPLP+ +  Q +I++I P KDVDG 
Sbjct: 63  HSVLEKYDAAMSEAELLARVDALNNDPSIHGILVQLPLPAHIDAQKVIEAISPAKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ +AG +M G    G  PCTP G + ++E   G DL G+HAVVIGRSN+ GKPM  +LL
Sbjct: 123 HIASAGALMTG--MPGFWPCTPYGCMKMLEHI-GYDLRGKHAVVIGRSNIVGKPMALMLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +++ATVT+ HS+T +L      AD++V AVGR  ++  D +K G++VIDVG+NR +  + 
Sbjct: 180 AKDATVTVCHSRTADLKAQTLQADVIVAAVGRRNVLTADMVKPGAVVIDVGMNRNDEGR- 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
               L GDV  D  + V G ITPVPGGVGPMTI ML+ NT+ AA R+ G
Sbjct: 239 ----LCGDVDFDGVREVAGHITPVPGGVGPMTITMLLVNTLEAAERAAG 283


>gi|311030980|ref|ZP_07709070.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Bacillus
           sp. m3-13]
          Length = 291

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 184/285 (64%), Gaps = 13/285 (4%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++ GK +A      I E V+ L  E  +Q  LAV+LVG DPAS SYV AK +  +  G  
Sbjct: 5   IVSGKDLAVEKRAFIKEKVSELHTEKSIQPSLAVILVGQDPASQSYVRAKQKACEEAGIK 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+   +P  I+Q +L N +   N D S+HGILVQLPLP  + E ++I+ I P KDVDG H
Sbjct: 65  SILEEYPSSITQEELLNRITHFNDDTSVHGILVQLPLPDHIDELAVIEHISPNKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCD--LSGQHAVVIGRSNLFGKPMGQLL 181
            VN G++MI       +PCTP G   ++E  K  D  +SG+H VVIGRSN+ GKP+GQLL
Sbjct: 125 PVNIGRMMIDQ--KSFLPCTPYG---IVEMIKSLDVSISGKHVVVIGRSNIVGKPVGQLL 179

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  +ATVT  HS+TK+L  I + ADIL+ AVGR +++  +++K G++VIDVG+NR+ +  
Sbjct: 180 LKEDATVTYCHSRTKDLASITKQADILIAAVGRAKLIGPEYVKDGAIVIDVGVNRLET-- 237

Query: 242 LGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
            GK  L GDV  E  K     ITPVPGGVGPMTI ML+ NT+ +A
Sbjct: 238 -GK--LCGDVDFESVKEKASFITPVPGGVGPMTITMLLHNTLQSA 279


>gi|154174422|ref|YP_001407944.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Campylobacter curvus 525.92]
 gi|166988383|sp|A7GXK2|FOLD_CAMC5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|112802124|gb|EAT99468.1| bifunctional protein FolD [Campylobacter curvus 525.92]
          Length = 288

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 194/283 (68%), Gaps = 10/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK  ++ +  ++ E  + LK   G++  LAV+LVG+D AS +YV+AK +  +  G  
Sbjct: 3   ILDGKATSAKVKAEVKERASALK-NAGIEPALAVILVGSDKASQTYVAAKQKACEASGIR 61

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV +  P   SQ +L   +  LN DDSI GILVQLPLP+ +   S++++I P+KDVDG H
Sbjct: 62  SVMHKLPQTTSQNELLALINVLNLDDSIDGILVQLPLPAHIDTTSVLETIWPQKDVDGFH 121

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N GK++ G    G VPCTP G + +++++ G D++G +AVVIGRSN+ GKPM  LLL+
Sbjct: 122 AENVGKLVSG--LDGFVPCTPLGIMRILKEY-GIDVAGLNAVVIGRSNIVGKPMASLLLN 178

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT+ HSKT+NL +IC  AD++V A+G+P  V  D +K G++VIDVGINR++  +  
Sbjct: 179 ASATVTITHSKTRNLKQICSAADLIVAAIGKPNFVTADMVKEGAIVIDVGINRLDDGR-- 236

Query: 244 KTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAA 285
              LVGDV  E  +   + ITPVPGGVGPMTIAML++NT+ +A
Sbjct: 237 ---LVGDVDFEAVAPKSSFITPVPGGVGPMTIAMLLSNTIRSA 276


>gi|299532224|ref|ZP_07045618.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Comamonas testosteroni S44]
 gi|298719886|gb|EFI60849.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Comamonas testosteroni S44]
          Length = 284

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 191/288 (66%), Gaps = 9/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK ++  L  ++A   A LK + G+  GLAVVLVG++ AS  YV  K +  +  GFH
Sbjct: 5   LIDGKALSEQLRKEVATRAAALKAK-GITPGLAVVLVGDNQASQVYVRNKVKACEDVGFH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +   +++ +L   V +LN D SIHGILVQLPLP  + +  +I++I P KDVDG H
Sbjct: 64  SVLEKYDASMTEAELLARVEALNNDPSIHGILVQLPLPKHIDDHKVIETISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M+G+   G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 124 VASAGALMVGEV--GFKACTPYGCMKMLESIGMKDLRGKHAVVIGRSNIVGKPMAMMLLA 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS T +L  + R ADI+V AVG+  ++  D +K G++VIDVG+NR N+   G
Sbjct: 182 ANATVTVAHSGTADLAAMTRQADIIVAAVGKVDVLTADMVKPGAVVIDVGMNR-NAE--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV  +  K V G ITPVPGGVGPMTI ML+ NT+ +A R+ G
Sbjct: 239 K--LCGDVDFNGVKEVAGYITPVPGGVGPMTITMLLVNTMESAERAAG 284


>gi|320530430|ref|ZP_08031488.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Selenomonas artemidis F0399]
 gi|320137263|gb|EFW29187.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Selenomonas artemidis F0399]
          Length = 288

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 183/288 (63%), Gaps = 12/288 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++ GK  A+ + +    +VA LK E GV   LAVV+VG DPAS  YV  K +     
Sbjct: 1   MARILSGKEFAAKIKEDAGRAVAELKAE-GVHPRLAVVIVGADPASEVYVRNKQKACAEL 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVS--EQSIIQSIVPEKD 118
           G  S     P D ++ +L   + +LN D S+HGILVQLPLP  +   E+ +++ I P KD
Sbjct: 60  GIISDHIALPADTAKEELITRIDALNADASVHGILVQLPLPEGLRAYEEEVLERIDPRKD 119

Query: 119 VDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMG 178
           VDG H VN G++++G    GL PCTPAG I ++E   G  + G HAV+IGRSN+ GKPMG
Sbjct: 120 VDGFHPVNVGRLVLG--APGLRPCTPAGCIRMLE-LAGIPIEGAHAVIIGRSNIVGKPMG 176

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LLL RNATVT+ HS+T+NL  + R ADILV AVGRP  V  D +K G+ VIDVGINRI 
Sbjct: 177 HLLLERNATVTVCHSRTQNLAAVAREADILVAAVGRPGFVTADMVKPGATVIDVGINRIA 236

Query: 239 SPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             +     LVGDV  +    + GAITPVPGGVG +T+AMLM N V AA
Sbjct: 237 PKK-----LVGDVDFNAVSEIAGAITPVPGGVGLLTVAMLMQNVVQAA 279


>gi|307275460|ref|ZP_07556602.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX2134]
 gi|306507848|gb|EFM76976.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX2134]
 gi|327534565|gb|AEA93399.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Enterococcus faecalis OG1RF]
          Length = 281

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AV+IGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVIIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|315149500|gb|EFT93516.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0012]
          Length = 281

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGYFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|167033111|ref|YP_001668342.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas putida GB-1]
 gi|190359412|sp|B0KLM9|FOLD2_PSEPG RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|166859599|gb|ABY98006.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Pseudomonas
           putida GB-1]
          Length = 303

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 185/283 (65%), Gaps = 9/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +  ++ E V  L+ + GVQ GL VVLVG D AS  YV  K   A+  G  
Sbjct: 9   LIDGKATAARVLAEVREQVQELR-QGGVQPGLVVVLVGADAASQVYVRNKVLRAEEVGIR 67

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S ++  P D +Q  L   +  LN+D  ++GILVQLPLP+ + E  ++Q+I P KDVDG H
Sbjct: 68  SQEHRLPADTTQAHLLTLIDRLNRDPEVNGILVQLPLPAHIDEHCVLQAINPLKDVDGFH 127

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+    G +L G+HAVV+GRSN+ GKPM  LLL 
Sbjct: 128 SENVGGLAQGRDV--LTPCTPSGCMRLLRDACG-ELRGKHAVVVGRSNIVGKPMAALLLQ 184

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+ HS++++LP +CR ADILV AVG+PR++  D +K G++VIDVGINRIN    G
Sbjct: 185 ADCTVTVVHSRSRDLPALCRQADILVAAVGKPRLIGADCLKPGAVVIDVGINRINED--G 242

Query: 244 KTVLVGDV--ADECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
           +  LVGDV  A     V G ITPVPGGVGPMTIA LM NT++A
Sbjct: 243 QNHLVGDVDFAAALPQVAG-ITPVPGGVGPMTIAYLMKNTLLA 284


>gi|55822581|ref|YP_141022.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Streptococcus thermophilus CNRZ1066]
 gi|55738566|gb|AAV62207.1| methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate
           cyclohydrolase [Streptococcus thermophilus CNRZ1066]
          Length = 288

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 139/290 (47%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + +++ E VA LK++  +  GL V++VG +PAS  YV  K R AK  
Sbjct: 5   MAIIMDGKALAVNMQEQLQEKVARLKEKEWIVPGLVVIMVGENPASQVYVRNKERAAKKA 64

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N++   HGILVQLPLP+ ++E  I+ +I P+KDVD
Sbjct: 65  GFHSKTVNLSESISEEELIEVIEKYNQNPLFHGILVQLPLPNHINEMRILLAIDPKKDVD 124

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 125 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 181

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 182 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 238

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           + GK  L GDV  D+ K  V  ITPVPGGVGPMTI MLM  T  AA RSL
Sbjct: 239 EEGK--LCGDVDFDQVKEKVSMITPVPGGVGPMTITMLMEQTYQAALRSL 286


>gi|312867062|ref|ZP_07727272.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus parasanguinis F0405]
 gi|311097191|gb|EFQ55425.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus parasanguinis F0405]
          Length = 284

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 147/290 (50%), Positives = 193/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A+ L  +IAE  A LKKETGV  GL V++VG++PAS  YV  K R A   
Sbjct: 1   MTTIIDGKALATKLQGEIAEKTARLKKETGVVPGLVVIVVGDNPASKIYVRNKERSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  ISQ +L   +   N+D   HGILVQLPLP  +   +++ +I P KDVD
Sbjct: 61  GFRSEVRRLPESISQAELLEVIEHYNQDPLWHGILVQLPLPKHIDADAVLLAIDPTKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G+    +VP TPAG + + +++ G DL G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWAGNPL--MVPSTPAGIMEMFKEY-GIDLEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +LP+I R ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLPKIARRADILVVAIGRAKFVTADFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMT+ MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDFDSVAPLASHITPVPGGVGPMTVTMLMEQTYEAAVRAL 282


>gi|3023795|sp|P96050|FOLD_STRTR RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|119370065|sp|Q5M0P7|FOLD_STRT1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|1685110|gb|AAC44612.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Streptococcus
           thermophilus]
          Length = 284

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 139/290 (47%), Positives = 192/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK +A  + +++ E VA LK++  +  GL V++VG +PAS  YV  K R AK  
Sbjct: 1   MAIIMDGKALAVNMQEQLQEKVARLKEKEWIVPGLVVIMVGENPASQVYVRNKERAAKKA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GFHS   N    IS+ +L   +   N++   HGILVQLPLP+ ++E  I+ +I P+KDVD
Sbjct: 61  GFHSKTVNLSESISEEELIEVIEKYNQNPLFHGILVQLPLPNHINEMRILLAIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGNLWNG--RPQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    
Sbjct: 178 LLEKNATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---D 234

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           + GK  L GDV  D+ K  V  ITPVPGGVGPMTI MLM  T  AA RSL
Sbjct: 235 EEGK--LCGDVDFDQVKEKVSMITPVPGGVGPMTITMLMEQTYQAALRSL 282


>gi|289434641|ref|YP_003464513.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170885|emb|CBH27427.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 284

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 192/291 (65%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  +  K+   VA L K  G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGQIIDGKKLAKEIQGKVTTEVAELAK-NGKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +S+  L   V  LN D++IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLMELPETVSEEKLLEVVEELNTDETIHGILVQLPLPKHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG  +   VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIGKDS--FVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LPE+ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPEVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V      D+   V G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDV----DFDDVVDVAGFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|160899417|ref|YP_001564999.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Delftia
           acidovorans SPH-1]
 gi|226704343|sp|A9BWT7|FOLD_DELAS RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|160365001|gb|ABX36614.1| Methenyltetrahydrofolate cyclohydrolase [Delftia acidovorans SPH-1]
          Length = 284

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 187/288 (64%), Gaps = 9/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDG  ++  L  ++A+    LK   G   GLAVVLVG++PAS  YV  K +  +  GFH
Sbjct: 5   LIDGNALSRQLRAEVAQRATALKAR-GTTPGLAVVLVGDNPASQVYVRNKVKACEDAGFH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +   +++ +L   V +LN D SIHGILVQLPLP+ + +  +I++I P KDVDG H
Sbjct: 64  SVLEKYDASMTEAELLARVEALNNDPSIHGILVQLPLPAHIDDHKVIETISPLKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M+G+   G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 124 VASAGALMVGEV--GFKACTPYGCMKMLESIGMKDLRGKHAVVIGRSNIVGKPMAMMLLA 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+ HS T +L  + R ADI+V AVG+  ++  D  K G++VIDVG+NR +    G
Sbjct: 182 ANATVTICHSGTADLAAMTRQADIVVAAVGKRNVLTADMCKPGAVVIDVGMNRNDE---G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ AA R+ G
Sbjct: 239 K--LCGDVDFDGVKEVAGFITPVPGGVGPMTITMLLVNTMEAAERAAG 284


>gi|330967628|gb|EGH67888.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 300

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 190/285 (66%), Gaps = 7/285 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +++ + V  LK E G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVRDDVHTLKAE-GIEPALAVILVGNDPASEVYVRNKIVRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S+  L   +  LN D S++GIL+QLPLP+ + E   +Q+I   KDVDG H
Sbjct: 64  SLEHCLPADCSEARLLALIAELNNDRSVNGILLQLPLPAHIDEARALQAIAAAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+++  G DL+G+HAVV+GRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCMHLLKETCG-DLTGKHAVVVGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           ++ LVGDV  D    VV AITPVPGGVGPMTIA LM NTV AA +
Sbjct: 239 RSRLVGDVDFDNVLDVVSAITPVPGGVGPMTIAFLMKNTVTAARQ 283


>gi|172056941|ref|YP_001813401.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Exiguobacterium sibiricum 255-15]
 gi|226704360|sp|B1YLQ1|FOLD_EXIS2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|171989462|gb|ACB60384.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Exiguobacterium
           sibiricum 255-15]
          Length = 277

 Score =  251 bits (641), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 187/286 (65%), Gaps = 11/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA     K+ E VA LK+E  +Q  L V+L+G DPAS SYV  K + A+  
Sbjct: 1   MAVVIDGKQVAQSYRLKLKEEVARLKEER-IQPKLTVILIGEDPASQSYVRGKEKAAQEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P +  + +L + +  LN D S+HGILVQLPLP  + E  +I +I PEKDVD
Sbjct: 60  GMDSDLIRLPEETKESELLHLIERLNADASVHGILVQLPLPKHIDESKVIFAIAPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H V+ GK+MIG+ T   +PCTP G + L+++     ++G+H VV+GRS + GKP+G L
Sbjct: 120 GFHPVSVGKMMIGEPT--FLPCTPNGILHLVKEM-NVPIAGRHVVVVGRSQIVGKPVGML 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L+ +ATVT  HSKT +L  + R ADIL+VAVG P+++  D +K  ++VIDVG+NR++  
Sbjct: 177 FLNESATVTYCHSKTADLGAMTRQADILIVAVGVPKLITADMVKPEAVVIDVGVNRVD-- 234

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  LVGDV  E  K V   ITPVPGGVGPMTI ML+ NT+ AA
Sbjct: 235 --GK--LVGDVEFEAVKEVASMITPVPGGVGPMTITMLLHNTIEAA 276


>gi|322418853|ref|YP_004198076.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacter sp.
           M18]
 gi|320125240|gb|ADW12800.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Geobacter sp.
           M18]
          Length = 281

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/290 (46%), Positives = 187/290 (64%), Gaps = 10/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ +  +I+   A LK E G+  GLAVVLVG DPAS  YVS K +     
Sbjct: 1   MAKIIDGKAIAAKIRAEISAEAAKLK-EKGIVPGLAVVLVGEDPASKVYVSMKEKACTDV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S +Y  P +  + +L   +  LN D  IHGILVQLPLP  ++ + ++++I P+KD D
Sbjct: 60  GIFSDEYKLPAETEEAELLALIEKLNADPKIHGILVQLPLPRQINTERVLEAISPDKDAD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G+++IG       PCTP G ++++++  G +LSG+  VV+GRSN+ GKP+  +
Sbjct: 120 GFHPYNVGRLVIGKPL--FQPCTPYGVMVMLKE-AGVELSGKEVVVVGRSNIVGKPVAFM 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L +NATVT+ HSKT++LP     AD+++ AVG P M++  WIK G++VIDVG+NR+   
Sbjct: 177 CLQQNATVTLCHSKTRDLPAKVAQADVVIAAVGVPEMIKGAWIKEGAVVIDVGVNRV--- 233

Query: 241 QLGKTVLVGDVADECKSV-VGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             G+  LVGDV     S    AITPVPGGVGPMTI ML+ NT+ +A R L
Sbjct: 234 --GEKKLVGDVEYAAASERASAITPVPGGVGPMTITMLLQNTLESAKRGL 281


>gi|325263868|ref|ZP_08130601.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Clostridium sp. D5]
 gi|324030906|gb|EGB92188.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Clostridium sp. D5]
          Length = 279

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/287 (46%), Positives = 191/287 (66%), Gaps = 8/287 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK++++ + D++ E V  +  E G  + LAVV VG+DPAS  YV+ K +   + 
Sbjct: 1   MAQIIDGKLISAQIKDELKEEVKKIN-ENGGHICLAVVQVGDDPASSVYVNNKKKACAYI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S  Y  P   ++ +L + V  LN D  ++GILVQLPLP  ++E  +I++I P+KDVD
Sbjct: 60  GIESRAYELPETTTEAELVSLVEELNADSEVNGILVQLPLPPHINEDLVIRTISPDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + G++ IG+   G + CTPAG I L+++ +  ++ G+  VVIGRSN+ GKPM  L
Sbjct: 120 GFHPGSVGRLWIGE--KGFLSCTPAGIIQLLKRSE-IEIEGKECVVIGRSNIVGKPMAAL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+AHS+TKNL E+ R ADIL+VA+G+ + +  +++K G++VIDVG++R  + 
Sbjct: 177 LLRENGTVTVAHSRTKNLKEVARRADILIVAIGKRQFINAEYVKDGAVVIDVGMHRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +L   V   DVAD+    V AITPVPGGVGPMTIAMLM N V  A R
Sbjct: 237 KLCGDVDFTDVADK----VSAITPVPGGVGPMTIAMLMNNCVETARR 279


>gi|331695937|ref|YP_004332176.1| Bifunctional protein folD [Pseudonocardia dioxanivorans CB1190]
 gi|326950626|gb|AEA24323.1| Bifunctional protein folD [Pseudonocardia dioxanivorans CB1190]
          Length = 277

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 186/283 (65%), Gaps = 14/283 (4%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA+ +  ++A  VA L +  G    LA +LVG+DPAS  YV  K R+    G  
Sbjct: 5   IIDGKAVAARVRAEVARDVAALDRVPG----LATLLVGDDPASAIYVRNKRRLCVEAGMA 60

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
            +  + P D+SQ +L   +  L  D  + GIL+QLPLP  +    +I  I  +KDVDGL 
Sbjct: 61  DLHRHLPGDVSQAELAAVIDELAADPDVTGILLQLPLPGHLDAAPLIARIPADKDVDGLT 120

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            V+AG++ +G    GL PCTP+G ++L+++  G DL+G  AVV+GRS+L GKP G LLL+
Sbjct: 121 EVSAGRLALG--RPGLRPCTPSGVMVLLDE-AGVDLAGAEAVVVGRSDLVGKPQGALLLA 177

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           RNATVT  HS+T++L  +CR AD+LVVA GRP ++  D +K G++VIDVGI+R      G
Sbjct: 178 RNATVTTCHSRTRDLAAVCRRADVLVVAAGRPGLIGADAVKPGAVVIDVGIHR------G 231

Query: 244 KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           +  LVGDV   E   V GAITPVPGGVGPMTIAML+ NTV AA
Sbjct: 232 EHGLVGDVRTAEVAEVAGAITPVPGGVGPMTIAMLLRNTVTAA 274


>gi|315303025|ref|ZP_07873736.1| bifunctional protein FolD [Listeria ivanovii FSL F6-596]
 gi|313628607|gb|EFR97029.1| bifunctional protein FolD [Listeria ivanovii FSL F6-596]
          Length = 284

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 147/291 (50%), Positives = 192/291 (65%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  + + +   VA L K TG + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGQIIDGKKLAKEIQENVTTEVAELVK-TGKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +S+  L   V  LN DD+IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLIELPETVSEEKLLEVVEELNTDDTIHGILVQLPLPKHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG  +   VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIGKDS--FVPCTPAGIIELIKS-TGTPIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LPE+ + ADILVVA G  + V+ ++IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPEVAKEADILVVATGLAKFVKKNYIKPGAVVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V       +   V G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDV----DFADVVDVAGFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|312960306|ref|ZP_07774817.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas fluorescens WH6]
 gi|311285528|gb|EFQ64098.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Pseudomonas fluorescens WH6]
          Length = 301

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 183/280 (65%), Gaps = 7/280 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ +  ++ E VA L  +  +Q  LAV+LVG+DPAS  YV  K   A   G  
Sbjct: 6   LIDGKAAAARVLLQVREDVARLLAQD-IQPALAVILVGSDPASQVYVRNKILRADEVGIR 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S   L   +  LN + +IHGIL+QLPLP+ + E   +++I P KDVDG H
Sbjct: 65  SLEHRLPGDTSTEQLLILIGQLNTNPAIHGILLQLPLPAQIDELRALEAIAPHKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L+PCTP+G + L+EQ  G DL G+HAVVIGRSN+ GKPM  LLL 
Sbjct: 125 SQNVGGLSQGRAV--LMPCTPSGCLYLLEQTCG-DLRGKHAVVIGRSNIVGKPMAALLLK 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS+++N   +CR ADI++ AVGR R+V   W+K G++VIDVGINRI+    G
Sbjct: 182 ADCSVTVLHSRSQNAQALCRQADIVIAAVGRARLVDASWLKPGAVVIDVGINRIDDD--G 239

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           ++ LVGDV  D     V AITPVPGGVGPMTIA LM NTV
Sbjct: 240 RSRLVGDVDFDSALPHVAAITPVPGGVGPMTIAFLMKNTV 279


>gi|73667294|ref|YP_303310.1| methenyltetrahydrofolate cyclohydrolase [Ehrlichia canis str. Jake]
 gi|119369790|sp|Q3YRE3|FOLD_EHRCJ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|72394435|gb|AAZ68712.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Ehrlichia canis
           str. Jake]
          Length = 300

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 181/293 (61%), Gaps = 4/293 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            ++I+GK +A  +T  +A  +  LK +  +   L VVLVG+DPAS  YV  K R A+  G
Sbjct: 3   ANIINGKAIAEDITGTLATCINDLKLQYSLVPCLIVVLVGDDPASHLYVRNKQRKAEMLG 62

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S     P   S+  L + +  LN DD++HGILVQLP+P  + +  II +I P KDVDG
Sbjct: 63  LRSETILLPSTTSESSLIDKIHELNNDDNVHGILVQLPVPKHIDKNLIINTIDPRKDVDG 122

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H  N G++  G     L+PCTP G + LI+     +LSG  AVVIGRSN+ GKPM  LL
Sbjct: 123 FHNDNVGRLFTGQKRNCLIPCTPRGCLYLIKTVTH-NLSGSDAVVIGRSNIVGKPMACLL 181

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  N TVT  HS T+NL + C  ADILV AVG P  V+  WIK G++VIDVGIN +    
Sbjct: 182 LGENCTVTTVHSATRNLSDYCSKADILVAAVGIPNFVKSSWIKPGAIVIDVGINSVEEDG 241

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
           + K   VGDV   E K+V  AITPVPGGVGPMTIA LM NTV+AA    G+++
Sbjct: 242 VKK--FVGDVNFAEAKNVASAITPVPGGVGPMTIAFLMVNTVMAACNQSGIEN 292


>gi|330876861|gb|EGH11010.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 300

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 193/296 (65%), Gaps = 7/296 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK  A+ + +++ + V  LK E G++  LAV+LVGNDPAS  YV  K   A+  G  
Sbjct: 5   IIDGKAAAARVLEQVRDDVHTLKAE-GIEPALAVILVGNDPASEVYVRNKIVRAEEAGIR 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S+++  P D S+  L   +  LN D S++GIL+QLPLP+ + E   +Q+I   KDVDG H
Sbjct: 64  SLEHCLPADCSEARLLALIAELNNDRSVNGILLQLPLPAHIDEARALQAIAAAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G     L PCTP+G + L+++  G DL+G+HAVV+GRSN+ GKPM  LLL 
Sbjct: 124 SENVGGLSQGRNV--LTPCTPSGCMHLLKETCG-DLTGKHAVVVGRSNIVGKPMAALLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + +VT+ HS++ +   +C+ ADI+V AVGRPRM+   W+K G++VIDVGINRI+    G
Sbjct: 181 AHCSVTVVHSRSTDAKALCQLADIVVAAVGRPRMIDAGWLKPGAVVIDVGINRIDDQ--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDA 298
           ++ LVGDV  D    V  AITPVPGGVGPMTIA LM NTV AA +    +  + +A
Sbjct: 239 RSRLVGDVDFDSALGVASAITPVPGGVGPMTIAFLMKNTVTAARQQAHAQRSQSEA 294


>gi|218437607|ref|YP_002375936.1| Methenyltetrahydrofolate cyclohydrolase [Cyanothece sp. PCC 7424]
 gi|226704341|sp|B7KEP3|FOLD_CYAP7 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|218170335|gb|ACK69068.1| Methenyltetrahydrofolate cyclohydrolase [Cyanothece sp. PCC 7424]
          Length = 301

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 188/286 (65%), Gaps = 6/286 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK +A  +   + E +  L+ + G   GLAV++VG++PAS  YV  K +     G  
Sbjct: 8   ILDGKALAQKIQLSLKEEIQTLQPKIGRPPGLAVLMVGDNPASAVYVRNKEKSCTKVGMA 67

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S   +FP + SQ +LE  +  LN+D  + GIL+QLPLP  +   +++  I PEKD DGLH
Sbjct: 68  SFGRHFPGETSQSELEQVIEELNQDSRVDGILIQLPLPDHLDGIALLHQINPEKDADGLH 127

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G+++ G+   GL  CTPAG + L+E++   ++ G+HAVVIGRS L GKPMG +LL 
Sbjct: 128 PTNLGRLVRGE--PGLRSCTPAGVMALLEEYN-LEVKGKHAVVIGRSILVGKPMGLMLLE 184

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+AHS T+NL E+ R+ADILV A G+  ++  + +K G++VIDVGINRI   + G
Sbjct: 185 ENATVTIAHSLTQNLTELTRSADILVAAAGKANLITPEMVKPGAVVIDVGINRIED-ESG 243

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  LVGDV  E    V   ITPVPGG+GPMT+AML++NTV  +YR 
Sbjct: 244 KARLVGDVDYEGVAEVAQYITPVPGGIGPMTVAMLLSNTVY-SYRQ 288


>gi|157163934|ref|YP_001466481.1| tetrahydrofolate dehydrogenase/cyclohydrolase NAD(P)-binding
           domain-containing protein [Campylobacter concisus 13826]
 gi|171855052|sp|A7ZCH3|FOLD_CAMC1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|112800646|gb|EAT97990.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Campylobacter concisus 13826]
          Length = 283

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/284 (48%), Positives = 189/284 (66%), Gaps = 10/284 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DGK V+  + + +      LKK  GV+  LAVVLVG D AS +YV AK +     G 
Sbjct: 2   KILDGKAVSLKVKESVKVRADELKK-FGVEPTLAVVLVGEDKASQTYVRAKEKACNEYGI 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV +    + +Q +L   +  LN DDSIHGILVQLPLP  +    ++ +I P KDVDG 
Sbjct: 61  KSVAHRLSENTTQNELLALINVLNLDDSIHGILVQLPLPKHIDTNVVLAAIDPRKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN GK++ G    G VPCTP G + +++++ G +++G +AVVIGRSN+ GKPM  LLL
Sbjct: 121 HAVNVGKLVSG--LDGFVPCTPLGVMEILKEY-GIEVAGLNAVVIGRSNIVGKPMANLLL 177

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + +ATVT+ HSKTKNL EIC+ AD++V A+G+P  ++ D +K G++V+DVGINR++  + 
Sbjct: 178 NASATVTVTHSKTKNLKEICKNADLIVAAIGKPFFLKADMVKDGAVVVDVGINRLDDGR- 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
               LVGDV  DE       ITPVPGGVGPMTIAML+ NT++AA
Sbjct: 237 ----LVGDVDFDEVAPKCSYITPVPGGVGPMTIAMLLNNTILAA 276


>gi|313638046|gb|EFS03324.1| bifunctional protein FolD [Listeria seeligeri FSL S4-171]
          Length = 284

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 192/291 (65%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +A  +  K+   VA L K  G + GLAVVLVG++ AS +YV  K +  +  
Sbjct: 1   MGQIIDGKKLAKEIQGKVTTEVAELAK-NGKKPGLAVVLVGDNQASRTYVRNKQKRTEEA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV    P  +S+  L   V  LN D++IHGILVQLPLP  +SE+ +I +I  +KDVD
Sbjct: 60  GMKSVLMELPETVSEEKLLEVVEELNIDETIHGILVQLPLPKHISEEKVIDTISYDKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G + IG  +   VPCTPAG I LI+   G  + G+ AVVIGRSN+ GKP+ QL
Sbjct: 120 GFHPVNVGNLFIGKDS--FVPCTPAGIIELIKS-TGTQIEGKRAVVIGRSNIVGKPVAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+AHS+TK+LPE+ + ADILVVA G  + V+ D+IK G++VIDVG++R  + 
Sbjct: 177 LLNENATVTIAHSRTKDLPEVAKEADILVVATGLAKFVKKDYIKPGAVVIDVGMDRDENN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           +L   V      D+   V G ITPVPGGVGPMTI ML+ANT+ AA R   M
Sbjct: 237 KLCGDV----DFDDVVDVAGFITPVPGGVGPMTITMLLANTLKAAKRIWKM 283


>gi|257081231|ref|ZP_05575592.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           E1Sol]
 gi|256989261|gb|EEU76563.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           E1Sol]
          Length = 281

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  V E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHVDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA +E   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFNEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|264678379|ref|YP_003278286.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Comamonas
           testosteroni CNB-2]
 gi|262208892|gb|ACY32990.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Comamonas
           testosteroni CNB-2]
          Length = 300

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 190/288 (65%), Gaps = 9/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK ++  L  ++A   A LK + GV  GLAVVLVG++ AS  YV  K +  +  GFH
Sbjct: 21  LIDGKALSEQLRKEVATRAAALKAK-GVTPGLAVVLVGDNQASQVYVRNKVKACEDVGFH 79

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +   +++ +L   V +LN D SIHGILVQLPLP  + +  +I++I P KDVDG H
Sbjct: 80  SVLEKYDASMTEAELLARVEALNNDPSIHGILVQLPLPKHIDDHKVIETISPAKDVDGFH 139

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M+G+   G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 140 VASAGALMVGE--VGFKACTPYGCMKMLESIGMKDLRGRHAVVIGRSNIVGKPMAMMLLA 197

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+ HS T +L  + R ADI+V AVG+  ++  D +K G++VIDVG+NR N+   G
Sbjct: 198 ANATVTVTHSGTADLAAMTRQADIIVAAVGKVDVLTADMVKPGAVVIDVGMNR-NAE--G 254

Query: 244 KTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV  +  K V G ITPVPGGVGPMTI ML+ NT+ +A R+ G
Sbjct: 255 K--LCGDVDFNGVKEVAGYITPVPGGVGPMTITMLLVNTMESAERAAG 300


>gi|257083887|ref|ZP_05578248.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           Fly1]
 gi|256991917|gb|EEU79219.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           Fly1]
          Length = 281

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 189/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +N TVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNTTVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|188586317|ref|YP_001917862.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+),
           Methenyltetrahydrofolate cyclohydrolase [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|226704376|sp|B2A532|FOLD_NATTJ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|179351004|gb|ACB85274.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+),
           Methenyltetrahydrofolate cyclohydrolase [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 284

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 185/289 (64%), Gaps = 11/289 (3%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            SLI G  VA  +   + + V  LK + GV   LAVVLVG D AS +YV+ K + A   G
Sbjct: 3   ASLIKGSDVAKEIRSDLQKDVEDLKSQ-GVTPHLAVVLVGEDSASQTYVNMKEKTAGKVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             S     P ++ + +L   +  LNKDDS+HGILVQLPLP  + E  I+ +I   KDVD 
Sbjct: 62  IESTVKRLPTNVEEDELLRLIDELNKDDSVHGILVQLPLPYHIDEYKILNAIDQYKDVDS 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN G + IG       PCTPAG + L++     DL+G+HAVV+GRSN+ GKP+  LL
Sbjct: 122 FHPVNVGNLTIG--QKRFTPCTPAGIMKLLDSID-YDLNGKHAVVLGRSNIVGKPISLLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L RNATV++ HS+TK+L E+ ++AD+L+VAVGRP +V    IK G++VIDVG+N+++   
Sbjct: 179 LERNATVSICHSRTKDLTEMTKSADLLIVAVGRPEIVTGKMIKPGAVVIDVGVNKVDDK- 237

Query: 242 LGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
                L+GDV  E  K V G ITPVPGGVGPMTI ML+ NT+ AA R L
Sbjct: 238 -----LIGDVEFESAKEVAGWITPVPGGVGPMTITMLLNNTIEAARRCL 281


>gi|312278016|gb|ADQ62673.1| Methenyltetrahydrofolate cyclohydrolase [Streptococcus thermophilus
           ND03]
          Length = 280

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/286 (48%), Positives = 189/286 (66%), Gaps = 9/286 (3%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           +DGK +A  + +++ E VA LK++     GL V++VG +PAS  YV  K R AK  GFHS
Sbjct: 1   MDGKALAVNMQEQLQEKVARLKEKEWTVPGLVVIMVGENPASQVYVRNKERAAKKAGFHS 60

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
              N    IS+ +L   +   N+D   HGILVQLPLP+ ++E  I+ +I P+KDVDG H 
Sbjct: 61  KTVNLSESISEEELIEVIEKYNQDPLFHGILVQLPLPNHINEMRILLAIDPKKDVDGFHP 120

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           +N G +  G     +VPCTPAG + ++ ++   +L G+ AV+IGRSN+ GKPM QLLL +
Sbjct: 121 MNTGNLWNGH--PQMVPCTPAGIMEILREY-NVELEGKTAVIIGRSNIVGKPMAQLLLEK 177

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           NATVT+ HS+T +L ++C  AD+L+VA+GR + V  +++K G++VIDVGINR    + GK
Sbjct: 178 NATVTLTHSRTPHLAKVCNKADVLIVAIGRAKFVTEEFVKEGAVVIDVGINR---DEEGK 234

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             L GDV  D+ K  V  ITPVPGGVGPMTI MLM  T  AA RSL
Sbjct: 235 --LCGDVDFDQVKEKVSMITPVPGGVGPMTITMLMEQTYQAALRSL 278


>gi|119369672|sp|Q6ALZ5|FOLD_DESPS RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
          Length = 296

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/288 (45%), Positives = 187/288 (64%), Gaps = 7/288 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  +   +  +I ++V  +K + G   GL  +LVG  PAS SYVS K + A   GF+
Sbjct: 5   IISGTEIRKEILGEIKDAVTEMKDKYGTVPGLVTILVGESPASMSYVSLKIKTALSLGFY 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
            VQ +  V+ ++ +L   +   N DDSIHG+LVQLPLP  ++EQ+II +I P+KDVD  H
Sbjct: 65  EVQESLSVETTEAELLALIEKYNNDDSIHGVLVQLPLPKHINEQNIITAIDPDKDVDAFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++MIG      +PCTPAG   ++ +  G + +G   VV+GRSN+ GKP+  ++  
Sbjct: 125 PVNIGRLMIGGDDVKFLPCTPAGIQEMLVR-SGVETAGAEVVVVGRSNIVGKPIAMMMAQ 183

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ H+ +++L   CR ADIL+VA G P +V+ +WIK G+ VIDVG+NR+ +
Sbjct: 184 KGIGANATVTIVHTGSRDLATHCRRADILIVAAGVPNLVKPEWIKPGATVIDVGVNRVGT 243

Query: 240 -PQLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             + GK +L GDV  E  K + G ITPVPGGVGPMTIAMLM NT+ +A
Sbjct: 244 NSETGKAILRGDVDFEAVKEIAGKITPVPGGVGPMTIAMLMKNTLASA 291


>gi|317051250|ref|YP_004112366.1| methenyltetrahydrofolate cyclohydrolase [Desulfurispirillum indicum
           S5]
 gi|316946334|gb|ADU65810.1| Methenyltetrahydrofolate cyclohydrolase [Desulfurispirillum indicum
           S5]
          Length = 295

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 190/294 (64%), Gaps = 13/294 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +++DGK ++  + D+++  V+ LK + G+Q GLAV+LVG+DPAS  YV +K +  +  
Sbjct: 1   MPTILDGKKLSQTILDELSAEVSALKSQ-GIQPGLAVILVGDDPASKVYVGSKQKTCEKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P   SQ +L + V   N D  IHGIL QLPLP  + E  +I +I P+KDVD
Sbjct: 60  GILSKSSILPAATSQAELLSVVQQYNDDPQIHGILCQLPLPHHLDESEVINAIAPQKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
             H  N G+V+IG      +PCTP G + LI++  G + +G+HAV++GRS++ GKP+  +
Sbjct: 120 CFHPDNVGRVLIG--APRFLPCTPHGVVQLIKR-TGIETTGKHAVIVGRSDIVGKPLAAM 176

Query: 181 LLSR--------NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDV 232
           +L +        N+TVT+ HS T+NL E+C  ADILV A+G+P  ++   +K G++VIDV
Sbjct: 177 MLQKDSGSNMGCNSTVTICHSATRNLEEVCAQADILVAAIGKPEFIKAHMVKEGAVVIDV 236

Query: 233 GINRINSPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GINRI++       LVGDVA DE      AITPVPGGVGPMTIAMLM NTV +A
Sbjct: 237 GINRIDADNSKGYRLVGDVAYDEVAPKSSAITPVPGGVGPMTIAMLMYNTVKSA 290


>gi|332530778|ref|ZP_08406705.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Hylemonella gracilis ATCC 19624]
 gi|332039765|gb|EGI76164.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Hylemonella gracilis ATCC 19624]
          Length = 283

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 187/289 (64%), Gaps = 10/289 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG  ++  L  ++A+  A L    G Q GLAVVLVG++PAS  YV  K +  +  G 
Sbjct: 4   QLIDGIALSKQLRSEVAQRAAALTAR-GRQPGLAVVLVGDNPASQVYVRNKVKACEESGI 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV   +   +S+ DL   + +LN D +IHGILVQLPLP+ +  Q +I++I P+KDVDG 
Sbjct: 63  RSVMEKYDATLSEADLLARITALNTDPTIHGILVQLPLPAHIDAQKVIEAISPDKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV +AG +M G    G  PCTP G I ++E     DL G+HAVVIGRSN+ GKPM  +LL
Sbjct: 123 HVASAGALMTG--LPGFWPCTPHGCIKMLEHID-YDLKGKHAVVIGRSNIVGKPMALMLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            +NATVT+ HS TK+L      AD++V AVG+ +M+  D +K G++VIDVG+NR    + 
Sbjct: 180 GKNATVTVCHSATKDLKAQTLQADVIVAAVGKAKMLTADMVKPGAVVIDVGMNR---DEQ 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           GK  L GDV  +  K V   ITPVPGGVGPMTI ML+ NT+ AA R++G
Sbjct: 237 GK--LCGDVDFERVKDVASWITPVPGGVGPMTITMLLVNTLEAAQRAVG 283


>gi|218781241|ref|YP_002432559.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Desulfatibacillum alkenivorans AK-01]
 gi|226704344|sp|B8FLE5|FOLD_DESAA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|218762625|gb|ACL05091.1| Methenyltetrahydrofolate Cyclohydrolase/Methylenetetrahydrofolate
           dehydrogenase (Bifunctional protein FolD)
           [Desulfatibacillum alkenivorans AK-01]
          Length = 302

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/290 (47%), Positives = 188/290 (64%), Gaps = 11/290 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LI G  +   + +++ + VA LK++TG   GL  +LVG +PAS SYV+ K + A   GF
Sbjct: 4   KLIKGTDIREEILEEVTKEVAELKEKTGKVPGLVTILVGENPASVSYVTLKIKTAHRVGF 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
             +Q N   DIS+ DL   +   N DDSI+GILVQLPLP  + ++ I+ +I P+KDVDG 
Sbjct: 64  TEIQDNQSPDISEEDLLALIDKYNNDDSINGILVQLPLPKHIDDKKILNAIDPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++MIG       PCTPAG   +I +  G + SG   VV+GRSN+ GKP+  +++
Sbjct: 124 HPVNVGRLMIGGDEVKFAPCTPAGIQEMIVR-AGVETSGAEVVVVGRSNIVGKPIANMMV 182

Query: 183 SR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            +    N+TVT+ H++TK+L   C+ ADIL+VA G P +V+ +WIK G+ VIDVG+NR+ 
Sbjct: 183 QKGPGANSTVTIVHTRTKDLAAHCQRADILIVAAGVPGLVKPEWIKKGACVIDVGVNRVG 242

Query: 239 ---SPQLGK--TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
              S + GK   VL GDV  D  K + G+ITPVPGGVGPMTI MLM NT+
Sbjct: 243 TKISEKTGKEIAVLRGDVDFDAAKEIAGSITPVPGGVGPMTITMLMVNTL 292


>gi|149926854|ref|ZP_01915113.1| FolD bifunctional protein [Limnobacter sp. MED105]
 gi|149824406|gb|EDM83624.1| FolD bifunctional protein [Limnobacter sp. MED105]
          Length = 282

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 180/287 (62%), Gaps = 10/287 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LI G  +A+ + + IA+    L  E G Q GLAVVLVG DPAS  YV  K    +  GF 
Sbjct: 5   LISGTELAASIRETIAKRATELT-ELGHQPGLAVVLVGEDPASQVYVRNKVSACEKAGFK 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV +  P + SQ  L   V  LN D SIHGILVQLPLP  +    +I+SI  EKDVDG H
Sbjct: 64  SVMHRMPENTSQDALVGLVEQLNSDPSIHGILVQLPLPKHLDSHVVIESISAEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + NAG +M G       PCTP G + ++E   G +L G  AVVIG SN+ GKP   LLL 
Sbjct: 124 ISNAGLLMTGKPL--FRPCTPYGVMKMLE-LTGIELRGAEAVVIGASNIVGKPQAMLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           + ATVT+ +SKTK+L   C+ AD+LVVAVGRP M+  D IK G++VIDVGINR+     G
Sbjct: 181 QGATVTLCNSKTKDLKSHCQRADVLVVAVGRPNMITGDMIKPGAVVIDVGINRLPD---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           K  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ A  RSL
Sbjct: 238 K--LCGDVDFDSAKEVAGWITPVPGGVGPMTITMLLQNTIEAVERSL 282


>gi|51245753|ref|YP_065637.1| methylenetetrahydrofolate dehydrogenase [Desulfotalea psychrophila
           LSv54]
 gi|50876790|emb|CAG36630.1| probable methylenetetrahydrofolate dehydrogenase [Desulfotalea
           psychrophila LSv54]
          Length = 313

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 132/288 (45%), Positives = 187/288 (64%), Gaps = 7/288 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  +   +  +I ++V  +K + G   GL  +LVG  PAS SYVS K + A   GF+
Sbjct: 22  IISGTEIRKEILGEIKDAVTEMKDKYGTVPGLVTILVGESPASMSYVSLKIKTALSLGFY 81

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
            VQ +  V+ ++ +L   +   N DDSIHG+LVQLPLP  ++EQ+II +I P+KDVD  H
Sbjct: 82  EVQESLSVETTEAELLALIEKYNNDDSIHGVLVQLPLPKHINEQNIITAIDPDKDVDAFH 141

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++MIG      +PCTPAG   ++ +  G + +G   VV+GRSN+ GKP+  ++  
Sbjct: 142 PVNIGRLMIGGDDVKFLPCTPAGIQEMLVR-SGVETAGAEVVVVGRSNIVGKPIAMMMAQ 200

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ H+ +++L   CR ADIL+VA G P +V+ +WIK G+ VIDVG+NR+ +
Sbjct: 201 KGIGANATVTIVHTGSRDLATHCRRADILIVAAGVPNLVKPEWIKPGATVIDVGVNRVGT 260

Query: 240 -PQLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             + GK +L GDV  E  K + G ITPVPGGVGPMTIAMLM NT+ +A
Sbjct: 261 NSETGKAILRGDVDFEAVKEIAGKITPVPGGVGPMTIAMLMKNTLASA 308


>gi|148554979|ref|YP_001262561.1| methenyltetrahydrofolate cyclohydrolase [Sphingomonas wittichii
           RW1]
 gi|190359416|sp|A5V807|FOLD2_SPHWW RecName: Full=Bifunctional protein FolD 2; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|148500169|gb|ABQ68423.1| Methenyltetrahydrofolate cyclohydrolase [Sphingomonas wittichii
           RW1]
          Length = 297

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 183/281 (65%), Gaps = 4/281 (1%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDG+ +A  L ++ A +V  +    G   GLAVVLVGNDPAS  YV  K    +  G  S
Sbjct: 17  IDGRAIARSLDERTAAAVRAIVARDGAPPGLAVVLVGNDPASEVYVGRKIEACRRVGILS 76

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
            ++  P   +Q  L   +  LN D +IHGILVQ+PLPS + +  ++ +I P KDVDG H 
Sbjct: 77  FEHRLPAQTTQDALLTLIARLNADPTIHGILVQVPLPSHIDDGMVLSAIDPAKDVDGFHP 136

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
           VN G++  G  T GLVPCTP G ++L++     D+ G  AVVIG+SN+ GKP+  LLL R
Sbjct: 137 VNVGRLSTG--TGGLVPCTPLGVMMLLDSVID-DMKGMDAVVIGKSNIVGKPIAMLLLER 193

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
            ATVT+ H +T+ LP+I R ADI+V A G PR+V+  W+K G+++IDVGI R+   + GK
Sbjct: 194 EATVTVTHIETRGLPDIVRKADIIVAAAGAPRLVKGYWVKEGAVIIDVGITRLPG-EGGK 252

Query: 245 TVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           T LVGDVA +      A+TPVPGGVGPMTIA L+ANTV AA
Sbjct: 253 TRLVGDVAFDEVQHARAVTPVPGGVGPMTIACLLANTVKAA 293


>gi|171911180|ref|ZP_02926650.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Verrucomicrobium spinosum DSM 4136]
          Length = 291

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/293 (47%), Positives = 193/293 (65%), Gaps = 9/293 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA+ +  +  + +A L  + G + GLAVVLVG+DPAS +YV +K +  +  G H
Sbjct: 1   MIKGSEVAAKVLAECQQDIAALAAQ-GHKPGLAVVLVGDDPASRAYVRSKDKKCRDLGLH 59

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV+   P + +Q +L   + SLN D +IHGILVQ P P  + E +++ +I P KDVDG H
Sbjct: 60  SVKLELPAETTQEELLAHIASLNADPAIHGILVQSPPPKHIDESAVVLAIDPRKDVDGFH 119

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN  K+ + D ++G VPCTPAG   L+    G + SG   VV+GRS + GKPM  LL++
Sbjct: 120 PVNVAKLALED-SSGFVPCTPAGCQRLLLD-AGVETSGAKVVVLGRSMIVGKPMALLLMA 177

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    +ATVT+AHS+TKNL E+ R ADI++ A+GRP  V+ + +K G+++IDVGINR+  
Sbjct: 178 KGKGGDATVTVAHSRTKNLAEVTREADIIIAAIGRPNFVRAEHVKEGAVIIDVGINRVED 237

Query: 240 PQLGKTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           P   K   +VGDVA DE      AITPVPGGVGPMTIAMLMANT+ A  + +G
Sbjct: 238 PGSEKGYKIVGDVAFDEVAPKCRAITPVPGGVGPMTIAMLMANTIKACKQLVG 290


>gi|210612607|ref|ZP_03289398.1| hypothetical protein CLONEX_01600 [Clostridium nexile DSM 1787]
 gi|210151532|gb|EEA82539.1| hypothetical protein CLONEX_01600 [Clostridium nexile DSM 1787]
          Length = 279

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 191/287 (66%), Gaps = 8/287 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  LIDGK++++ + +++ E VA LK+E G+   LAVV VG DPAS  YV+ K +     
Sbjct: 1   MAKLIDGKLISTQIKEELKEEVAKLKQE-GIVPCLAVVQVGKDPASSVYVNNKKKACAFI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y     +++ +L + V  LN+D+ ++GILVQLPLP+ + E ++IQ+I PEKDVD
Sbjct: 60  GIESLSYELDETVTEEELLSLVQKLNEDEKVNGILVQLPLPAHIREDAVIQAIAPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + G + IG    G +PCTPAG I L+++ +  ++ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFHPESVGNMCIG--RNGFLPCTPAGIIELLKRSE-IEIEGKECVVVGRSNIVGKPMALL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N TVT+ HS+T++L EI   ADIL+ A+G+P+ +  D++K G++VIDVGI+R    
Sbjct: 177 LLRENGTVTITHSRTRDLKEITGRADILIAAIGKPKFITSDYVKEGAVVIDVGIHRNAEN 236

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +L   V   DV ++    V AITPVPGGVGPMTIAMLM N + A  +
Sbjct: 237 KLCGDVDFDDVIEK----VSAITPVPGGVGPMTIAMLMNNCIEAVRK 279


>gi|291613812|ref|YP_003523969.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Sideroxydans
           lithotrophicus ES-1]
 gi|291583924|gb|ADE11582.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Sideroxydans
           lithotrophicus ES-1]
          Length = 284

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/288 (48%), Positives = 183/288 (63%), Gaps = 10/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  +  +       LK   G+  GLAV++VG DPAS  YV+ K +     G +
Sbjct: 5   IIDGKAIAQEVRAEWKVRADALKAR-GITPGLAVIIVGEDPASKVYVANKVKACAELGLY 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P D S+  L   +  LN D +IHG+LVQLP+P  +    I+ +I P+KDVDG H
Sbjct: 64  SEHIALPADTSEATLLAKIAELNADPNIHGLLVQLPVPRHIDSDKILNAISPDKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G +  G       PCTP G+++L+ Q  G D+ G+HAVV+GRSN+ GKPM QLLL 
Sbjct: 124 PMNVGALATGSMR--FAPCTPYGSLILL-QKSGVDIEGKHAVVVGRSNIVGKPMAQLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT+  SKT++L +  R ADILVVA G+P+M+  D IK G+ VIDVGINR+ +   G
Sbjct: 181 HHATVTICTSKTRDLAKHTRDADILVVATGKPKMITGDMIKPGAAVIDVGINRMEN---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV  D  K V G ITPVPGGVGPMTI ML+ANTV +A R+ G
Sbjct: 238 K--LCGDVDFDSAKEVAGWITPVPGGVGPMTITMLVANTVQSAERAAG 283


>gi|326491559|dbj|BAJ94257.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 374

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 134/286 (46%), Positives = 188/286 (65%), Gaps = 3/286 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK+VA  + +++   +A +K  TGV  GLAV+LVG+   S +YV  K +  +  G  
Sbjct: 85  IIDGKLVAKQIREEVGVEIARMKDATGVVPGLAVILVGSRKVSQTYVRNKKKACEAVGIK 144

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S + N P D S+ ++   + + N D S+HGILVQLPLP  +++++I+ ++  EKDVDG H
Sbjct: 145 SYEVNLPEDASEYEVIKHIATFNDDPSVHGILVQLPLPRHMNDENILNAVSIEKDVDGFH 204

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++ +       VPCTP G + L+ +  G +++G+ AVVIGRSN+ G P   LL  
Sbjct: 205 PVNIGRLAMQGRDPFFVPCTPKGCMELLHR-SGVEINGKRAVVIGRSNIVGTPAALLLQK 263

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATV++ HSKTKN  EI R ADI++ AVG   +V+  WIK G+ +IDVGIN ++ P   
Sbjct: 264 ANATVSIVHSKTKNPEEITRQADIIIAAVGVANLVRGSWIKPGAAIIDVGINPVDDPASP 323

Query: 244 KTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +   LVGDV  DE   V GAITPVPGGVGPMTIAML++NT+ +A R
Sbjct: 324 RGYRLVGDVCFDEASKVAGAITPVPGGVGPMTIAMLLSNTLDSAKR 369


>gi|162451986|ref|YP_001614353.1| methenyltetrahydrofolate cyclohydrolase [Sorangium cellulosum 'So
           ce 56']
 gi|189044589|sp|A9GW22|FOLD_SORC5 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|161162568|emb|CAN93873.1| Methenyltetrahydrofolate cyclohydrolase [Sorangium cellulosum 'So
           ce 56']
          Length = 287

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/284 (46%), Positives = 185/284 (65%), Gaps = 8/284 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DGK +A  + D++ E VA      G   GL VVLVG DPAS ++  +K RM+   G 
Sbjct: 4   KILDGKAIAQKVRDEVREGVARFVAAHGRPPGLEVVLVGEDPASVTHTRSKERMSNEVGI 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
                  P   ++ +L   V  L+ DD++ GILVQLPLP+ +   +++ +I P KDVDGL
Sbjct: 64  RGRLRALPAATTEAELLACVAELDADDTVDGILVQLPLPARIRAHAVLDAIDPAKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VNAG + +G    G+ PCTP G + L+ +  G +L+G  AVV+GRSNL G+PM QLLL
Sbjct: 124 HPVNAGLLAMG-RPGGIAPCTPVGCMRLLAE-AGVELAGARAVVVGRSNLVGRPMAQLLL 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +R+ATV +AH++T++L  +CR AD+LVVA G+ +++  DWIK G+ VIDVG+NR ++   
Sbjct: 182 ARHATVAIAHTRTRDLKALCREADVLVVAAGKAKLIGGDWIKEGATVIDVGMNRDDA--- 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GK  LVGDV  D  +     ITPVPGGVGPMTIA L+  T+ AA
Sbjct: 239 GK--LVGDVDFDAVRERAAWITPVPGGVGPMTIASLLETTLRAA 280


>gi|241763753|ref|ZP_04761800.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Acidovorax
           delafieldii 2AN]
 gi|241366972|gb|EER61368.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Acidovorax
           delafieldii 2AN]
          Length = 284

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/288 (48%), Positives = 188/288 (65%), Gaps = 10/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDG  ++  L  ++A+  A LK   G   GLAVVLVG++PAS  YV  K +  +  G H
Sbjct: 5   LIDGNALSRQLRTEVAQRAAALKTR-GTTPGLAVVLVGDNPASQVYVRNKVKACEDSGLH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +  D+S+  L   V +LN D +IHGILVQLPLP+ +  Q +I++I P KDVDG H
Sbjct: 64  SVLEKYDADMSEAALLARVEALNNDPAIHGILVQLPLPAHIDAQKVIEAISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + +AG +M G    G  PCTP G + ++E   G DL G+HAVVIGRSN+ GKPM  +LL 
Sbjct: 124 IASAGALMTG--MPGFWPCTPYGCMKMLESI-GYDLRGKHAVVIGRSNIVGKPMALMLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           ++ATVT+ HS+T +L      AD++V AVG+  ++  D +K G++V+DVG+NR +    G
Sbjct: 181 KDATVTICHSRTADLKAQTLQADVIVAAVGKRNVLTADMVKPGAVVLDVGMNRNDE---G 237

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV  E  KSV G ITPVPGGVGPMTI ML+ NT+ AA R+ G
Sbjct: 238 K--LCGDVDFEGVKSVAGWITPVPGGVGPMTITMLLVNTLEAAERAAG 283


>gi|328948382|ref|YP_004365719.1| Bifunctional protein folD [Treponema succinifaciens DSM 2489]
 gi|328448706|gb|AEB14422.1| Bifunctional protein folD [Treponema succinifaciens DSM 2489]
          Length = 294

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 190/286 (66%), Gaps = 8/286 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A+ +   +A+ V+ LKK +GV   LAV+LVGN+PAS SYVS K +     G  
Sbjct: 5   IIDGKSIAAEVKADVAKKVSELKK-SGVTPCLAVILVGNNPASVSYVSGKRKALAEAGME 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
                 P   ++ ++ + +  LN+D ++HGILVQLPLPS + E+ +  SI PEKDVDG H
Sbjct: 64  DRSIELPESTTEQEILSLIQKLNEDKTVHGILVQLPLPSHIDEKKVTNSISPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G+++ G+   G +PCTP G  +L+++    + SG++ VV+GRSN+ GKPM  L+L 
Sbjct: 124 PVNVGRLVTGE--KGFLPCTPNGITVLLKKM-NVETSGKNVVVVGRSNIVGKPMALLMLR 180

Query: 184 R--NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI-NSP 240
           +  N+TVT+ H+ TKNL +  + ADIL+VA GRP  V  D IK G+ VIDVG+NRI +S 
Sbjct: 181 KEFNSTVTICHTGTKNLSDYTKKADILIVASGRPNTVTADMIKEGAAVIDVGVNRIPDST 240

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           +     L GDV  E  K V G ITPVPGGVGPMTIAML+ NT+ +A
Sbjct: 241 KKSGFRLCGDVDFEGAKEVAGFITPVPGGVGPMTIAMLIFNTLESA 286


>gi|94264138|ref|ZP_01287936.1| Methenyltetrahydrofolate cyclohydrolase [delta proteobacterium
           MLMS-1]
 gi|94267761|ref|ZP_01290982.1| Methenyltetrahydrofolate cyclohydrolase [delta proteobacterium
           MLMS-1]
 gi|93451866|gb|EAT02603.1| Methenyltetrahydrofolate cyclohydrolase [delta proteobacterium
           MLMS-1]
 gi|93455474|gb|EAT05668.1| Methenyltetrahydrofolate cyclohydrolase [delta proteobacterium
           MLMS-1]
          Length = 294

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 184/293 (62%), Gaps = 8/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA  +  ++ + VA LK + GV  GL  +LVG DPAS SYV+AK + AK  G +
Sbjct: 5   IISGTEVAKAIRAELQQEVAELKDKHGVVPGLVTILVGEDPASQSYVAAKNKTAKELGIN 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S Q   P D  + +L   V   N D  ++GILVQLPLP  + E  ++ +I P+KDVDG H
Sbjct: 65  SEQITLPADTPESELLQLVNKSNNDPKVNGILVQLPLPKHIDEAKVLDAINPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++++G+     +PCTP G IL +    G + SG   VVIGRSN+ GKP+  L+L 
Sbjct: 125 PVNVGRMVLGEQC--FLPCTPHG-ILEMLTRSGVETSGAEVVVIGRSNIVGKPIANLMLQ 181

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ H++TK++    R ADI++ AVG PRM+  D +K G  VIDVG+NR+  
Sbjct: 182 KRDGGNATVTLCHTRTKDIAAHTRRADIIIAAVGVPRMLTADMVKDGVAVIDVGVNRMGV 241

Query: 240 PQLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
            + GK +L GDV  E  K     ITPVPGGVGPMTI MLM NTV AA R+ G+
Sbjct: 242 SESGKAILAGDVDFEAVKEKASCITPVPGGVGPMTITMLMKNTVQAARRAAGV 294


>gi|320450060|ref|YP_004202156.1| bifunctional protein FolD [Thermus scotoductus SA-01]
 gi|320150229|gb|ADW21607.1| bifunctional protein FolD [Thermus scotoductus SA-01]
          Length = 283

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/273 (47%), Positives = 182/273 (66%), Gaps = 13/273 (4%)

Query: 17  KIAESVAFLKKETGVQV----GLAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVD 72
           ++AE+V    +ET   +     L V+ +G DPAS SYV  K + A+  G  S    FP D
Sbjct: 11  EVAETVYRELRETLSSLPFVPSLRVIRLGEDPASVSYVRLKDKRARELGLLSQVEVFPAD 70

Query: 73  ISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMI 132
             +  L   + +LN+D  + GILVQLPLP+ +  + ++++I P KDVDG H +N GK+  
Sbjct: 71  TPEEALLGRIEALNQDPEVDGILVQLPLPAHIRTERVLEAISPLKDVDGFHPLNVGKLWS 130

Query: 133 GDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAH 192
           G    GL PCTP G + L++ + G +L G+  VV+GRSN+ GKP+  LLL  +ATVT+ H
Sbjct: 131 GG--EGLFPCTPLGVVHLLKHY-GVELRGKEVVVLGRSNIVGKPLAGLLLREDATVTVVH 187

Query: 193 SKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVA 252
           S+T+NLPE+ R A++LVVAVGRP +V+ +W++ G++V+DVG+NR+     GK  L+GDV 
Sbjct: 188 SRTRNLPEVTRRAEVLVVAVGRPHLVRKEWVRPGAIVVDVGVNRVE----GK--LLGDVH 241

Query: 253 DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
            E   V  A+TPVPGGVGPMT+AMLMANTV AA
Sbjct: 242 PEVAEVASALTPVPGGVGPMTVAMLMANTVKAA 274


>gi|319794388|ref|YP_004156028.1| methylenetetrahydrofolate dehydrogenase (nadp(+)) [Variovorax
           paradoxus EPS]
 gi|315596851|gb|ADU37917.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Variovorax
           paradoxus EPS]
          Length = 283

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 183/286 (63%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDG  +A  +  ++A   A LK   GV   L+++LVG DPAS  Y   K   +   G  
Sbjct: 5   LIDGNALAKTIRAEVAGRTAALKAR-GVNPALSIILVGEDPASQVYTKHKVNDSTQTGLE 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           +    +P D+++ DL   V +LN D  +HGILVQLPLP  +  Q +I++I P KDVDG H
Sbjct: 64  ATLETYPADMTEADLLARVRALNDDPEVHGILVQLPLPKHMDSQKVIETISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M G    G  PCTP G + ++E   G DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 124 VASAGALMTG--APGFWPCTPHGCMKMLEAI-GYDLRGKHAVVIGRSNIVGKPMAMMLLA 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           ++ATVT+ HS T++L  I R AD++V AVG+  ++  D +K G++VIDVG+NR      G
Sbjct: 181 KSATVTICHSATQDLGAITRQADVIVAAVGKLNLLTADMVKPGAVVIDVGMNRKAD---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D  K V G ITPVPGGVGPMT AML+ANT+ AA R+
Sbjct: 238 K--LAGDVDFDGVKEVAGWITPVPGGVGPMTRAMLLANTLEAAERA 281


>gi|326317561|ref|YP_004235233.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323374397|gb|ADX46666.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 283

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 186/289 (64%), Gaps = 10/289 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG  ++  L   +A   A LK E G   GLAVVLVG++PAS  YV  K +  +  G 
Sbjct: 4   QLIDGNALSRQLRADVARRAALLK-ERGTTPGLAVVLVGDNPASQVYVRNKVKACEESGL 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV   +   +++ +L   V +LN D SIHGILVQLPLP  +  Q +I++I P KDVDG 
Sbjct: 63  HSVLEKYDAAMTEAELLARVNALNNDPSIHGILVQLPLPPHIDAQKVIEAISPAKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H+ +AG +M G    G  PCTP G + ++E   G DL G+HAVVIGRSN+ GKPM  +LL
Sbjct: 123 HIASAGALMTG--MPGFWPCTPYGCMKMLEHI-GYDLRGKHAVVIGRSNIVGKPMALMLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +++ATVT+ HS+T +L      AD++V AVGR  ++  D +K G++VIDVG+NR +    
Sbjct: 180 AKDATVTVCHSRTTDLKAQTLQADVIVAAVGRRNVLTADMVKPGAVVIDVGMNRNDE--- 236

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           GK  L GDV  E  + V G ITPVPGGVGPMTI ML+ NT+ AA R+ G
Sbjct: 237 GK--LCGDVDFEGVREVAGHITPVPGGVGPMTITMLLVNTLEAAERAAG 283


>gi|256617901|ref|ZP_05474747.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis ATCC
           4200]
 gi|257089387|ref|ZP_05583748.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           CH188]
 gi|312904541|ref|ZP_07763699.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0635]
 gi|256597428|gb|EEU16604.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis ATCC
           4200]
 gi|256998199|gb|EEU84719.1| methylenetetrahydrofolate dehydrogenase [Enterococcus faecalis
           CH188]
 gi|310632054|gb|EFQ15337.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0635]
 gi|315577405|gb|EFU89596.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX0630]
          Length = 281

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 189/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++  +Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQD-IQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   HGILVQLPLP  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFHGILVQLPLPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|313894959|ref|ZP_07828518.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976412|gb|EFR41868.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 284

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/287 (49%), Positives = 183/287 (63%), Gaps = 12/287 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++ GK  A+ + +    +VA LK E GV   LAVV+VG DPAS  YV  K +     
Sbjct: 1   MARILSGKEFAAKIKEDAGRAVAELKAE-GVHPRLAVVIVGADPASEVYVRNKQKACAEL 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVS--EQSIIQSIVPEKD 118
           G  S     P D ++ +L   + +LN D S+HGILVQLPLP  +   E+ +++ I P KD
Sbjct: 60  GIISDHIALPADTAKEELITRIDALNADASVHGILVQLPLPEGLRAYEEEVLERIDPRKD 119

Query: 119 VDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMG 178
           VDG + +NAG++++G    GL PCTPAG I ++E   G  + G HAV+IGRSN+ GKPMG
Sbjct: 120 VDGFNPMNAGRLVLG--APGLRPCTPAGCIRMLE-LAGIPIEGAHAVIIGRSNIVGKPMG 176

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LLL RNATVT+ HS+T+NL  + R ADILV AVGRP  V  D +K G+ VIDVGINRI 
Sbjct: 177 HLLLERNATVTVCHSRTQNLAAVAREADILVAAVGRPGFVTADMVKPGATVIDVGINRIA 236

Query: 239 SPQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
             +     LVGDV  D    + GAITPVPGGVG +T+AMLM N V A
Sbjct: 237 PKK-----LVGDVDFDAVSEIAGAITPVPGGVGLLTVAMLMNNVVEA 278


>gi|329116454|ref|ZP_08245171.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus parauberis NCFD 2020]
 gi|326906859|gb|EGE53773.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Streptococcus parauberis NCFD 2020]
          Length = 284

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/290 (47%), Positives = 188/290 (64%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  +   +A+ V  L  +  +  GL V+L+GN+PAS  YV  K + A   
Sbjct: 1   MTQIIDGKALAQKMQSNLADKVQVLNNKYHIVPGLVVILIGNNPASQVYVKNKEKAAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S          Q +L + +   N DDSIHGILVQLPLPS ++++ II SI P+KDVD
Sbjct: 61  GFKSETVRLSESTCQEELIDIINQYNLDDSIHGILVQLPLPSHINDKKIILSIDPKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G +  G     +VPCTPAG + +  ++   DL G++AV+IGRSN+ GKPM QL
Sbjct: 121 GFHPMNTGHLWSG--RPLMVPCTPAGIMEMFSEY-SIDLEGKNAVIIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+ HS+TK+LPE+   ADIL+VA+G+   V  +++K G++VIDVG+NR ++ 
Sbjct: 178 LLDKNATVTLTHSRTKHLPEVASRADILIVAIGQGNFVTKEFVKEGAVVIDVGMNRDDN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L+GDV  D+   +   ITPVPGGVGPMTI ML+  T  A  RS+
Sbjct: 237 --GK--LIGDVDFDQVADLTSFITPVPGGVGPMTITMLLEQTYQACLRSV 282


>gi|147669282|ref|YP_001214100.1| methenyltetrahydrofolate cyclohydrolase [Dehalococcoides sp. BAV1]
 gi|189044530|sp|A5FRF1|FOLD_DEHSB RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|146270230|gb|ABQ17222.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Dehalococcoides
           sp. BAV1]
          Length = 296

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 136/293 (46%), Positives = 189/293 (64%), Gaps = 8/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I+G  +A+ + ++I   V  LK + G+  GLA VLVG+DPAS SYV +K +M ++ G +
Sbjct: 5   IINGTEIAAAIREEIRSEVIALKAKAGIVPGLATVLVGDDPASHSYVDSKIKMCQNLGIY 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P + +  DL   +  LN D  I GILVQ+PLP+ +SE  ++ +I P+KDVDG H
Sbjct: 65  SEHHPLPQNATIEDLLTLIAKLNADPKISGILVQVPLPAQISESLVLNAINPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++ +G+     +PCTP G   L+ +  G  + G H V++GRSNL GKP+  +LL 
Sbjct: 125 PVNVGRMCLGE--PCFLPCTPHGVQELLIR-SGIKIEGTHVVIVGRSNLVGKPLANILLQ 181

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ HS TKNLPEI R ADILV A+G+P+ +  D ++ G++VIDVG   I  
Sbjct: 182 KAPGANATVTICHSGTKNLPEITRQADILVAAMGKPKFITSDMVREGAVVIDVGTTCIGY 241

Query: 240 PQLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
              GK +L GDV  +E K    AITPVP GVGPMTI MLM NT+ AA R+ G+
Sbjct: 242 TPEGKRILSGDVDFEEVKEKAFAITPVPKGVGPMTIIMLMLNTLTAAKRAAGL 294


>gi|330813345|ref|YP_004357584.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486440|gb|AEA80845.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 284

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 184/288 (63%), Gaps = 8/288 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK +A  L  K+ + +  L      + GL V+L+G+ PAS  YV  K + AK  G +
Sbjct: 2   IIDGKKIAEELRFKLKKEIDQLPTNLS-KPGLTVILIGDHPASQIYVRNKEKFAKEVGIN 60

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    F   I++ DL   +  LN D ++HGILVQLPLPS +    II  I P KDVDG H
Sbjct: 61  SKLLKFEETITEQDLIQEIHKLNDDSTVHGILVQLPLPSHIDSGKIISEINPAKDVDGFH 120

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G +  G+    LVPCTP G  LL+++    +LSG +AV+IGRSN+ GKPM QLLL 
Sbjct: 121 PNNVGNLSSGN--DALVPCTPYGCYLLLKKVIP-NLSGLNAVIIGRSNINGKPMAQLLLK 177

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            N TVT+ HSKTKNL ++C TADILV +VG P+MV+ DW+K   ++IDVGINR+     G
Sbjct: 178 ENCTVTITHSKTKNLKDLCLTADILVASVGNPQMVKADWVKKDCVIIDVGINRLEDN--G 235

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
              +VGDV  E  K +V AITPVPGGVGPMTI+ L+ NT I AY+ + 
Sbjct: 236 TKRIVGDVDFENVKDLVKAITPVPGGVGPMTISCLLNNT-IKAYKKIN 282


>gi|260887781|ref|ZP_05899044.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Selenomonas sputigena ATCC 35185]
 gi|330838679|ref|YP_004413259.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Selenomonas
           sputigena ATCC 35185]
 gi|260862457|gb|EEX76957.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Selenomonas sputigena ATCC 35185]
 gi|329746443|gb|AEB99799.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Selenomonas
           sputigena ATCC 35185]
          Length = 287

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/285 (49%), Positives = 185/285 (64%), Gaps = 11/285 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           L++GKV A  + D+  E    L+   G   GLAVV+VG DPAS  YV  K R  +  GF 
Sbjct: 5   LLEGKVFAQKIKDEAREEALALRTVLGRMPGLAVVIVGEDPASEVYVRNKERACEALGFF 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQS--IIQSIVPEKDVDG 121
           S     P   ++ DL   +  LN    I GILVQLPLP+ +++ +  II+ I P+KDVDG
Sbjct: 65  SALIALPETTTKEDLLAEIDRLNASRRIDGILVQLPLPAHLAKSAAEIIERIDPKKDVDG 124

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H +N G+++ G+  T LVPCTPAG + ++ +  G  ++G+ A VIGRSN+ GKP+  LL
Sbjct: 125 FHPINIGRLVAGE--TALVPCTPAGCMKML-KLAGIPVAGKRACVIGRSNIVGKPISHLL 181

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L+ NATVT+ HS+T++L  + R ADILV AVG+PR V  D +K+G+ VIDVGINRI   +
Sbjct: 182 LAENATVTICHSRTEDLAAVAREADILVAAVGKPRFVTADMVKSGATVIDVGINRIAEKK 241

Query: 242 LGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
                LVGDV  D  K V GAITPVPGGVG +TIA LMANTV AA
Sbjct: 242 -----LVGDVDFDAVKEVAGAITPVPGGVGLLTIATLMANTVQAA 281


>gi|218533531|ref|YP_002424346.1| methenyltetrahydrofolate cyclohydrolase [Methylobacterium
           chloromethanicum CM4]
 gi|75489595|sp|Q9X7F6|FOLD_METC4 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|4538618|emb|CAB39400.1| FolD protein [Methylobacterium chloromethanicum]
 gi|218525834|gb|ACK86418.1| Methenyltetrahydrofolate cyclohydrolase [Methylobacterium
           chloromethanicum CM4]
          Length = 306

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 190/296 (64%), Gaps = 7/296 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +  +IDG+  A+ LTD +         E G   GLAVVL+G+DPAS  YV AKT  A+  
Sbjct: 2   IAQVIDGRAEAARLTDNVRARAHRFTDEFGRCPGLAVVLIGDDPASSVYVKAKTEKARST 61

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S  +  P D ++  L   +  LN+D ++ GILVQLPLP  ++ + ++Q I+P KDVD
Sbjct: 62  GILSSSHRLPSDTTEDALLRLIDQLNRDRTVDGILVQLPLPPHIAPERVLQRILPCKDVD 121

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VNAG +  G    GLVPCTP G + L++     +L GQ+ VV+GRS + G+P  Q+
Sbjct: 122 GFHPVNAGLLATG--QPGLVPCTPLGCLRLVQSV-AAELVGQNVVVVGRSTIVGRPAAQV 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L+ + +VT+ H +++++P  CR+ADILVVA G P +V+ DW+K G++VIDVGINRI  P
Sbjct: 179 FLNADCSVTILHKESRDVPGHCRSADILVVAAGSPGLVRRDWVKPGAVVIDVGINRI--P 236

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPK 295
                 LVGDV  E  + V  AITPVPGGVGPMT+A LM NTV A   +L +++P+
Sbjct: 237 VSSGYRLVGDVDFEGVQYVASAITPVPGGVGPMTVAALMENTV-ACAEALAIRAPE 291


>gi|167045739|gb|ABZ10386.1| putative Tetrahydrofolate dehydrogenase/cyclohydrolase,
           NAD(P)-binding domain protein [uncultured marine
           bacterium HF4000_APKG2098]
          Length = 281

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 139/280 (49%), Positives = 184/280 (65%), Gaps = 10/280 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I+GK VA+ L  ++ + V  LK       GL V+LVG D  S  YV  K + A   G +
Sbjct: 2   IINGKKVAADLRGELKKKVVELKSSYNAIPGLTVILVGEDLPSKIYVKNKEKSAIEVGIN 61

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S    +  ++ +  + N +  LNK+D + GILVQLPLP  ++++ +I++I P+KDVDGLH
Sbjct: 62  SEVLRYSDNVEEQVVLNKIKELNKNDKVSGILVQLPLPKHINKRKVIETIDPKKDVDGLH 121

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G +  G    G +PCTP G  LLI+  +  +L+G+HAV+IGRSNL GKPM QLLL 
Sbjct: 122 PVNVGNLSSG--YNGTIPCTPLGCYLLIKNTEK-NLNGKHAVIIGRSNLNGKPMTQLLLK 178

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            N TVT+ HSKTK+L   C  ADI+V AVGRP++V+ DW+K G++VIDVGIN+ +S    
Sbjct: 179 ENCTVTITHSKTKDLKSECSRADIIVAAVGRPKLVKGDWVKKGAIVIDVGINKTDSG--- 235

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
              LVGDV  DE   V  AITPVPGGVGPMTIA L+ NTV
Sbjct: 236 ---LVGDVDFDEVAKVAKAITPVPGGVGPMTIACLLNNTV 272


>gi|222110848|ref|YP_002553112.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Acidovorax ebreus TPSY]
 gi|254789402|sp|B9MIU6|FOLD_ACIET RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|221730292|gb|ACM33112.1| Methenyltetrahydrofolate cyclohydrolase [Acidovorax ebreus TPSY]
          Length = 282

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 184/285 (64%), Gaps = 9/285 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDG  ++  L  ++A   A LK   G+  GLAVVLVG++PAS  YV  K +  +  GFH
Sbjct: 5   LIDGNALSRQLRTEVAARTAALKSR-GITPGLAVVLVGDNPASQVYVRNKVKACEDVGFH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +   +S+  L   V +LN D SIHGILVQLPLP  + +  +I++I P KDVDG H
Sbjct: 64  SVLEKYDASMSEEQLLARVQALNNDPSIHGILVQLPLPKHIDDHKVIEAISPLKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M+G    G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 124 VASAGALMVGQV--GFKACTPYGCMKMLESIGMKDLRGKHAVVIGRSNIVGKPMAMMLLA 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+ HS T +L  + R AD++V AVG+  ++  D +K G++VIDVG+NR +    G
Sbjct: 182 ANATVTVCHSGTADLAAMTRQADVVVAAVGKRNVLTADMVKPGAVVIDVGMNRNDE---G 238

Query: 244 KTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           K  L GDV  E  K V G ITPVPGGVGPMTI ML+ NT+ AA R
Sbjct: 239 K--LCGDVDFEGVKQVAGYITPVPGGVGPMTITMLLVNTLEAAER 281


>gi|229916253|ref|YP_002884899.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Exiguobacterium sp. AT1b]
 gi|259647296|sp|C4L3F6|FOLD_EXISA RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|229467682|gb|ACQ69454.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Exiguobacterium
           sp. AT1b]
          Length = 278

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 143/288 (49%), Positives = 183/288 (63%), Gaps = 12/288 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK VA+   + + E VA L+   G+   L VVL+G+DPAS SYV  K R A+  
Sbjct: 1   MAVVIDGKQVAASYRETLKERVAELRAR-GIVPKLKVVLIGDDPASHSYVRGKERAAEEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S    F   IS+ +L + +  +N D+ +HGILVQLPLP  + E  +I  I PEKDVD
Sbjct: 60  GIDSQVLRFDETISEKELLDLIDLMNADEEVHGILVQLPLPKHIDESRVIMRISPEKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N GK+M+G  T  L+PCTP G + L +     +++G+H VV+GRS + GKP+G L
Sbjct: 120 GFHPENVGKMMLGLDT--LLPCTPHGILHLAKT--QTEIAGKHVVVVGRSQIVGKPVGML 175

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L+ +ATVT  HSKT +L E+ R ADIL+VAVGR  +V  D +K G+LVIDVG+NR+   
Sbjct: 176 FLNESATVTYCHSKTADLGEMTRQADILIVAVGRAGLVTSDMVKPGALVIDVGVNRVEGR 235

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
                 LVGDV  E  K    AITPVPGGVGPMTI MLM NTV  A R
Sbjct: 236 ------LVGDVDYEAVKEKASAITPVPGGVGPMTITMLMHNTVEVASR 277


>gi|315173307|gb|EFU17324.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Enterococcus faecalis TX1346]
          Length = 281

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 136/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++I+G+ +A  +  +I + V  + ++ G+Q GL V+LVG +PAS +YV  K R A   
Sbjct: 1   MSTVINGRELADQMQAEIQKDVEKMTQQ-GIQPGLVVLLVGENPASQTYVRNKERAAAKI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S     P  IS+ +L   +   N+D   +GILVQLP+P  + E+ I+ +I P+KDVD
Sbjct: 60  GILSKVEKLPETISEEELLAEIDKYNQDSRFYGILVQLPMPKHIDEEKILLAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +G     ++PCTP G + + E +   DL+G+ AVVIGRSN+ GKPM QL
Sbjct: 120 GFHPMNLGRLFVG--KPEMIPCTPYGIMKMFEAY-DIDLTGKRAVVIGRSNIVGKPMAQL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +NATVT+AHSKT++L E+ + ADILVVA+GR   V  +++K G++VIDVG+NR    
Sbjct: 177 LLMKNATVTIAHSKTEHLAEVAKEADILVVAIGRGHFVTKEFVKPGAVVIDVGMNR---N 233

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           Q GK  L+GDVA DE   +   ITPVP GVGPMTI MLM  TV AA + 
Sbjct: 234 QEGK--LIGDVAFDEVSEIASYITPVPKGVGPMTITMLMYQTVEAAKKQ 280


>gi|319762910|ref|YP_004126847.1| methylenetetrahydrofolate dehydrogenase (nadp(+)) [Alicycliphilus
           denitrificans BC]
 gi|330824989|ref|YP_004388292.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Alicycliphilus
           denitrificans K601]
 gi|317117471|gb|ADU99959.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Alicycliphilus
           denitrificans BC]
 gi|329310361|gb|AEB84776.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Alicycliphilus
           denitrificans K601]
          Length = 282

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 139/286 (48%), Positives = 186/286 (65%), Gaps = 9/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG  ++  L  ++A+    LK   G+  GLAVVLVG++PAS  YV  K +  +  GF
Sbjct: 4   QLIDGNALSRQLRAQVAQRTQALKAR-GITPGLAVVLVGDNPASQVYVRNKVKACEDVGF 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV   +   +++ +L   V +LN D +IHGILVQLPLP  + +  +I++I P KDVDG 
Sbjct: 63  HSVLEKYDASMTEAELLARVEALNNDPAIHGILVQLPLPKHIDDHKVIEAISPLKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV +AG +M+G+   G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL
Sbjct: 123 HVASAGALMVGE--VGFKACTPYGCMKMLESIGMKDLRGKHAVVIGRSNIVGKPMAMMLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+ HS T +L  + R ADI+V AVG+  ++  D +K G++VIDVG+NR +    
Sbjct: 181 AANATVTICHSGTADLAAMTRQADIVVAAVGKRGVLTADMVKPGAVVIDVGMNRNDE--- 237

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK  L GDV  D  K V G ITPVPGGVGPMTI ML+ NT+ AA R
Sbjct: 238 GK--LCGDVDFDGVKEVAGYITPVPGGVGPMTITMLLVNTLEAAER 281


>gi|117926986|ref|YP_867603.1| methenyltetrahydrofolate cyclohydrolase [Magnetococcus sp. MC-1]
 gi|158705774|sp|A0LE04|FOLD_MAGSM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|117610742|gb|ABK46197.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Magnetococcus
           sp. MC-1]
          Length = 285

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 181/289 (62%), Gaps = 9/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A  + +++   V  LK    +  GLAVVLVG DPAS  YV  K R  +  
Sbjct: 1   MAHVIDGKAIAQSVREELRMEVERLKLNHQLTPGLAVVLVGADPASQVYVRNKKRACETA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S  +      SQ +L   +  LN+DD++HGILVQLPLP  + EQ ++++I P KD D
Sbjct: 61  GIASFSHELAATTSQAELLALIEQLNQDDAVHGILVQLPLPKHIDEQKVLEAISPSKDAD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G+++ GD T    PCTP G + ++ +  G D  G+HAVVIGRSN+ GKP+  +
Sbjct: 121 GFHPYNVGRLVTGDPT--FQPCTPWGVMEML-KVSGVDPKGKHAVVIGRSNIVGKPVALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ +ATVT+ HS+T +L E  + ADI+V AVGR  MV   WIK G++VIDVGINR    
Sbjct: 178 LLAAHATVTICHSRTPDLAETVKRADIVVAAVGRANMVPGSWIKKGAVVIDVGINRGED- 236

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
             GK  L GDV    C     AITPVPGGVGPMTIAML+ NTV  A R+
Sbjct: 237 --GK--LCGDVDYASCFEHASAITPVPGGVGPMTIAMLLKNTVEGAKRA 281


>gi|255586321|ref|XP_002533811.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus
           communis]
 gi|223526248|gb|EEF28564.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus
           communis]
          Length = 366

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 134/287 (46%), Positives = 191/287 (66%), Gaps = 5/287 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK+VA  + ++I   V+ +K E GV  GLAV+LVG+   S +YV  K +     G +
Sbjct: 77  VIDGKLVAMKIREEITVEVSRMKDEIGVVPGLAVILVGDRKDSATYVRNKKKACDSVGIN 136

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S + N P D ++ ++   +   N D S+HGILVQLPLPS +++Q+I+ ++  EKDVDG H
Sbjct: 137 SFEANLPEDSTEQEVLKFISGFNSDPSVHGILVQLPLPSHMNDQNILNAVSIEKDVDGFH 196

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G I L+ ++ G ++ G+ AVVIGRSN+ G P   +L  
Sbjct: 197 PLNIGRLAMRGREPLFVPCTPKGCIELLHRY-GVEIKGKRAVVIGRSNIVGMPAALMLQR 255

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATV++ HS+TKN  EI R ADI++ AVG+P MV+ +WIK G++VIDVGIN +   +  
Sbjct: 256 EDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGNWIKPGAVVIDVGINPVEDAKSP 315

Query: 244 KTV-LVGDVADE--CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +   LVGDV  E  CK V  A+TPVPGGVGPMTIAML++NT+ +A R
Sbjct: 316 RGYRLVGDVCYEEACK-VASAVTPVPGGVGPMTIAMLLSNTLTSAKR 361


>gi|195606540|gb|ACG25100.1| C-1-tetrahydrofolate synthase, cytoplasmic [Zea mays]
          Length = 369

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 190/291 (65%), Gaps = 3/291 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK+VA  + ++IA  V  +K   G+  GLAV+LVG+   S +YV  K +  +  G  
Sbjct: 80  LIDGKLVAKQVREEIAVQVTRMKDVIGIVPGLAVILVGSRKDSQTYVRNKKKACEAVGIK 139

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S + N P D S+ ++   + S N D S+HGILVQLPLP  +++++I+ ++  EKDVDG H
Sbjct: 140 SYEVNLPEDSSEEEVIKHIASFNSDPSVHGILVQLPLPRHMNDENILNAVSIEKDVDGFH 199

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G + L+ +  G ++ G+ AVVIGRSN+ G P   LL  
Sbjct: 200 PLNIGRLAMQGRDPFFVPCTPKGCMELLHRH-GVEIKGKRAVVIGRSNIVGTPAALLLQK 258

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATV++ HS+TKN  +I R ADI++ AVG   +V+ DWIK G+ +IDVGIN ++ P+  
Sbjct: 259 ANATVSIVHSQTKNPEQITRQADIVIAAVGVANLVRGDWIKPGATIIDVGINPVDDPESP 318

Query: 244 KTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           +   LVGDV  +E   V GAITPVPGGVGPMTIAML++NT+ +A R  G K
Sbjct: 319 RGYRLVGDVCYEEASKVAGAITPVPGGVGPMTIAMLLSNTLESARRIHGFK 369


>gi|219884419|gb|ACL52584.1| unknown [Zea mays]
          Length = 369

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 190/291 (65%), Gaps = 3/291 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK+VA  + ++IA  V  +K   G+  GLAV+LVG+   S +YV  K +  +  G  
Sbjct: 80  LIDGKLVAKQVREEIAVQVTRMKDVIGIVPGLAVILVGSRKDSQTYVRNKKKACEAVGIK 139

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S + N P D S+ ++   + S N D S+HGILVQLPLP  +++++I+ ++  EKDVDG H
Sbjct: 140 SYEVNLPEDSSEEEVIKHIASFNSDPSVHGILVQLPLPRHMNDENILNAVSIEKDVDGFH 199

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G + L+ +  G ++ G+ AVVIGRSN+ G P   LL  
Sbjct: 200 PLNIGRLAMQGRDPFFVPCTPKGCMELLHRH-GVEIKGKRAVVIGRSNIVGTPAALLLQK 258

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATV++ HS+TKN  +I R ADI++ AVG   +V+ DWIK G+ +IDVGIN ++ P+  
Sbjct: 259 ANATVSIVHSQTKNPEQITRQADIVIAAVGVANLVRGDWIKPGATIIDVGINPVDDPESP 318

Query: 244 KTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMK 292
           +   LVGDV  +E   V GAITPVPGGVGPMTIAML++NT+ +A R  G K
Sbjct: 319 RGYRLVGDVCYEEASKVAGAITPVPGGVGPMTIAMLLSNTLESARRIHGFK 369


>gi|121594477|ref|YP_986373.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Acidovorax sp. JS42]
 gi|158705706|sp|A1W7S2|FOLD_ACISJ RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|120606557|gb|ABM42297.1| 5,10-methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Acidovorax sp.
           JS42]
          Length = 282

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 185/286 (64%), Gaps = 9/286 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LIDG  ++  L  ++A   A LK + G+  GLAVVLVG++PAS  YV  K +  +  GF
Sbjct: 4   QLIDGNALSRQLRTEVAARTAALK-DRGITPGLAVVLVGDNPASQVYVRNKVKACEDVGF 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HSV   +   +++  L   V +LN D SIHGILVQLPLP  + +  +I++I P KDVDG 
Sbjct: 63  HSVLEKYDASMTEEQLLARVQALNNDPSIHGILVQLPLPKHIDDHKVIEAISPLKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           HV +AG +M+G    G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL
Sbjct: 123 HVASAGALMVGQV--GFKACTPYGCMKMLESIGMKDLRGKHAVVIGRSNIVGKPMAMMLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           + NATVT+ HS T +L  + R AD++V AVG+  ++  D +K G++VIDVG+NR +    
Sbjct: 181 AANATVTVCHSGTADLAAMTRQADVVVAAVGKRNVLTADMVKPGAVVIDVGMNRNDE--- 237

Query: 243 GKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           GK  L GDV  E  K V G ITPVPGGVGPMTI ML+ NT+ AA R
Sbjct: 238 GK--LCGDVDFEGVKQVAGYITPVPGGVGPMTITMLLVNTLEAAER 281


>gi|322389026|ref|ZP_08062595.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus parasanguinis ATCC 903]
 gi|321144273|gb|EFX39682.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus parasanguinis ATCC 903]
          Length = 284

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 145/290 (50%), Positives = 193/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A+ L  +IA+  A LK+ETGV  GL V++VG++PAS  YV  K R A   
Sbjct: 1   MTTIIDGKALATKLQGEIAKKTARLKEETGVVPGLVVIVVGDNPASKIYVRNKERSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P  ISQ +L   +   N+D   HGILVQLPLP  +   +++ +I P KDVD
Sbjct: 61  GFRSEVRRLPESISQAELLEVIEHYNQDPLWHGILVQLPLPKHIDADAVLLAIDPTKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G+    +VP TPAG + + +++ G DL G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWAGNPI--MVPSTPAGIMEMFKEY-GIDLEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +LP+I R ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLPKIARRADILVVAIGRAKFVTADFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMT+ MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDFDSVAPLASHITPVPGGVGPMTVTMLMEQTYEAAVRAL 282


>gi|291288763|ref|YP_003505579.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290885923|gb|ADD69623.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 283

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 138/288 (47%), Positives = 185/288 (64%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++++GK +A+ +   +   VA  K + G   GLAV LVG DPAS  YV+AK +     G+
Sbjct: 5   TIMNGKALAAKVRAGLKTKVADYKSKHGRGPGLAVFLVGEDPASDIYVNAKNKACVEAGY 64

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV    P +    +L  AV   NKDD+IHGILVQLPLP  + E+ +I +I PEKDVDG 
Sbjct: 65  KSVVIRMPENTPTEELLAAVEKYNKDDTIHGILVQLPLPKHIDEKKVIYAIAPEKDVDGF 124

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N G +  G+   GL PCTPAG +++++++   D  G+HAVVIG SN+ G+PM  LLL
Sbjct: 125 HPFNVGLMYSGE--EGLYPCTPAGCMMILDEYN-IDPRGKHAVVIGASNIVGRPMSALLL 181

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
             ++T T  H  T+NL EI R ADILV A+G+P  V  D +K G++VID+GINR++    
Sbjct: 182 RADSTTTTCHIYTQNLKEITRQADILVAALGKPEFVTADHVKEGAVVIDIGINRVD---- 237

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK  LVGDVA +E       ITPVPGGVGPMTIA+L+ NT+ A   +L
Sbjct: 238 GK--LVGDVAFEEVSKKASYITPVPGGVGPMTIAVLLDNTLKAFEATL 283


>gi|221067197|ref|ZP_03543302.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Comamonas
           testosteroni KF-1]
 gi|220712220|gb|EED67588.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Comamonas
           testosteroni KF-1]
          Length = 284

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 140/288 (48%), Positives = 190/288 (65%), Gaps = 9/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK ++  L  ++A   A LK + G+  GLAV+LVG++ AS  YV  K +  +  GFH
Sbjct: 5   LIDGKALSEQLRKEVATRAAALKVK-GITPGLAVILVGDNQASQVYVRNKVKACEDVGFH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV   +   +++ +L   V +LN D SIHGILVQLPLP  + +  +I++I P KDVDG H
Sbjct: 64  SVLEKYDASMTEAELLARVEALNNDPSIHGILVQLPLPKHIDDHKVIETISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M+G+   G   CTP G + ++E     DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 124 VASAGALMVGEV--GFKACTPYGCMKMLESIGMKDLRGKHAVVIGRSNIVGKPMAMMLLA 181

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            NATVT+ HS T +L  + R ADI+V AVG+  ++  D +K G++VIDVG+NR N+   G
Sbjct: 182 ANATVTVTHSGTADLGAMTRQADIIVAAVGKVDVLTADMVKPGAVVIDVGMNR-NAE--G 238

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV  +  K V G ITPVPGGVGPMTI ML+ NT+ +A R+ G
Sbjct: 239 K--LCGDVDFNGVKEVAGYITPVPGGVGPMTITMLLVNTMESAERAAG 284


>gi|90961509|ref|YP_535425.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Lactobacillus
           salivarius UCC118]
 gi|119369803|sp|Q1WUJ3|FOLD_LACS1 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|90820703|gb|ABD99342.1| Methylenetetrahydrofolate dehydrogenase (NADP+) /
           Methenyltetrahydrofolate cyclohydrolase [Lactobacillus
           salivarius UCC118]
          Length = 285

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 193/292 (66%), Gaps = 14/292 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           + +++DG++++  +   ++E V+ LK+E G+   L V+LVG DPAS  YV  K + A   
Sbjct: 2   VATILDGRMLSKKIRTNVSEKVSLLKQE-GITPKLVVILVGEDPASQVYVRNKRKTAHAL 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  +V    P ++ + +L   +  LN D ++HGILVQLPLP  ++E  +   I+PEKDVD
Sbjct: 61  GIEAVDIRLPENVEEDELIRLIDELNSDGTVHGILVQLPLPKHINENKVTHRIIPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDL--SGQHAVVIGRSNLFGKPMG 178
           G H +N GK+ +     G +PCTP G   ++E FK  D+  SG+  V++GRSN+ G+PM 
Sbjct: 121 GFHPLNIGKLFMN--IPGPLPCTPRG---IMEFFKEYDIPVSGKRVVIVGRSNIVGRPMA 175

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LL++ +ATVT+AHSKTKNL E+ + ADIL+VA+G+   +  +++K G++VIDVG+NR N
Sbjct: 176 ALLVNSDATVTIAHSKTKNLAEVTKQADILIVAIGKGEFIDENYVKKGAVVIDVGMNRNN 235

Query: 239 SPQLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSL 289
               GK  LVGDV  E  S V + ITPVPGGVGPMTIAMLM  TV  A RS+
Sbjct: 236 D---GK--LVGDVNMESVSKVASYITPVPGGVGPMTIAMLMKQTVELAERSV 282


>gi|227890596|ref|ZP_04008401.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Lactobacillus
           salivarius ATCC 11741]
 gi|227867534|gb|EEJ74955.1| methylenetetrahydrofolate dehydrogenase (NADP+) /
           methenyltetrahydrofolate cyclohydrolase [Lactobacillus
           salivarius ATCC 11741]
          Length = 292

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 193/292 (66%), Gaps = 14/292 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           + +++DG++++  +   ++E V+ LK+E G+   L V+LVG DPAS  YV  K + A   
Sbjct: 9   VATILDGRMLSKKIRTNVSEKVSLLKQE-GITPKLVVILVGEDPASQVYVRNKRKTAHAL 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  +V    P ++ + +L   +  LN D ++HGILVQLPLP  ++E  +   I+PEKDVD
Sbjct: 68  GIEAVDIRLPENVEEDELIRLIDELNSDGTVHGILVQLPLPKHINENKVTHRIIPEKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDL--SGQHAVVIGRSNLFGKPMG 178
           G H +N GK+ +     G +PCTP G   ++E FK  D+  SG+  V++GRSN+ G+PM 
Sbjct: 128 GFHPLNIGKLFMN--IPGPLPCTPRG---IMEFFKEYDIPVSGKRVVIVGRSNIVGRPMA 182

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LL++ +ATVT+AHSKTKNL E+ + ADIL+VA+G+   +  +++K G++VIDVG+NR N
Sbjct: 183 ALLVNSDATVTIAHSKTKNLAEVTKQADILIVAIGKGEFIDENYVKKGAVVIDVGMNRNN 242

Query: 239 SPQLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSL 289
               GK  LVGDV  E  S V + ITPVPGGVGPMTIAMLM  TV  A RS+
Sbjct: 243 D---GK--LVGDVNMESVSKVASYITPVPGGVGPMTIAMLMKQTVELAERSV 289


>gi|170077511|ref|YP_001734149.1| 5,10-methylenetetrahydrofolate dehydrogenase; methenyl
           tetrahydrofolate cyclohydrolase [Synechococcus sp. PCC
           7002]
 gi|169885180|gb|ACA98893.1| 5,10-methylenetetrahydrofolate dehydrogenase; methenyl
           tetrahydrofolate cyclohydrolase [Synechococcus sp. PCC
           7002]
          Length = 288

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 180/282 (63%), Gaps = 4/282 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK  A  +   +   +A L  + G   GLAV++VG++PAS +YV  K R  +  
Sbjct: 1   MAQILDGKSFAQKIQANLKTQIAALTPKMGRPPGLAVLMVGDNPASAAYVRNKERACERI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S   +FP D +Q +LE  +  LN+D+ + GILVQLPLP  +    ++ +I PEKD D
Sbjct: 61  GMASFGKHFPADTTQSELEAVIQDLNQDERVDGILVQLPLPPHLDAVGLLLTIAPEKDAD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH +N G ++  +   GL  CTP G + L++++    L G+ AVV+GRS L GKP+  +
Sbjct: 121 GLHPLNLGHLVRSE--PGLRSCTPYGVMELLKEYH-IPLEGKKAVVVGRSILVGKPIALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATV +AHS+T++L  + R ADILV A+GRP  +  D IK G++VIDVGINRI   
Sbjct: 178 LLEANATVAIAHSRTQDLAAVTREADILVAAIGRPEFITADMIKPGAVVIDVGINRIVDT 237

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANT 281
             GK+ LVGDVA  E   V   ITPVPGG+GPMT+AML+ NT
Sbjct: 238 ATGKSRLVGDVAYTEAAQVAAQITPVPGGIGPMTVAMLLQNT 279


>gi|114319752|ref|YP_741435.1| methenyltetrahydrofolate cyclohydrolase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|119369616|sp|Q0AB42|FOLD_ALHEH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|114226146|gb|ABI55945.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 286

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 136/284 (47%), Positives = 182/284 (64%), Gaps = 9/284 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            ++DGK +A+ L +++ + V    +  G + GLAVVLVG DPAS  YV  K +  +  G 
Sbjct: 4   QILDGKAIAAELREQVRKQVEARVERGGRRPGLAVVLVGADPASTVYVGKKRQACEQLGM 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HS  +  P + +Q +L   V  LN  D I GILVQLPLP  + EQ++I  I P+KDVDG 
Sbjct: 64  HSSAHELPAETTQDELLALVDELNGRDEIDGILVQLPLPDHIDEQTVIDRIHPDKDVDGF 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H VN G++ +     GL PCTP G + ++    G +L G+ AV+IG+SN+ G+PM   LL
Sbjct: 124 HPVNMGRLTL--RLPGLRPCTPNGVMTMLAH-AGIELEGKDAVIIGQSNIVGRPMAMELL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
           +   T+T+ HS+T+NL +  R ADI+V AVGRP  V  DWIK G++VIDVGINR+ S   
Sbjct: 181 NARCTITICHSRTRNLADRVRAADIVVAAVGRPGFVPGDWIKPGAVVIDVGINRLES--- 237

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           GK  L GDV     + + G ITPVPGGVGPMT+A LMANT+ AA
Sbjct: 238 GK--LTGDVDFAAARELAGWITPVPGGVGPMTVATLMANTLAAA 279


>gi|300214350|gb|ADJ78766.1| Bifunctional protein folD (Includes: Methylenetetrahydrofolate
           dehydrogenase; Methenyltetrahydrofolate cyclohydrolase )
           [Lactobacillus salivarius CECT 5713]
          Length = 285

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 194/292 (66%), Gaps = 14/292 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           + +++DG++++  +   ++E V+ LK+E G+   L V+LVG DPAS  YV  K + A   
Sbjct: 2   VATILDGRMLSKKIRTNVSEKVSLLKQE-GITPKLVVILVGEDPASQVYVRNKRKTAHAL 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  +V    P ++ + +L   +  LN D ++HGILVQLPLP  ++E  +   I+PEKDVD
Sbjct: 61  GIEAVDIRLPENVEEDELIRLIDELNSDGTVHGILVQLPLPKHINENKVTHRIIPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDL--SGQHAVVIGRSNLFGKPMG 178
           G H +N GK+ +     G +PCTP G   ++E FK  D+  SG+  V++GRSN+ G+PM 
Sbjct: 121 GFHPLNIGKLFMN--IPGPLPCTPRG---IMEFFKEYDIPVSGKRVVIVGRSNIVGRPMA 175

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LL++ +ATVT+AHSKTKNL E+ R ADIL+VA+G+   +  ++++ G++VIDVG+NR N
Sbjct: 176 ALLVNSDATVTIAHSKTKNLAEVTRQADILIVAIGKDEFIDENYVRKGAVVIDVGMNR-N 234

Query: 239 SPQLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           S   GK  LVGDV  E  S V + ITPVPGGVGPMTIAMLM  TV  A RS+
Sbjct: 235 SD--GK--LVGDVNMESVSKVASYITPVPGGVGPMTIAMLMKQTVELAERSV 282


>gi|55981089|ref|YP_144386.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase [Thermus
           thermophilus HB8]
 gi|81364140|sp|Q5SJ94|FOLD_THET8 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|55772502|dbj|BAD70943.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase [Thermus
           thermophilus HB8]
          Length = 282

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 172/251 (68%), Gaps = 9/251 (3%)

Query: 35  LAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGI 94
           L V+ +G DPAS +YV  K + A+  G+ S    +P D+ +  L   + +LN D+ + GI
Sbjct: 32  LRVIRLGEDPASVAYVRLKDKRARALGYRSQVEVYPEDLPEEALLERIAALNADEEVDGI 91

Query: 95  LVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQF 154
           LVQLPLP  +  Q ++++I P KDVDG H +N G++  G    GL PCTP G + L++ +
Sbjct: 92  LVQLPLPPHIRTQRVLEAIHPLKDVDGFHPLNVGRLWSGG--KGLFPCTPLGVVRLLKHY 149

Query: 155 KGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGR 214
            G DL G+  VV+GRSN+ GKP+  LLL  +ATVT+AHSKT++LPE+ R A +LVVAVGR
Sbjct: 150 -GVDLRGKEVVVVGRSNIVGKPLAGLLLREDATVTLAHSKTQDLPEVTRRAQVLVVAVGR 208

Query: 215 PRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTI 274
           P +V+ +W++ G++V+DVG+NR+     G+  L+GDV  E   V  A+TPVPGGVGPMT+
Sbjct: 209 PHLVRKEWVREGAIVVDVGVNRVE----GR--LLGDVHPEVAEVAFALTPVPGGVGPMTV 262

Query: 275 AMLMANTVIAA 285
           AMLM NT+ AA
Sbjct: 263 AMLMGNTLEAA 273


>gi|255322597|ref|ZP_05363742.1| bifunctional protein FolD [Campylobacter showae RM3277]
 gi|255300505|gb|EET79777.1| bifunctional protein FolD [Campylobacter showae RM3277]
          Length = 283

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 185/285 (64%), Gaps = 12/285 (4%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +++DGK V++ + +++      LK + G++  LAV+LVG D AS +YV+AK +    C  
Sbjct: 2   TILDGKNVSAQVKERVKNEALNLKNQ-GIEPALAVILVGEDKASQTYVAAKEKACIACEI 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV +  P   +Q +L   +  LN DD I GILVQLPLP  +    I+++I P KDVDG 
Sbjct: 61  KSVMHRLPESTTQSELIALIDVLNLDDGIDGILVQLPLPKHIDTNKILETISPAKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCD--LSGQHAVVIGRSNLFGKPMGQL 180
             +N GK+  G    G VPCTP G   ++E FK  D  L G++AVVIGRSN+ GKPM  L
Sbjct: 121 AAINVGKLASG--LDGFVPCTPLG---IMEIFKAYDINLEGKNAVVIGRSNIVGKPMANL 175

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+ HSKT+NL EIC  ADILV A+GR   V  D +K G++VIDVGINR++  
Sbjct: 176 LLNANATVTVTHSKTQNLKEICADADILVAAIGRADFVTADMVKDGAVVIDVGINRMDDG 235

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           +L   V   +VA +C      ITPVPGGVGPMTIAML++NT+ +A
Sbjct: 236 KLKGDVKFDEVAPKC----SFITPVPGGVGPMTIAMLLSNTIKSA 276


>gi|261367589|ref|ZP_05980472.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Subdoligranulum variabile DSM 15176]
 gi|282570375|gb|EFB75910.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Subdoligranulum variabile DSM 15176]
          Length = 284

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 148/287 (51%), Positives = 185/287 (64%), Gaps = 10/287 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LI+GK +A+ +  + A+    LK + G+   LAV+LVG DPAS  YV  K      CG  
Sbjct: 5   LIEGKALAAEVKREAAQQTEALKAK-GITPCLAVILVGEDPASQVYVRGKINDCAQCGIE 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S     P + +Q +L   V  L  D ++HGILVQLPLP+ + E++II +I PEKDVDG  
Sbjct: 64  SRNIRLPEETTQEELLARVDELAGDPAVHGILVQLPLPAHIDEKAIIDAIPPEKDVDGFS 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G++ IG+     +PCTPAG I +IE   G  + G+HAVVIGRSN+ GKP   LLL+
Sbjct: 124 PVNVGRMQIGEPC--YLPCTPAGCIRMIES-TGVPIPGKHAVVIGRSNIVGKPAAMLLLA 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           +NATVT+ HSKT+NL  IC +ADILV AVGR   V  D IK G++VIDVGINR      G
Sbjct: 181 KNATVTICHSKTQNLQAICASADILVAAVGRAGFVTGDMIKPGAVVIDVGINRGAD---G 237

Query: 244 KTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           K  L GDV  E  +   A ITPVPGGVGPMT AMLM NTV AA R++
Sbjct: 238 K--LHGDVDFETAAQKAAWITPVPGGVGPMTRAMLMLNTVEAARRAM 282


>gi|322382776|ref|ZP_08056620.1| methylenetetrahydrofolate dehydrogenase-like
           protein/methenyltetrahydrofolate cyclohydrolase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153245|gb|EFX45691.1| methylenetetrahydrofolate dehydrogenase-like
           protein/methenyltetrahydrofolate cyclohydrolase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 288

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/288 (46%), Positives = 188/288 (65%), Gaps = 8/288 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G +I+GK + S + ++I    A L  E G++ GLAVV+VG+DPAS  YV+ K +  +  G
Sbjct: 3   GQVINGKELVSSIREEIKTEAAKLT-EAGIRPGLAVVIVGDDPASHIYVNNKAKACEQVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            +S  +  P    Q +L   +  LN+D+ IHGILVQ PLPS ++E+ ++  I P KDVD 
Sbjct: 62  IYSKVFRLPEATKQEELLALIQKLNEDNRIHGILVQSPLPSHLNEEEVVDHIDPRKDVDC 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H VN G +MIG    G +PCTPAG I ++++  G D++G+HAVV+GRSN+ GKPM  LL
Sbjct: 122 FHPVNVGNLMIGK--PGFLPCTPAGVIEILKR-TGIDIAGKHAVVVGRSNIVGKPMALLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  +ATVT+ HS+T N+ EI R ADILVVAVG+  +++   +K G++VIDVG+NR    +
Sbjct: 179 LREHATVTVCHSRTPNMEEITRQADILVVAVGKANLIRSHHVKPGAVVIDVGMNRNEHNK 238

Query: 242 LGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           L   V  G    E K +   ITPVPG VGPMTI ML+ NT+ +A + L
Sbjct: 239 LTGDVNFG----EAKEICSYITPVPGCVGPMTITMLLKNTLQSAVKHL 282


>gi|113477590|ref|YP_723651.1| methenyltetrahydrofolate cyclohydrolase [Trichodesmium erythraeum
           IMS101]
 gi|119370079|sp|Q10X46|FOLD_TRIEI RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|110168638|gb|ABG53178.1| Methenyltetrahydrofolate cyclohydrolase [Trichodesmium erythraeum
           IMS101]
          Length = 287

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 187/283 (66%), Gaps = 5/283 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M + +DGK +A  +  ++ + V  L+ + G   GLAV++VG++PAS  YV  K +     
Sbjct: 1   MTNKLDGKALAKKIKAELQQKVQSLQIKIGRPPGLAVLMVGDNPASGVYVRNKEKACTQV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+  +FP   SQ  L   +  LN+D  + GILVQLPLP  +   S++  I P KDVD
Sbjct: 61  GITSLGKHFPTQTSQAQLGQVIQKLNQDPQVDGILVQLPLPKHLDSTSLLYQIDPSKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           GLH +N G+++ G+   GL  CTPAG + L++++K  +L G+HAV++GRS L GKPM  +
Sbjct: 121 GLHPMNLGQLLRGE--KGLRSCTPAGVMRLLQEYK-IELQGKHAVILGRSILVGKPMALM 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  N+TVT+AHS++KNL  I + ADIL+ AVGRP+M+  + +K G++VIDVGINR+   
Sbjct: 178 LLEANSTVTIAHSRSKNLEAITKKADILITAVGRPKMISAEMVKPGAVVIDVGINRVID- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTV 282
           + G + LVGDV  +    V   ITPVPGG+GPMT+AML+ NTV
Sbjct: 237 EAGNSQLVGDVQFNSVAQVAEYITPVPGGIGPMTVAMLLQNTV 279


>gi|242063846|ref|XP_002453212.1| hypothetical protein SORBIDRAFT_04g001700 [Sorghum bicolor]
 gi|241933043|gb|EES06188.1| hypothetical protein SORBIDRAFT_04g001700 [Sorghum bicolor]
          Length = 368

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/289 (45%), Positives = 190/289 (65%), Gaps = 3/289 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           +  +IDGK+VA  + ++IA  V  +K   G+  GLAV+LVG+   S +YV  K +  +  
Sbjct: 76  LAKVIDGKLVAKQVREEIAVEVTRMKDAIGIVPGLAVILVGSRKDSQTYVRNKKKACEAV 135

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S + N P D S+ ++   + S N D S+HGILVQLPLP  +++++I+ ++  EKDVD
Sbjct: 136 GIKSYEVNLPEDSSEEEVIKHIASFNSDPSVHGILVQLPLPRHMNDENILNAVSIEKDVD 195

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++ +       VPCTP G + L+ ++ G ++ G+ AVVIGRSN+ G P   L
Sbjct: 196 GFHPLNIGRLAMQGRDPFFVPCTPKGCMELLHRY-GVEIKGKRAVVIGRSNIVGMPAALL 254

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           L   NATV++ HS+TKN  EI R ADI++ AVG   +V+ +WIK G+ +IDVGIN ++ P
Sbjct: 255 LQKANATVSIVHSQTKNPEEITRQADIVIAAVGVANLVRGNWIKPGAAIIDVGINPVDDP 314

Query: 241 QLGKTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +  +   LVGDV  +E   V GAITPVPGGVGPMTIAML++NT+ +A R
Sbjct: 315 ESPRGYRLVGDVCYEEASKVAGAITPVPGGVGPMTIAMLLSNTLESAKR 363


>gi|296876943|ref|ZP_06900988.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus parasanguinis ATCC 15912]
 gi|296432074|gb|EFH17876.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Streptococcus parasanguinis ATCC 15912]
          Length = 284

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 144/290 (49%), Positives = 193/290 (66%), Gaps = 9/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK +A+ L  +IAE    LK+ETGV  GL V++VG++PAS  YV  K R A   
Sbjct: 1   MTTIIDGKALATKLQGEIAEKTVRLKEETGVVPGLVVIVVGDNPASKIYVRNKERSAIAA 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S     P +ISQ +L   +   N+D   HGILVQLPLP  +   +++ +I P KDVD
Sbjct: 61  GFRSEVRQLPENISQDELLEVIEHYNQDSLWHGILVQLPLPKHIDADAVLLAIDPTKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N G++  G+    +VP TPAG + + +++ G DL G+ AVVIGRSN+ GKPM QL
Sbjct: 121 GFHPLNMGRLWAGNPI--MVPSTPAGIMEMFKEY-GIDLEGKRAVVIGRSNIVGKPMAQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL++NATVT+ HS+T +LP+I + ADILVVA+GR + V  D++K G++VIDVG+NR  + 
Sbjct: 178 LLAKNATVTLTHSRTHHLPKIAKRADILVVAIGRAKFVTADFVKEGAVVIDVGMNRDEN- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             GK  L GDV  D    +   ITPVPGGVGPMT+ MLM  T  AA R+L
Sbjct: 237 --GK--LCGDVDFDSVAPLASHITPVPGGVGPMTVTMLMEQTYEAAVRTL 282


>gi|46199061|ref|YP_004728.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase [Thermus
           thermophilus HB27]
 gi|81405916|sp|Q72JL7|FOLD_THET2 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|46196685|gb|AAS81101.1| methylenetetrahydrofolate dehydrogenase
           (NADP+)/methenyltetrahydrofolate cyclohydrolase [Thermus
           thermophilus HB27]
          Length = 282

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 172/251 (68%), Gaps = 9/251 (3%)

Query: 35  LAVVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGI 94
           L V+ +G DPAS +YV  K + A+  G+ S    +P D+ +  L   + +LN D+ + GI
Sbjct: 32  LRVIRLGEDPASVAYVRLKDKRARALGYRSQVEVYPEDLPEEALLERIAALNADEEVDGI 91

Query: 95  LVQLPLPSTVSEQSIIQSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQF 154
           LVQLPLP  +  Q ++++I P KDVDG H +N G++  G    GL PCTP G + L++ +
Sbjct: 92  LVQLPLPPHIRTQRVLEAIHPLKDVDGFHPLNVGRLWSGG--KGLFPCTPLGVVRLLKHY 149

Query: 155 KGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGR 214
            G DL G+  VV+GRSN+ GKP+  LLL  +ATVT+AHSKT++LP++ R A +LVVAVGR
Sbjct: 150 -GVDLRGKEVVVVGRSNIVGKPLAGLLLREDATVTLAHSKTQDLPQVTRRAQVLVVAVGR 208

Query: 215 PRMVQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVADECKSVVGAITPVPGGVGPMTI 274
           P +V+ +W++ G++V+DVG+NR+     G+  L+GDV  E   V  A+TPVPGGVGPMT+
Sbjct: 209 PHLVRKEWVREGAIVVDVGVNRVE----GR--LLGDVHPEVAEVASALTPVPGGVGPMTV 262

Query: 275 AMLMANTVIAA 285
           AMLM NT+ AA
Sbjct: 263 AMLMGNTLEAA 273


>gi|296114356|ref|ZP_06833010.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295979117|gb|EFG85841.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 308

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/283 (51%), Positives = 179/283 (63%), Gaps = 5/283 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK  A+ LT  IAE V        V  GLAVVLVGNDPAS  YV  K       G  
Sbjct: 19  LIDGKGFANRLTQDIAEDVRAFYARHQVTPGLAVVLVGNDPASEVYVRNKALQTHRAGMR 78

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P   SQ +L   +  LN D  IHGILVQLPLP  +   ++  +I P KDVDGL 
Sbjct: 79  SFMHMLPETTSQEELLALIARLNIDPEIHGILVQLPLPGDLDPVAVTNAIDPRKDVDGLG 138

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           VVNAG++ +G    GLVPCTP G +LL++ + G DL G +A+V+G SNL G+PM QLLL 
Sbjct: 139 VVNAGRLALG--LPGLVPCTPLGCLLLLKSYVG-DLRGLNAMVVGASNLVGRPMAQLLLR 195

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
              TVT+AH  T++   + R ADILVVA G   +V   WIK G+ VIDVGI+R+   + G
Sbjct: 196 EGCTVTVAHIDTRDPQVLARQADILVVATGCSGLVNGAWIKPGATVIDVGISRVPV-ENG 254

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           KT LVGDV  DE + + G ITPVPGGVGPMTIA L+ NT+ AA
Sbjct: 255 KTRLVGDVVFDEARHIAGQITPVPGGVGPMTIACLLRNTMQAA 297


>gi|301300960|ref|ZP_07207125.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851427|gb|EFK79146.1| tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
           protein [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 285

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 194/292 (66%), Gaps = 14/292 (4%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           + +++DG++++  +   ++E V+ LK+E G+   L V+LVG DPAS  YV  K + A   
Sbjct: 2   VATILDGRMLSKKIRTNVSEKVSLLKQE-GITPKLVVILVGEDPASQIYVRNKRKTAHAL 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  +V    P ++ + +L   +  LN D ++HGILVQLPLP  ++E  +   I+PEKDVD
Sbjct: 61  GIEAVDIRLPENVEEDELIRLIDELNSDRTVHGILVQLPLPKHINENKVTHRIIPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDL--SGQHAVVIGRSNLFGKPMG 178
           G H +N GK+ +     G +PCTP G   ++E FK  D+  SG+  V++GRSN+ G+PM 
Sbjct: 121 GFHPLNIGKLFMN--IPGPLPCTPRG---IMEFFKEYDIPVSGKRVVIVGRSNIVGRPMA 175

Query: 179 QLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRIN 238
            LL++ +ATVT+AHSKTKNL E+ R ADIL+VA+G+   +  ++++ G++VIDVG+NR N
Sbjct: 176 ALLVNSDATVTIAHSKTKNLAEVTRQADILIVAIGKGEFIDENYVRKGAVVIDVGMNR-N 234

Query: 239 SPQLGKTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           S   GK  LVGDV  E  S V + ITPVPGGVGPMTIAMLM  TV  A RS+
Sbjct: 235 SD--GK--LVGDVNMESVSKVASYITPVPGGVGPMTIAMLMKQTVELAERSV 282


>gi|15236888|ref|NP_191971.1| tetrahydrofolate dehydrogenase/cyclohydrolase, putative
           [Arabidopsis thaliana]
 gi|3047116|gb|AAC13627.1| F6N23.26 gene product [Arabidopsis thaliana]
 gi|7267401|emb|CAB80871.1| putative tetrahydrofolate synthase [Arabidopsis thaliana]
 gi|16649149|gb|AAL24426.1| Unknown protein [Arabidopsis thaliana]
 gi|23197716|gb|AAN15385.1| Unknown protein [Arabidopsis thaliana]
 gi|332656510|gb|AEE81910.1| Amino acid dehydrogenase family protein [Arabidopsis thaliana]
          Length = 360

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/286 (46%), Positives = 184/286 (64%), Gaps = 3/286 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA  + D+I   V+ +K+  GV  GLAV+LVG+   S +YV  K +     G  
Sbjct: 71  VIDGKAVAKKIRDEITIEVSRMKESIGVIPGLAVILVGDRKDSATYVRNKKKACDSVGIK 130

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S +     D S+ ++  +V   N D S+HGILVQLPLPS + EQ+I+ ++  EKDVDG H
Sbjct: 131 SFEVRLAEDSSEEEVLKSVSGFNDDPSVHGILVQLPLPSHMDEQNILNAVSIEKDVDGFH 190

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G I L+ ++   ++ G+ AVVIGRSN+ G P   LL  
Sbjct: 191 PLNIGRLAMRGREPLFVPCTPKGCIELLHRYN-IEIKGKRAVVIGRSNIVGMPAALLLQR 249

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATV++ HS+TKN  EI R ADI++ AVG+P MV+  WIK G+++IDVGIN +  P   
Sbjct: 250 EDATVSIIHSRTKNPEEITREADIIISAVGQPNMVRGSWIKPGAVLIDVGINPVEDPSAA 309

Query: 244 KTV-LVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +   LVGD+  +E   V  AITPVPGGVGPMTIAML++NT+ +A R
Sbjct: 310 RGYRLVGDICYEEASKVASAITPVPGGVGPMTIAMLLSNTLTSAKR 355


>gi|326791249|ref|YP_004309070.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           lentocellum DSM 5427]
 gi|326542013|gb|ADZ83872.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Clostridium
           lentocellum DSM 5427]
          Length = 282

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/286 (47%), Positives = 190/286 (66%), Gaps = 10/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK++++++ D++ E VA LK + G+  GLAV+LVG++ AS  YV  K +  ++ 
Sbjct: 1   MSKIIDGKLISTMIKDELKEEVALLKTQ-GIHPGLAVILVGDNSASQVYVGNKKKACEYV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S  Y  P++  + DL   + +LN+DD +HG+LVQLPLP  + EQ +I  I P KDVD
Sbjct: 60  GIKSFSYELPIETPEADLLELIDTLNRDDQVHGVLVQLPLPKHMDEQKVIMRISPAKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  + G + IG    G V CTPAG I L+++    D+ G++ VV+GRSN+ GKP+  L
Sbjct: 120 GFHPQSVGALSIG--LPGFVSCTPAGIIELLKR-SHVDIVGKNCVVVGRSNIVGKPVSLL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  + TVT+ HS+T NL +I + ADI+V AVG P+ ++ + +K  ++VIDVG+NR  + 
Sbjct: 177 LLREHGTVTICHSRTNNLTDILQQADIVVAAVGIPKFIKGEQLKADAVVIDVGMNRDEN- 235

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  L GDV  D  K  V AITPVPGGVGPMTIAMLM N V+AA
Sbjct: 236 --GK--LCGDVDFDSAKDHVAAITPVPGGVGPMTIAMLMKNCVLAA 277


>gi|317403811|gb|EFV84289.1| methenyltetrahydrofolate cyclohydrolase [Achromobacter xylosoxidans
           C54]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 185/286 (64%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDG  ++  + +++A+ VA L  + G + GLAVVLVG DPAS  YV  K    +  G H
Sbjct: 5   IIDGAALSQRIREEVAQRVAALAAK-GTRPGLAVVLVGEDPASQVYVRNKVAACEKAGLH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV+  +P D+++ +L   +  LN+D SIHGILVQLPLP  +    +I++I  EKDVDG H
Sbjct: 64  SVKEQYPADMTEAELLARIDKLNRDPSIHGILVQLPLPKHMDAHKVIEAIAAEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V NAG +M G       PCTP G + ++E  +G  L G  AV++G SN+ GKPM  LLL+
Sbjct: 124 VSNAGLLMTGQPL--FRPCTPYGVMKMLES-EGVALRGAEAVIVGASNIVGKPMAMLLLA 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             AT+T+ +SKT++L    R AD+LVVA G+P M+    IK G++VIDVGINR      G
Sbjct: 181 AGATITICNSKTRDLAAQTRRADVLVVATGKPGMIDGSMIKPGAVVIDVGINRGAD---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV     + V GAITPVPGGVGPMTIAML+ NTV AA R+
Sbjct: 238 K--LCGDVDFASARQVAGAITPVPGGVGPMTIAMLLVNTVEAAERA 281


>gi|220931492|ref|YP_002508400.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Halothermothrix
           orenii H 168]
 gi|254789408|sp|B8D2H8|FOLD_HALOH RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|219992802|gb|ACL69405.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Halothermothrix
           orenii H 168]
          Length = 283

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 139/285 (48%), Positives = 186/285 (65%), Gaps = 9/285 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG +IDGK +AS + +++ E V    +E G   GL+VVLVG+DPAS +YV  K ++AK  
Sbjct: 1   MGKIIDGKKIASEIRNELKEEVKKFTEE-GRPPGLSVVLVGDDPASRTYVRMKEKVAKEI 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S         +Q +L + V  LN D+ I GILVQLPLP  + E+++I++I P KDVD
Sbjct: 60  GIYSKVDYLSRQTTQDELLDIVDKLNNDEKIDGILVQLPLPDHIDEKAVIEAISPFKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H +N GK+  G        CTP G I L+++ +G ++ G+ AVV+GRSN+ GKP+  L
Sbjct: 120 GFHPINTGKLFSGMTGQRFEACTPLGIIELLDR-EGIEIDGKKAVVVGRSNIVGKPVAHL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL R+ATVT+ HS T +L    R ADILVVA GRP++V+ + +K G+ VIDVG NR++  
Sbjct: 179 LLERHATVTVCHSHTADLGIETRQADILVVAAGRPKLVKGEMVKEGAAVIDVGTNRVDGH 238

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
                 LVGDV  E  +   G ITPVPGGVGPMTIAMLM NTV A
Sbjct: 239 ------LVGDVDFEAARQRAGYITPVPGGVGPMTIAMLMKNTVKA 277


>gi|297810105|ref|XP_002872936.1| hypothetical protein ARALYDRAFT_490506 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297318773|gb|EFH49195.1| hypothetical protein ARALYDRAFT_490506 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 361

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 186/287 (64%), Gaps = 5/287 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA  + D+I   V+ +K+  GV  GLAV+LVG+   S +YV  K +     G  
Sbjct: 72  VIDGKAVAKKIRDEITIEVSRMKESIGVIPGLAVILVGDRKDSATYVRNKKKACDSVGIK 131

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S +     D S+ ++  +V + N D S+HGILVQLPLPS + EQ+I+ ++  EKDVDG H
Sbjct: 132 SFEVCLAEDSSEEEVLKSVSAFNGDPSVHGILVQLPLPSHMDEQNILNAVSIEKDVDGFH 191

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G I L+ ++   ++ G+ AVVIGRSN+ G P   LL  
Sbjct: 192 PLNIGRLAMRGREPLFVPCTPKGCIELLHRYN-IEIKGKRAVVIGRSNIVGMPAALLLQR 250

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATV++ HS+TKN  EI R ADI++ AVG+P MV+  WIK G+++IDVGIN +  P   
Sbjct: 251 EDATVSIIHSRTKNPEEITREADIIIAAVGQPNMVRGSWIKPGAVIIDVGINPVEDPSAA 310

Query: 244 KTV-LVGDVADE--CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +   LVGD+  E  CK V  AITPVPGGVGPMTIAML++NT+ +A R
Sbjct: 311 RGYRLVGDICYEEACK-VASAITPVPGGVGPMTIAMLLSNTLTSAKR 356


>gi|307295746|ref|ZP_07575579.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Sphingobium
           chlorophenolicum L-1]
 gi|306878402|gb|EFN09623.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Sphingobium
           chlorophenolicum L-1]
          Length = 289

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 135/285 (47%), Positives = 175/285 (61%), Gaps = 4/285 (1%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M S+I G   A  L   +   VA   +  G    L  VLVG+DPAS  YV  K    +  
Sbjct: 1   MASIISGTAAAEGLLADLTRDVARFSQVHGYAPTLVAVLVGDDPASHIYVRKKIEQCRKV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV++  P D S+ DL   + SLN D+ +HGILVQLPLP+ +    ++ +I P KDVD
Sbjct: 61  GMESVEHRLPADCSEEDLLALIASLNADERVHGILVQLPLPAQIDSGKVLDTIDPRKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN G++  G  T GLVPCTP G ++L+      DL G+ AVVIG+SN+ GKP+  L
Sbjct: 121 GFHPVNVGRLSTG--TGGLVPCTPMGCMILLRSVLP-DLKGKQAVVIGKSNIVGKPVAML 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL +  TVT+    T+NL E+CR ADI+V A G P +V+  W+K G++VIDVGINRI   
Sbjct: 178 LLEQGCTVTVCGRHTRNLAEVCRNADIIVAAAGTPHLVKGYWVKAGAVVIDVGINRIALD 237

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             G++ +VGDVA +      A TPVPGGVGPMTIA L+ NT  AA
Sbjct: 238 D-GRSRIVGDVASDEIGHAAAFTPVPGGVGPMTIACLLLNTFRAA 281


>gi|294498866|ref|YP_003562566.1| tetrahydrofolate dehydrogenase/cyclohydrolase domain-containing
           protein [Bacillus megaterium QM B1551]
 gi|294348803|gb|ADE69132.1| tetrahydrofolate dehydrogenase/cyclohydrolase domain protein
           [Bacillus megaterium QM B1551]
          Length = 284

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 192/283 (67%), Gaps = 11/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I GK VA  L   + E VA LK + G+  GL V+LVG +PAS SYV AK +  +  G  
Sbjct: 5   VIKGKEVAQELRAALKEEVAQLKTK-GIVPGLTVILVGENPASQSYVRAKAKACEEIGVA 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S      V I++ +L N +  LN + S+HGIL+QLPLP  + E++++ ++ P+KDVDG H
Sbjct: 64  SEIIKRDVTITEEELLNEIHHLNGNPSVHGILIQLPLPKHIDEKAVLNAVSPKKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            V+ G ++IGD     +PCTP G + LI++  G ++SG+HAVVIGRSN+ GKP+  LLL 
Sbjct: 124 PVSVGNMVIGDEC--YLPCTPHGIVELIKR-SGEEISGKHAVVIGRSNIVGKPVSMLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT+AHS+TK+L  + + ADILV AVG+PR+++ D IK G++VIDVG    N+ + G
Sbjct: 181 ESATVTIAHSRTKDLSALTKQADILVSAVGQPRLIKADDIKPGAIVIDVG----NTMENG 236

Query: 244 KTVLVGDVADECK-SVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           K  LVGDV  E    V G ITPVPGGVGPMTI ML+ NTV AA
Sbjct: 237 K--LVGDVDYEAALEVAGYITPVPGGVGPMTITMLLKNTVDAA 277


>gi|295704188|ref|YP_003597263.1| tetrahydrofolate dehydrogenase/cyclohydrolase domain-containing
           protein [Bacillus megaterium DSM 319]
 gi|294801847|gb|ADF38913.1| tetrahydrofolate dehydrogenase/cyclohydrolase domain protein
           [Bacillus megaterium DSM 319]
          Length = 284

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 192/283 (67%), Gaps = 11/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I GK VA  L   + E VA LK + G+  GL V+LVG +PAS SYV AK +  +  G  
Sbjct: 5   VIKGKEVAQELRAALKEEVAQLKTK-GIVPGLTVILVGENPASQSYVKAKAKACEEIGVA 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S      V I++ +L N +  LN + S+HGIL+QLPLP  + E++++ ++ P+KDVDG H
Sbjct: 64  SEIIKRDVSITEEELLNEINHLNGNPSVHGILIQLPLPKHIDEKAVLNAVSPKKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            V+ G ++IGD     +PCTP G + LI++  G ++SG+HAVVIGRSN+ GKP+  LLL 
Sbjct: 124 PVSVGNMVIGDEC--YLPCTPHGIVELIKR-SGEEISGKHAVVIGRSNIVGKPVSMLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT+AHS+TK+L  + + ADILV AVG+PR+++ D IK G++VIDVG    N+ + G
Sbjct: 181 ESATVTIAHSRTKDLSALTKQADILVSAVGQPRLIKADDIKPGAIVIDVG----NTMENG 236

Query: 244 KTVLVGDVADECK-SVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           K  LVGDV  E    V G ITPVPGGVGPMTI ML+ NTV AA
Sbjct: 237 K--LVGDVDYEAALEVAGYITPVPGGVGPMTITMLLKNTVDAA 277


>gi|66811082|ref|XP_639248.1| methenyl tetrahydrofolate cyclohydrolase / NADP-dependent methylene
           H4F dehydrogenase [Dictyostelium discoideum AX4]
 gi|60467876|gb|EAL65890.1| methenyl tetrahydrofolate cyclohydrolase / NADP-dependent methylene
           H4F dehydrogenase [Dictyostelium discoideum AX4]
          Length = 292

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/290 (45%), Positives = 189/290 (65%), Gaps = 7/290 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
            G +IDGK ++S + + I + +  +K++      L V+LVG+   S +YV  K + A   
Sbjct: 7   FGKIIDGKEISSQVKESIKDEITLMKEKGLRAPCLVVILVGDRKDSQTYVRNKKKTASDL 66

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S+    P   +Q +L + V S +K D + GILVQLPLPS ++E+ I+  I   KDVD
Sbjct: 67  GINSIDILLPEQTTQQELIDLVQSYSKKDDVDGILVQLPLPSHINEEIILTQIDESKDVD 126

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN GK+ +        PCTP G I ++++  G +++G++AVV+GRSN+ G P+  L
Sbjct: 127 GFHPVNIGKLAMRGRKADFEPCTPKGCIEMLDR-SGIEIAGKNAVVLGRSNIVGLPVSML 185

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LLSR+ATVT+ HSKT NL E CR ADILVVA+G+ ++V+ DW+KTG++VIDVG+N   + 
Sbjct: 186 LLSRDATVTICHSKTPNLKEKCREADILVVAIGKAKLVKKDWVKTGAVVIDVGMNTDENN 245

Query: 241 QLGKTVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           +     L GDV  +E K V   ITPVPGGVGPMTIAMLM NT+ +A + L
Sbjct: 246 K-----LCGDVDYNEVKEVASYITPVPGGVGPMTIAMLMKNTLESAKKKL 290


>gi|325838527|ref|ZP_08166549.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Turicibacter sp. HGF1]
 gi|325490822|gb|EGC93124.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Turicibacter sp. HGF1]
          Length = 283

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 185/286 (64%), Gaps = 9/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK V+  L + +        +ETG+Q  L VV+VGN+PAS +YV  K R  +  
Sbjct: 1   MATIIDGKKVSEDLREDLKVQTEKFVEETGIQPHLVVVIVGNNPASMTYVRNKKRSCEAV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I++ DL   +  LN+DDS+HGILVQLPLP  ++E  II +I  +KDVD
Sbjct: 61  GFKSTVIELADTITEADLLAQIDVLNQDDSVHGILVQLPLPKHINEDHIISAIDVKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H    G +  G     L PCTPAG I L++ +   ++ G+HAV+IGRS++ GKP+ QL
Sbjct: 121 GFHPYQVGCLASG--LDSLKPCTPAGVIELLKAYD-IEIEGRHAVIIGRSHIVGKPLVQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS+T+NL  + + ADIL+VA+GRP  V  D +K G++V+DVGINR+ + 
Sbjct: 178 LLEENATVTVCHSRTQNLSMLTQMADILIVAIGRPHFVTADMVKEGAVVVDVGINRLET- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  LVGDV  D  +     ITPVPGGVGPMTI ML+ NT+ AA
Sbjct: 237 --GK--LVGDVDFDTVEPKASYITPVPGGVGPMTITMLLFNTLKAA 278


>gi|255641405|gb|ACU20979.1| unknown [Glycine max]
          Length = 342

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 189/288 (65%), Gaps = 7/288 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA  + D+I   V+ +++  GV  GLAV+LVG+   S +YV  K +  +  G +
Sbjct: 53  VIDGKSVAKQIRDEITAEVSRMRESIGVIPGLAVILVGDRKDSATYVRNKKKACESVGIN 112

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S++ N P D ++ ++ N +   N D S+HGILVQLPLPS ++EQ+I+ ++  EKDVDG H
Sbjct: 113 SLEANLPEDSTEEEVLNYIAGYNDDPSVHGILVQLPLPSHMNEQNILNAVRIEKDVDGFH 172

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G I L+ ++    + G+ AVVIGRSN+ G P   LL  
Sbjct: 173 PLNIGRLAMRGREPLFVPCTPKGCIELLHRYNA-SIKGKRAVVIGRSNIVGMPAALLLQR 231

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI---NSP 240
            +ATV++ HS+T N  EI R ADI++ AVG+  MV+  WIK G+++IDVGIN +   NSP
Sbjct: 232 EDATVSIVHSRTSNPEEIIRQADIIIAAVGQANMVRGSWIKPGAVIIDVGINPVEDPNSP 291

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +  K  LVGDV  +E   +  A+TPVPGGVGP TIAML+ NT+I+A R
Sbjct: 292 RGYK--LVGDVCYEEAIRIASAVTPVPGGVGPTTIAMLLQNTLISAKR 337


>gi|255648103|gb|ACU24506.1| unknown [Glycine max]
          Length = 345

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 190/288 (65%), Gaps = 7/288 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK VA  + D+I   V+ +++  GV  GLAV+LVG+   S +YV  K +  +  G +
Sbjct: 56  VIDGKSVAKQIRDEITAEVSRMRESIGVIPGLAVILVGDRKDSATYVRNKKKACESVGIN 115

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S++ N P + ++ ++ N +   N D S+HGILVQLPLPS ++EQ+I+ ++  EKDVDG H
Sbjct: 116 SLEANLPENSTEEEVLNYIAGYNDDPSVHGILVQLPLPSHMNEQNILNAVRIEKDVDGFH 175

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++ +       VPCTP G I L+ ++    + G+ AVVIGRSN+ G P   LL  
Sbjct: 176 PLNIGRLAMRGREPLFVPCTPKGCIELLHRYN-VSIKGKRAVVIGRSNIVGMPAALLLQR 234

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRI---NSP 240
            +ATV++ HS+T N  EI R ADI++ AVG+  MV+  WIK G+++IDVGIN +   NSP
Sbjct: 235 EDATVSIVHSRTSNPEEIIRQADIIIAAVGQANMVRGSWIKPGAVIIDVGINPVEDPNSP 294

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
           +  K  LVGDV  +E   +  A+TPVPGGVGPMTIAML+ NT+I+A R
Sbjct: 295 RGYK--LVGDVCYEEAIRIASAVTPVPGGVGPMTIAMLLQNTLISAKR 340


>gi|169828974|ref|YP_001699132.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/methenyl
           tetrahydrofolate cyclohydrolase FolD [Lysinibacillus
           sphaericus C3-41]
 gi|226704371|sp|B1HRX9|FOLD_LYSSC RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|168993462|gb|ACA41002.1| Bifunctional protein folD [Lysinibacillus sphaericus C3-41]
          Length = 284

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 134/288 (46%), Positives = 187/288 (64%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++I+GK +   + + +AE V  LK E G+  GLAVVLVG++ AS +YV  K +  +  G 
Sbjct: 4   AIINGKEIGQEIRNAVAERVIRLK-EQGLTPGLAVVLVGDNQASATYVRNKQKSCEAIGM 62

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           +S     P +  Q +L   +  LN+ + IHGILVQLPLP  + E ++I +I  EKDVDG 
Sbjct: 63  YSELIKLPEETKQEELLTQIQQLNQREDIHGILVQLPLPKHIDEDTVIATIAVEKDVDGF 122

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
             V+ GK+M+G  T   +PCTP G + L+E + G +++G+HAV++GRS++ GKPMGQLLL
Sbjct: 123 SPVSVGKMMLGQET--FLPCTPFGVMKLLE-YSGIEIAGKHAVIVGRSHIVGKPMGQLLL 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            ++ATVT  HSKT +LP   + ADIL+ AVGR   +  + +K G++VIDVGINR ++ + 
Sbjct: 180 QKDATVTYTHSKTPDLPSFTKQADILIAAVGRANFITKEHVKEGAVVIDVGINRDDNNK- 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
               L GDV   E   +   ITPVPGGVGPMTI ML+ NTV AA   L
Sbjct: 239 ----LCGDVNFAEVDGIASHITPVPGGVGPMTITMLLFNTVQAAENKL 282


>gi|255071739|ref|XP_002499544.1| predicted protein [Micromonas sp. RCC299]
 gi|226514806|gb|ACO60802.1| predicted protein [Micromonas sp. RCC299]
          Length = 335

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 136/291 (46%), Positives = 186/291 (63%), Gaps = 5/291 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDGK +A+ + +++   VA +K++ G   GLAVVLVG    S +YV+AK +     G  
Sbjct: 46  LIDGKAIAADVREEVRVGVAQMKEKIGKVPGLAVVLVGERKDSQTYVNAKKKACAEAGID 105

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S   + P D ++ ++   V   N D ++HGILVQLP+P  + E+ ++ +I  EKDVDG H
Sbjct: 106 SFGTDLPGDATEEEVLKVVADYNADPNVHGILVQLPMPDHIDEERVLGAISYEKDVDGFH 165

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G++         VPCTP G I L+E+  G +++G+ AVV+GRSN+ G P   LL  
Sbjct: 166 PLNTGRLAQRGREPLFVPCTPRGCIELLER-SGIEIAGKEAVVVGRSNVVGIPAAMLLQR 224

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP--Q 241
           R+ATVT+ HS+T N  EI R ADI++ A GR  MV+  W+K G+ VIDVGIN  + P  +
Sbjct: 225 RDATVTIVHSRTPNSEEIVRRADIVIAACGRMEMVKGSWLKPGAAVIDVGINAKDDPSKK 284

Query: 242 LGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
           LG   LVGD   E CK V GAITPVPGGVGPMTIA+L+ NT+  A R+ GM
Sbjct: 285 LGYR-LVGDADFESCKEVAGAITPVPGGVGPMTIAILLKNTMEGAMRAYGM 334


>gi|308270098|emb|CBX26710.1| Bifunctional protein folD [uncultured Desulfobacterium sp.]
          Length = 314

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 193/311 (62%), Gaps = 23/311 (7%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
            LI G  +   + ++I + VA +K + GV  GL  +LVG +PAS SYV+ K + A   GF
Sbjct: 4   KLILGTEIREQILEEITKEVAEIKGKHGVVPGLVTILVGANPASISYVTLKIQTAHRVGF 63

Query: 63  HSVQ------------YNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSII 110
             +              + PVDIS+ DL   + + NKDDS++GILVQLPLP  + E+ ++
Sbjct: 64  KEMMPGKPINESNPDLKSLPVDISEADLLATIDNYNKDDSVNGILVQLPLPKHIDEKKVL 123

Query: 111 QSIVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRS 170
            +I P+KDVDG H VN G++MIG       PCTPAG   +I +  G + SG   VV+GRS
Sbjct: 124 NAIDPDKDVDGFHPVNVGRLMIGGSEVKFAPCTPAGIQEMIVR-AGVETSGAEVVVVGRS 182

Query: 171 NLFGKPMGQLLLSR----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTG 226
           N+ GKP+  ++L +    N+TVT+ H++TK++   C+ ADIL+VA G P +V+ +WIK G
Sbjct: 183 NIVGKPIANMMLQKGPGANSTVTIVHTRTKDMASHCKRADILIVAAGVPDLVKPEWIKPG 242

Query: 227 SLVIDVGINRIN---SPQLGK--TVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMAN 280
           + VIDVG+NR+    S + GK   +L GDV  D  K + G ITPVPGGVGPMTI MLM N
Sbjct: 243 ACVIDVGVNRVGEKVSEKTGKKIAILKGDVNFDAAKEIAGYITPVPGGVGPMTITMLMKN 302

Query: 281 TVIAAYRSLGM 291
           T+ +    LG+
Sbjct: 303 TLKSLKFKLGI 313


>gi|300087916|ref|YP_003758438.1| methenyltetrahydrofolate cyclohydrolase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527649|gb|ADJ26117.1| Methenyltetrahydrofolate cyclohydrolase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 295

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 181/287 (63%), Gaps = 8/287 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G   A  + +++   VA LK   G+  GLA V+VG+DPAS +YV +K R  K  G H
Sbjct: 5   IISGTETARCIREELKAEVAALKDRHGIVPGLATVIVGDDPASQTYVGSKIRACKELGIH 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +    + ++++L   +  LN D +IHGILVQ+PLP  ++E  ++ +I P+KDVDG H
Sbjct: 65  SANFPMLAETTEVELLELIDRLNTDPAIHGILVQVPLPKHINEHRVLVAISPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            V+ G+++IG+   G +PCTP G   L+ +  G    G   V++GRSN+ GKP+  +L+ 
Sbjct: 125 PVSVGRMVIGE--PGFLPCTPHGIQELLTR-GGVSTEGAEVVIVGRSNIVGKPVANILMQ 181

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ HS T+++    R ADIL+ A+GRP+ +  D +K G+ VIDVG N I  
Sbjct: 182 KAPGANATVTVCHSATRDIAAHTRRADILIAAIGRPKFITADMVKPGAAVIDVGTNEIGR 241

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
              GK +L GDV  D  K V G ITPVPGGVGPMTI MLMANTV AA
Sbjct: 242 TAEGKRILTGDVDFDNVKEVAGVITPVPGGVGPMTIVMLMANTVKAA 288


>gi|223039420|ref|ZP_03609708.1| bifunctional protein FolD [Campylobacter rectus RM3267]
 gi|222879216|gb|EEF14309.1| bifunctional protein FolD [Campylobacter rectus RM3267]
          Length = 283

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 184/285 (64%), Gaps = 12/285 (4%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +++DGK V++ + +K+      LK + G++  LAV+LVG D AS +YV+AK +    C  
Sbjct: 2   TILDGKNVSARVKEKVKFEALNLKNQ-GIEPALAVILVGEDKASQTYVAAKEKACIACEI 60

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            SV +      +Q +L   +  LN DD I GILVQLPLP  +    I+++I P KDVDG 
Sbjct: 61  KSVMHRLSESTTQSELIALIDVLNLDDGIDGILVQLPLPKHIDTNKILETISPAKDVDGF 120

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCD--LSGQHAVVIGRSNLFGKPMGQL 180
             +N GK+  G    G VPCTP G   ++E FK  D  L G++AVVIGRSN+ GKPM  L
Sbjct: 121 AAINVGKLASG--LDGFVPCTPLG---IMEIFKAYDINLEGKNAVVIGRSNIVGKPMANL 175

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATVT+ HSKT+NL EIC  ADILV A+GR   V  D +K G++VIDVGINR++  
Sbjct: 176 LLNANATVTVTHSKTRNLKEICADADILVAAIGRADFVTADMVKEGAVVIDVGINRMDDG 235

Query: 241 QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           +L   V   +VA +C      ITPVPGGVGPMTIAML++NT+ +A
Sbjct: 236 KLKGDVKFDEVAPKC----SFITPVPGGVGPMTIAMLLSNTIKSA 276


>gi|330805092|ref|XP_003290521.1| methenyl tetrahydrofolate cyclohydrolase [Dictyostelium purpureum]
 gi|325079351|gb|EGC32955.1| methenyl tetrahydrofolate cyclohydrolase [Dictyostelium purpureum]
          Length = 293

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 135/290 (46%), Positives = 189/290 (65%), Gaps = 7/290 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
            G++IDGKV++S + + I   +  + ++      L V+LVG+   S +YV  K + A   
Sbjct: 8   FGNIIDGKVISSQVRESIKNEIKEMTEKGLRAPCLVVILVGDRKDSQTYVRNKKKTALEL 67

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G +S+    P DIS+ +L   V S + D  I GILVQLPLP  ++E++I+  I   KDVD
Sbjct: 68  GINSIDKTLPEDISEQELIEIVKSYSADPEIDGILVQLPLPKHINEETILNQICETKDVD 127

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN GK+ +        PCTP G I L+++  G  + G++AVV+GRSN+ G P+  L
Sbjct: 128 GFHPVNIGKLGMRGRVADFQPCTPKGCIELLDR-SGIKIEGKNAVVLGRSNIVGLPVSLL 186

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+RNATVT+ HSKT++L E CR ADILVVA+G+ ++V+ DWIK G++VIDVG   +N+ 
Sbjct: 187 LLNRNATVTICHSKTQDLKEKCREADILVVAIGQAKLVKKDWIKQGAVVIDVG---MNTD 243

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           + GK  L GDV  ++CK     ITPVPGGVGPMTIAMLM NT+ +A + L
Sbjct: 244 ENGK--LCGDVDFNDCKETASYITPVPGGVGPMTIAMLMKNTLESAKKKL 291


>gi|298490660|ref|YP_003720837.1| methenyltetrahydrofolate cyclohydrolase ['Nostoc azollae' 0708]
 gi|298232578|gb|ADI63714.1| Methenyltetrahydrofolate cyclohydrolase ['Nostoc azollae' 0708]
          Length = 294

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 188/280 (67%), Gaps = 5/280 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK +A+ +  ++A ++   + + G   GLAV++VG++PAS +Y+S K R     G  
Sbjct: 10  ILDGKALAAKIQKELAATITESQLKIGRPPGLAVLMVGDNPASAAYISNKERACAKVGIA 69

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S   +FP   SQ +LE+ +  LN+D+ ++GILVQLPLP  +   S++  I P+KD DGLH
Sbjct: 70  SFGKHFPTQTSQTELEDVIAELNQDEQVNGILVQLPLPKHLDAISLLHRIAPDKDADGLH 129

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN G+++ G+   GL  CTPAG I L+E++K   L G+ AVV+GRS L GKPM  +LL 
Sbjct: 130 PVNLGRLVRGE--AGLRSCTPAGVIRLLEEYK-IPLLGKQAVVVGRSILVGKPMALMLLE 186

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            +ATVT+AHS+T++L  I + ADIL+ A G P ++    +K G++V+DVGINRI     G
Sbjct: 187 VDATVTIAHSRTQDLKTITQNADILIAAAGIPGLITAQMVKLGAVVVDVGINRITDSS-G 245

Query: 244 KTVLVGDVADECKSVVGA-ITPVPGGVGPMTIAMLMANTV 282
           K+ LVGD+     ++V   ITPVPGG+GPMT+AML+ NTV
Sbjct: 246 KSRLVGDIDFSTTAMVAEYITPVPGGIGPMTVAMLLQNTV 285


>gi|163857334|ref|YP_001631632.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Bordetella petrii DSM 12804]
 gi|190359422|sp|A9ISZ5|FOLD_BORPD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|163261062|emb|CAP43364.1| Methylenetetrahydrofolate dehydrogenase and
           Methylenetetrahydrofolate cyclohydrolase [Bordetella
           petrii]
          Length = 294

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 186/288 (64%), Gaps = 10/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDG  +A  + + +A  V  L  + GV+ GLAVVLVG+DPAS  YV  K    +  G +
Sbjct: 16  IIDGAALAQRIREDVARRVQALAAK-GVRPGLAVVLVGDDPASQVYVRNKVAACEKAGLY 74

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S++  +P D+++ +L   + +LN+D +IHGILVQLPLP  +S   +I++I  EKDVDG H
Sbjct: 75  SIKEQYPADMTEAELLARIDTLNRDPAIHGILVQLPLPPHMSSHKVIEAIAAEKDVDGFH 134

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + NAG +M G       PCTP G + ++E  +G  L G  AV++G SN+ GKPM  LLL 
Sbjct: 135 ISNAGLLMTGQPL--FRPCTPYGVMKMLEA-EGVPLRGAEAVIVGASNIVGKPMAMLLLQ 191

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             AT+T+ +SKT++L    R AD+LVVA G+P M+    IK G++VIDVGINR      G
Sbjct: 192 AGATITICNSKTRDLAAQTRRADVLVVATGKPGMIDGSMIKPGAVVIDVGINRGAD---G 248

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV     + V GAITPVPGGVGPMTIAML+ NTV AA R+ G
Sbjct: 249 K--LCGDVDFASAREVAGAITPVPGGVGPMTIAMLLVNTVEAAERTAG 294


>gi|284045041|ref|YP_003395381.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Conexibacter
           woesei DSM 14684]
 gi|283949262|gb|ADB52006.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Conexibacter
           woesei DSM 14684]
          Length = 283

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 185/289 (64%), Gaps = 10/289 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           +LIDG+ +A  + D++A  VA    ETGV  GLA +LVG+DPAS  YV+ K R     G 
Sbjct: 4   TLIDGRAIAQQVRDQVAADVAAFTAETGVTPGLATLLVGDDPASAVYVANKRRACVAAGI 63

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
             +  + P D++Q  +   +  LN D  + GIL+QLP+P+ +    +   I P+KDVDGL
Sbjct: 64  ADLHRHLPADVAQEQVVAHLQELNADPQVSGILLQLPVPAQLDATLLTGLIAPDKDVDGL 123

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
             ++AG++M G    GL PCTP+G I L+++     L G  AVV+GRS+L GKP+  LLL
Sbjct: 124 TPISAGRLMQG--APGLRPCTPSGVIELLDRHD-VPLEGAEAVVVGRSDLVGKPLIHLLL 180

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            RNATVT+ HS+T++L  +C  AD+LV AVG P+++  D +K G+ VIDVGINR +    
Sbjct: 181 QRNATVTVCHSRTRDLAAVCARADVLVAAVGVPKLIGADAVKPGAAVIDVGINRTDDG-- 238

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
               LVGDV  D  + V G +TPVPGGVGPMTIA+L++NT+ AA    G
Sbjct: 239 ----LVGDVDFDAVREVAGLLTPVPGGVGPMTIALLLSNTLAAARLQRG 283


>gi|288553330|ref|YP_003425265.1| methylenetetrahydrofolate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288544490|gb|ADC48373.1| methylenetetrahydrofolate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 281

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 192/287 (66%), Gaps = 15/287 (5%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
            +L++GK +A+   + + + V+ L  E G++ GLAV+LVG++ AS +YV +K +  +  G
Sbjct: 3   AALLNGKELAAKKRETMKKEVSKLI-EAGIKPGLAVILVGDNQASKTYVRSKQKACEQIG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            HSV    P D  +  L   +  LN+D  I GILVQLPLPS +SE+++I+ I PEKDVDG
Sbjct: 62  IHSVLTTMPEDTPEEVLLAEIDRLNEDPDIDGILVQLPLPSQISERAVIERIAPEKDVDG 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCD--LSGQHAVVIGRSNLFGKPMGQ 179
            H VN G++M  D T   +PCTP G   ++E  K  D  ++G+H VV+GRSN+ GKP+GQ
Sbjct: 122 FHPVNIGRMMTKDKT--FLPCTPFG---IVEMLKEADIQMAGKHVVVVGRSNIVGKPVGQ 176

Query: 180 LLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           LLL+ +ATVT  HS+T ++    + ADIL+VAVGR +M++   +K G++V+DVG+NR   
Sbjct: 177 LLLNEDATVTYCHSRTDDIANFTKQADILIVAVGRAKMIKASDVKEGAVVVDVGMNR--- 233

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
            + GK  L GDV  DE + V   ITPVPGGVGPMTI ML+ NT+ +A
Sbjct: 234 -EDGK--LCGDVDFDEVREVASHITPVPGGVGPMTITMLLENTIQSA 277


>gi|118475042|ref|YP_892332.1| FolD bifunctional protein [Campylobacter fetus subsp. fetus 82-40]
 gi|261886151|ref|ZP_06010190.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Campylobacter fetus subsp. venerealis str. Azul-94]
 gi|158705721|sp|A0RQ49|FOLD_CAMFF RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|118414268|gb|ABK82688.1| FolD bifunctional protein [Campylobacter fetus subsp. fetus 82-40]
          Length = 283

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 137/282 (48%), Positives = 185/282 (65%), Gaps = 8/282 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDGK V++ + + +      LKK +G+   LAV+LVG D AS +YV++K +    C   
Sbjct: 3   IIDGKSVSAKVKEYVKNEAISLKK-SGITPTLAVILVGEDKASQTYVASKEKACLACEMG 61

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV +    + SQ +L   +  LN DDSI GILVQLPLP  +    ++++I P KDVDG H
Sbjct: 62  SVMHRLSKETSQSELLALIEVLNLDDSIDGILVQLPLPKHIDTNRVLEAIDPTKDVDGFH 121

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN GK+  G    G VPCTP G + L++++   +L G  AVVIGRSN+ GKPM  LLL+
Sbjct: 122 AVNVGKLSSG--LDGFVPCTPLGIMELLKEYD-VNLQGIDAVVIGRSNIVGKPMASLLLN 178

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             AT+++AHSKTKNLPEI R A ++VVAVGRP  +  D +  G++VIDVGINR++S +L 
Sbjct: 179 AGATISIAHSKTKNLPEITRRAKLVVVAVGRPNFLNADMVSDGAIVIDVGINRLDSGKLV 238

Query: 244 KTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             V    VA +C      ITPVPGGVGPMTIAML++NT+ +A
Sbjct: 239 GDVDFDSVAPKC----SLITPVPGGVGPMTIAMLLSNTLKSA 276


>gi|118578919|ref|YP_900169.1| methenyltetrahydrofolate cyclohydrolase [Pelobacter propionicus DSM
           2379]
 gi|158705755|sp|A1AL91|FOLD_PELPD RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|118501629|gb|ABK98111.1| methenyltetrahydrofolate cyclohydrolase /
           5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
           [Pelobacter propionicus DSM 2379]
          Length = 283

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 135/290 (46%), Positives = 189/290 (65%), Gaps = 10/290 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  +IDGK +A+ +  +IA  V  L+ + GV  GLAVVLVG+D AS  YVS K +     
Sbjct: 1   MAHIIDGKAIAAKIRSEIASGVRELQGK-GVTPGLAVVLVGDDQASRVYVSMKEKACNDA 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  SV++    + S+ +L   V  LN D  IHGILVQLPLPS +    ++++I P KDVD
Sbjct: 60  GIFSVEHKLAAETSEAELLALVELLNNDPKIHGILVQLPLPSQIDTDKVLEAISPFKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N G++ +G       PCTP G ++++ +  G +L G+  VV+GRSN+ GKP+  +
Sbjct: 120 GFHPYNVGRLSVGKPV--FQPCTPYGVMVMLRE-AGVELKGKEVVVVGRSNIVGKPVAMM 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
            L+ +ATVT+ HS+T++LP++ R AD+++ AVGRP M++ DWIK G++VIDVGINR+   
Sbjct: 177 CLAEHATVTLCHSRTRDLPDVVRRADVVIAAVGRPEMIKGDWIKEGAVVIDVGINRV--- 233

Query: 241 QLGKTVLVGDVADECKS-VVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
             G+  LVGDV     S    AITPVPGGVGPMTI ML+ NT+ +A R +
Sbjct: 234 --GEKKLVGDVEFAGASQRASAITPVPGGVGPMTITMLLQNTLESAKRGM 281


>gi|293376905|ref|ZP_06623122.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Turicibacter sanguinis PC909]
 gi|292644451|gb|EFF62544.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Turicibacter sanguinis PC909]
          Length = 283

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 185/286 (64%), Gaps = 9/286 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M ++IDGK V+  L + +        +ETG+Q  L VV+VGN+PAS +YV  K R  +  
Sbjct: 1   MATIIDGKKVSEDLREDLKVQTEKFVEETGIQPHLVVVIVGNNPASMTYVRNKKRSCEAV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           GF S        I++ DL   +  LN+DDS+HGILVQLPLP  ++E  II +I  +KDVD
Sbjct: 61  GFKSTVIELADTITEADLLAQIDVLNQDDSVHGILVQLPLPKHINEDHIISAIDVKKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H    G +  G     L PCTPAG I L++ +   ++ G+HAV+IGRS++ GKP+ QL
Sbjct: 121 GFHPYQVGCLASG--LDSLKPCTPAGVIGLLKAYD-IEIEGRHAVIIGRSHIVGKPLVQL 177

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL  NATVT+ HS+T+NL  + + ADIL+VA+GRP  V  D +K G++V+DVGINR+ + 
Sbjct: 178 LLEENATVTVCHSRTQNLSMLTQMADILIVAIGRPHFVTADMVKEGAVVVDVGINRLET- 236

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
             GK  LVGDV  D  +     ITPVPGGVGPMTI ML+ NT+ AA
Sbjct: 237 --GK--LVGDVDFDTVEPKASYITPVPGGVGPMTITMLLFNTLKAA 278


>gi|239815150|ref|YP_002944060.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Variovorax
           paradoxus S110]
 gi|259647309|sp|C5CXD8|FOLD_VARPS RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|239801727|gb|ACS18794.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Variovorax
           paradoxus S110]
          Length = 283

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 183/286 (63%), Gaps = 10/286 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           LIDG  +A  +  ++A   A LK + GV+  L+++LVG+DPAS  Y   K   +   G  
Sbjct: 5   LIDGNALAKTIRAEVAGRTAALKAK-GVEPALSIILVGSDPASQVYTKHKVNDSTETGLA 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           +    +P D+S+  L + + +LN D  +HGILVQLPLP  +  Q +I++I P KDVDG H
Sbjct: 64  ATLETYPADMSEAALLDRIRALNDDPKVHGILVQLPLPRHMDSQKVIETISPAKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           V +AG +M G    G  PCTP G + ++E   G DL G+HAVVIGRSN+ GKPM  +LL+
Sbjct: 124 VASAGALMTG--APGFWPCTPYGCMKMLESI-GYDLRGKHAVVIGRSNIVGKPMAMMLLA 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
           R+ATVT+ HS T++L    R AD++V AVG+  ++    +K G++VIDVG+NR      G
Sbjct: 181 RSATVTICHSATQDLAAFTRQADVIVAAVGKRNILTAGMVKPGAVVIDVGMNRKED---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           K  L GDV  D  K V G ITPVPGGVGPMT AML+ NT+ AA R+
Sbjct: 238 K--LAGDVDFDGVKEVAGWITPVPGGVGPMTRAMLLVNTLEAAERA 281


>gi|325294633|ref|YP_004281147.1| Bifunctional protein folD [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325065081|gb|ADY73088.1| Bifunctional protein folD [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 285

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 136/291 (46%), Positives = 190/291 (65%), Gaps = 8/291 (2%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M  ++DGK ++  + +++ E V  LK++ G +  LAVVLVGNDPAS  YV  K +  ++ 
Sbjct: 1   MAVILDGKALSKKIRNQLKEEVEELKEKAGREPALAVVLVGNDPASEIYVRNKIKACENV 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+    P +I+Q +L N V  LN+D ++ GI+VQLPLP  +S + +I  I PEKDVD
Sbjct: 61  GIRSIDRKLPANITQEELNNVVRELNEDKTVDGIIVQLPLPEHLSCREVINYISPEKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H VN GK +IG +  GL+PCTPAG +   E++    L G++AV++G SN+ GKP+  +
Sbjct: 121 GFHPVNVGKAVIGLYDEGLMPCTPAGVMKFFEEYN-ILLEGKNAVMVGHSNIVGKPLANM 179

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+ NATV++ H  T +L    R ADIL VA G P +++ D +K G++VID+GI+R+N  
Sbjct: 180 LLNANATVSVCHVYTNDLAYYTRNADILCVATGVPHLIKEDMVKEGAVVIDIGISRVN-- 237

Query: 241 QLGKTVLVGDVADE-CKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
             GK  +VGDV  E  K    AITPVPGGVGPMTI ML+ NTV A    +G
Sbjct: 238 --GK--IVGDVDFERVKEKAAAITPVPGGVGPMTITMLLYNTVKAFKMRMG 284


>gi|238924317|ref|YP_002937833.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Eubacterium
           rectale ATCC 33656]
 gi|259647295|sp|C4ZBG7|FOLD_EUBR3 RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|238875992|gb|ACR75699.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Eubacterium
           rectale ATCC 33656]
          Length = 279

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 188/288 (65%), Gaps = 10/288 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +LIDGK++++ + D++ E V  LKK+ G++  LAV+ VGNDPAS  YV  K +  ++ 
Sbjct: 1   MANLIDGKLISTQIKDELKEEVTELKKK-GIEGCLAVIQVGNDPASSVYVRNKKKACEYV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y    + ++ ++   +  LN D S++GIL QLPLP  + E  +I +I P+KDVD
Sbjct: 60  GIKSLSYELAEETTEDEILKLIEKLNADSSVNGILCQLPLPKHIDEDKVIDAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G    + G ++IG    G +PCTPAG I L+++    D+ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFSPQSVGAMVIG--KPGFLPCTPAGIIQLLKR-SNIDIDGKSCVVVGRSNIVGKPMSLL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           +L  NATVT+ HS TK+L ++C+ ADIL+VA+G+P+ +   ++K G++VIDVGI+R    
Sbjct: 177 MLRENATVTVCHSHTKDLKDVCKNADILIVAIGKPKFIDASYVKDGAVVIDVGIHR---- 232

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
              +  L GDV  D   S    ITPVPGGVGPMTIAMLM+N V A  R
Sbjct: 233 -NAENKLCGDVDFDSVVSKASHITPVPGGVGPMTIAMLMSNCVEAMKR 279


>gi|124267318|ref|YP_001021322.1| bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/
           5,10-methylene-tetrahydrofolate cyclohydrolase
           [Methylibium petroleiphilum PM1]
 gi|158705742|sp|A2SHP8|FOLD_METPP RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|124260093|gb|ABM95087.1| Methenyltetrahydrofolate cyclohydrolase [Methylibium petroleiphilum
           PM1]
          Length = 283

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 136/286 (47%), Positives = 183/286 (63%), Gaps = 8/286 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDG  ++  L  ++A+  A L+ E G+  GLAV+LVG +PAS  YV  K +     G HS
Sbjct: 6   IDGNALSRHLRHEVAQRAATLR-EHGITPGLAVILVGENPASQVYVRNKVKACHDSGLHS 64

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
           V  ++P  +++ +L   V +LN D +IHGILVQLPLP  +    +I++I P KDVDG HV
Sbjct: 65  VLEHYPAAMTEAELLARVQALNADPAIHGILVQLPLPPHIDAHRVIETIAPHKDVDGFHV 124

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            +AG +M+G    G  PCTP G + ++E   G D  G+HAVVIGRSN+ GKPM  LLL  
Sbjct: 125 ASAGALMVGQ--PGFKPCTPYGCMKMLESI-GYDPKGKHAVVIGRSNIVGKPMAMLLLQA 181

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           NATVT+ HS T +L    R ADI+V AVG+ +++  D +K G++VIDVG+NR +  +L  
Sbjct: 182 NATVTVCHSATPDLALHTRQADIVVAAVGKRKVLTADMVKPGAVVIDVGMNRDDHGKLCG 241

Query: 245 TVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
            V    VA     V G ITPVPGGVGPMTI ML+ NT+ +A R +G
Sbjct: 242 DVDYAGVA----KVAGWITPVPGGVGPMTITMLLMNTLESAERLVG 283


>gi|229589814|ref|YP_002871933.1| putative histidine biosynthesis-like tetrahydrofolate dehydrogenase
           [Pseudomonas fluorescens SBW25]
 gi|229361680|emb|CAY48561.1| putative histidine biosynthesis-related tetrahydrofolate
           dehydrogenase [Pseudomonas fluorescens SBW25]
          Length = 314

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 138/282 (48%), Positives = 188/282 (66%), Gaps = 7/282 (2%)

Query: 5   IDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFHS 64
           IDGK +++ + D++ E V  L  +  +   LAV+LVG+DPAS  YV  K   AK  G  S
Sbjct: 15  IDGKAISARVLDEVREEVLLLASQQ-IYPALAVLLVGDDPASHVYVRNKLLRAKDVGIRS 73

Query: 65  VQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLHV 124
           ++Y  P D SQ  + + +  LN D S++GILVQLPLP+ + E ++I +I P KDVDG H 
Sbjct: 74  LEYRLPEDASQTQVLDLLAQLNADTSVNGILVQLPLPAQIDEAAVIHAIDPIKDVDGFHR 133

Query: 125 VNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSR 184
            N G ++ G     L PCTP+G + L+ +  G DLSG HAVVIGRSN+ GKPM  LLL  
Sbjct: 134 ENVGGLVQG--IEVLTPCTPSGCMRLLHETCG-DLSGLHAVVIGRSNIVGKPMATLLLQA 190

Query: 185 NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLGK 244
           N +V++ HS++ + P +CR ADI+V AVGRP+++   W+K G++VIDVGINRI +     
Sbjct: 191 NCSVSVVHSRSVDAPALCRLADIVVAAVGRPQLIDARWLKPGAVVIDVGINRITTET--G 248

Query: 245 TVLVGDV-ADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           T LVGDV     ++V  AITPVPGGVGPMTIA L+ NT++A+
Sbjct: 249 TRLVGDVDYASARTVASAITPVPGGVGPMTIAYLLKNTLVAS 290


>gi|300867229|ref|ZP_07111891.1| Bifunctional protein folD (Includes: Methylenetetrahydrofolate
           dehydrogenase ; Methenyltetrahydrofolate cyclohydrolase)
           [Oscillatoria sp. PCC 6506]
 gi|300334774|emb|CBN57057.1| Bifunctional protein folD (Includes: Methylenetetrahydrofolate
           dehydrogenase ; Methenyltetrahydrofolate cyclohydrolase)
           [Oscillatoria sp. PCC 6506]
          Length = 291

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 189/288 (65%), Gaps = 5/288 (1%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK +A  +  ++   V  L+ + G   GLAV++VG +PAS +YV  K       G  
Sbjct: 8   ILDGKALAQKIQSELISRVHSLQSQKGRPPGLAVLMVGENPASATYVRNKELACAKVGIA 67

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S   +FP D +Q +LE A+ +LN+D+ + GILVQLPLP  +   S++  I P+KD DGLH
Sbjct: 68  SFGQHFPADTTQTELEQAIQTLNQDERVDGILVQLPLPGHLDAISLLYQIAPDKDADGLH 127

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N G+++ G+   GL  CTPAG + L++++   DL G+ AVV+GRS L GKPM  +LL 
Sbjct: 128 AMNLGRLVRGE--AGLRSCTPAGVMRLLQEYD-IDLKGKRAVVLGRSILVGKPMALMLLE 184

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
            + TVT+AHS+++NL  I R ADIL+ AVGRP +V  + +K G++V+DVG+NR+   + G
Sbjct: 185 ADCTVTVAHSRSQNLESITREADILIAAVGRPEIVTANMVKPGAVVVDVGMNRV-VKEDG 243

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
            + L GDV  +  ++V   ITPVPGGVGPMT+AML+ NTV +   + G
Sbjct: 244 SSRLTGDVDFNSVQAVAEFITPVPGGVGPMTVAMLLQNTVWSWENNHG 291


>gi|67921352|ref|ZP_00514871.1| Methenyltetrahydrofolate cyclohydrolase [Crocosphaera watsonii WH
           8501]
 gi|67857469|gb|EAM52709.1| Methenyltetrahydrofolate cyclohydrolase [Crocosphaera watsonii WH
           8501]
          Length = 293

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 190/288 (65%), Gaps = 6/288 (2%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           SL++GK +A  +  ++  +V  L+ + G   GLAV++VG++PAS  YV  K +     G 
Sbjct: 10  SLLNGKALAQKIQGELKITVEKLQGKIGRPPGLAVIMVGDNPASAVYVRNKEKACAKVGI 69

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
            S   + P +  Q ++E  +  LN D+ + GILVQLPLP  +    ++ +I PEKD DGL
Sbjct: 70  ASFGRHLPTETPQEEVEALINQLNADERVDGILVQLPLPPHLDTVKLLHAIAPEKDADGL 129

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H +N G ++ G+   GL  CTPAG + L+E++   D++G+HAVV+GRS L GKP+  +LL
Sbjct: 130 HPMNLGHLIRGE--NGLRSCTPAGVMALLEEYN-LDVAGKHAVVVGRSILVGKPLALMLL 186

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            +NATVTMAHS+T +L E+ R  DI++ AVG+P ++  D +K G++ IDVGINRI + + 
Sbjct: 187 EKNATVTMAHSRTPDLGEMTRQGDIIIAAVGKPNLITGDMVKPGAVAIDVGINRIMT-ED 245

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSL 289
           GK+ LVGD   D    V   ITPVPGGVGPMT+AML+ NTV+ +Y+ L
Sbjct: 246 GKSKLVGDFEFDSVAQVSSYITPVPGGVGPMTVAMLLQNTVL-SYQKL 292


>gi|317132601|ref|YP_004091915.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Ethanoligenens
           harbinense YUAN-3]
 gi|315470580|gb|ADU27184.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Ethanoligenens
           harbinense YUAN-3]
          Length = 285

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 135/284 (47%), Positives = 182/284 (64%), Gaps = 8/284 (2%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
             L+DGK VA+ +  ++AE V  L+ E+G+   LAVVLVG++PAS  YV  K +     G
Sbjct: 3   AKLLDGKAVAASVRARVAEDVRRLR-ESGITPALAVVLVGDNPASQVYVRNKEKDCAEVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
             SV    P + +Q +L   V  LN+D  +HGILVQLPLP  + E+++I++I P KDVD 
Sbjct: 62  IRSVGRRLPAETTQAELLALVDELNRDPQVHGILVQLPLPPQIDERAVIEAIDPAKDVDA 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H  N G++M+G++    +PCTPAG + L+    G   +G+  VVIGRSN+ GKPM  LL
Sbjct: 122 FHPSNVGRIMLGEYE--FLPCTPAGVMELLAD-AGISPAGKTCVVIGRSNIVGKPMAMLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L  + TVT+AHSKT NL E+   ADILV AVGR   V  D +K G++VIDVG+NR+ + +
Sbjct: 179 LHADGTVTVAHSKTPNLAEVTARADILVCAVGRAHFVTADMVKPGAVVIDVGMNRLENGK 238

Query: 242 LGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           L   V    VA++       ITPVPGGVGPMT AML+ NT+ AA
Sbjct: 239 LAGDVDFEAVAEKASY----ITPVPGGVGPMTRAMLLQNTLRAA 278


>gi|297568807|ref|YP_003690151.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924722|gb|ADH85532.1| Methylenetetrahydrofolate dehydrogenase (NADP(+)) [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 295

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 134/293 (45%), Positives = 182/293 (62%), Gaps = 8/293 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +I G  VA  +  ++   V  LK +  V  GL  +LVG DPAS SYV+AK + AK  G H
Sbjct: 5   IISGTEVAKEIRAELKTEVETLKAKHNVVPGLVTILVGEDPASQSYVAAKNKTAKELGIH 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S Q   P D  + +L N V   N+D  I+GILVQLPLP  + E  ++ +I P+KDVDG H
Sbjct: 65  SEQITLPADTPEDELLNLVAKCNQDPKINGILVQLPLPKHIDEAKVLYAIDPDKDVDGFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN GK+++G+     +PCTP G + L+ +  G + SG   V++GRSN+ GKP+  L+L 
Sbjct: 125 PVNVGKMVLGEQC--FLPCTPHGILELLTR-SGVETSGAEVVIVGRSNIVGKPIANLMLQ 181

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NATVT+ H++TK++    + ADI++ AVG P+M+  D +K G  VIDVG+NRI  
Sbjct: 182 KRDGGNATVTLCHTRTKDIAAHTKRADIIIAAVGVPKMITADMVKDGVAVIDVGVNRIGM 241

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGM 291
              GK +L GDV     K     ITPVPGGVGPMTI MLM NTV AA ++ G+
Sbjct: 242 SDSGKAILAGDVDFAGIKEKAACITPVPGGVGPMTITMLMKNTVQAAKQAAGL 294


>gi|293604961|ref|ZP_06687358.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Achromobacter piechaudii ATCC 43553]
 gi|292816789|gb|EFF75873.1| bifunctional methylenetetrahydrofolate
           dehydrogenase/methylenetetrahydrofolate cyclohydrolase
           [Achromobacter piechaudii ATCC 43553]
          Length = 283

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 185/288 (64%), Gaps = 10/288 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           +IDG  ++  + +++A+ VA L  + G + GLAVVLVG DPAS  YV  K    +  G H
Sbjct: 5   IIDGAALSLRIREEVAQRVAALAAK-GTRPGLAVVLVGADPASHVYVRNKVAACEKAGLH 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SV+  +P ++++ +L   +  LN+D +IHGILVQLPLP  +    +I++I  EKDVDG H
Sbjct: 64  SVKEQYPAEMTEAELLARIAVLNQDPTIHGILVQLPLPKHMDSHKVIEAIAAEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
           + NAG +M G       PCTP G + ++E  +G  L G  AV++G SN+ GKPM  LLL 
Sbjct: 124 ISNAGLLMTGQPL--FRPCTPYGVMKMLES-EGVTLRGAEAVIVGASNIVGKPMAMLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             AT+T+ +SKT++L    R AD+LVVA G+P M+    IK G++VIDVGINR      G
Sbjct: 181 AGATITICNSKTRDLAAQTRRADVLVVATGKPGMIDGSMIKPGAVVIDVGINRGED---G 237

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLG 290
           K  L GDV     K V GAITPVPGGVGPMTIAML+ NTV AA R+ G
Sbjct: 238 K--LCGDVDFASAKEVAGAITPVPGGVGPMTIAMLLVNTVEAAERAAG 283


>gi|205374080|ref|ZP_03226880.1| methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate
           cyclohydrolase [Bacillus coahuilensis m4-4]
          Length = 250

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 170/241 (70%), Gaps = 4/241 (1%)

Query: 2   GSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCG 61
           G +IDGK +A VL D I E V FLK + G+  GLAVVLVG++ AS +YV  K +  ++ G
Sbjct: 3   GRIIDGKQIAQVLRDSIQEEVMFLK-DKGITPGLAVVLVGDNQASETYVRMKQKACENVG 61

Query: 62  FHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDG 121
            HS+  ++P  +S+ +L   +  LN+D SIHGILVQLPLP  +SE  +I++IVPEKDVDG
Sbjct: 62  MHSILIHYPATVSETELLAKLHELNQDTSIHGILVQLPLPDNISEIKVIETIVPEKDVDG 121

Query: 122 LHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLL 181
            H +N G++M G      +PCTP G I ++E  +  DL G+H VVIGRSN+ GKP+GQLL
Sbjct: 122 FHPINIGRMMTG--QDAFLPCTPYGIIKMLEH-ENIDLEGKHVVVIGRSNIVGKPVGQLL 178

Query: 182 LSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQ 241
           L++NATVT  HS+TK+L  + R+ADILV AVG+ + +  ++IK G++VIDVG+NR    +
Sbjct: 179 LNKNATVTYCHSRTKDLASVTRSADILVAAVGKAKFITEEYIKPGAVVIDVGMNRDEQDK 238

Query: 242 L 242
           L
Sbjct: 239 L 239


>gi|116750112|ref|YP_846799.1| methylenetetrahydrofolate dehydrogenase (NADP(+)) [Syntrophobacter
           fumaroxidans MPOB]
 gi|158705780|sp|A0LLR2|FOLD_SYNFM RecName: Full=Bifunctional protein FolD; Includes: RecName:
           Full=Methylenetetrahydrofolate dehydrogenase; Includes:
           RecName: Full=Methenyltetrahydrofolate cyclohydrolase
 gi|116699176|gb|ABK18364.1| Methenyltetrahydrofolate cyclohydrolase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 295

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 180/286 (62%), Gaps = 8/286 (2%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           L+ G  VA  +  ++   V  L+ + GV  GL  +LVG +PAS SYV AK   A   GFH
Sbjct: 5   LLKGAEVAKEIRAELKTEVEQLQSKHGVVPGLVTILVGENPASQSYVRAKQNTAHELGFH 64

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           SVQ N P D+ +  L + +   NKD SIHGILVQLPLP  ++E  I+ SI P KDVD  H
Sbjct: 65  SVQDNQPADLEENRLLDLIDKYNKDPSIHGILVQLPLPKHINENRILLSIDPSKDVDAFH 124

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            VN GK+MIG+     +PCTPAG   L+ +  G  +SG    ++GRSN+ GKP+  +L+ 
Sbjct: 125 PVNVGKLMIGE--PDYLPCTPAGIQELLVR-SGTQVSGAEVTIVGRSNIVGKPIAMMLVQ 181

Query: 184 R----NATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
           +    NAT+T+ H++TK++    R ADIL+VA G    V+ + IK G++VIDVG+N +  
Sbjct: 182 KANGANATITVCHTRTKDVASHTRRADILIVAAGVAEYVKGNMIKPGAVVIDVGVNEVGK 241

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
              GK +L GDVA DE   V  AITPVPGGVGPMTI MLM NTV A
Sbjct: 242 TADGKRILKGDVAFDEAVEVASAITPVPGGVGPMTITMLMKNTVRA 287


>gi|291525099|emb|CBK90686.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Eubacterium rectale DSM
           17629]
 gi|291529412|emb|CBK94998.1| 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
           tetrahydrofolate cyclohydrolase [Eubacterium rectale
           M104/1]
          Length = 279

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 188/288 (65%), Gaps = 10/288 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           M +LIDGK++++ + D++ E V  LKK+ G++  LAV+ VGNDPAS  YV  K +  ++ 
Sbjct: 1   MANLIDGKLISTQIKDELKEEVTELKKK-GIEGCLAVIQVGNDPASSVYVRNKKKACEYV 59

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  S+ Y    + ++ ++   +  LN D S++GIL QLPLP  + E  +I +I P+KDVD
Sbjct: 60  GIKSLSYELAEETTEDEILKLIEKLNADASVNGILCQLPLPKHIDEDKVIDAIDPKKDVD 119

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G    + G ++IG    G +PCTPAG I L+++    D+ G+  VV+GRSN+ GKPM  L
Sbjct: 120 GFSPQSVGAMVIG--KPGFLPCTPAGIIQLLKR-SNIDIDGKSCVVVGRSNIVGKPMSLL 176

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           +L  NATVT+ HS TK+L ++C+ ADIL+VA+G+P+ +   ++K G++VIDVGI+R    
Sbjct: 177 MLRENATVTVCHSHTKDLKDVCKNADILIVAIGKPKFIDASYVKDGAVVIDVGIHR---- 232

Query: 241 QLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYR 287
              +  L GDV  D   S    ITPVPGGVGPMTIAMLM+N V A  R
Sbjct: 233 -NAENKLCGDVDFDSVVSKASHITPVPGGVGPMTIAMLMSNCVEAMKR 279


>gi|313899137|ref|ZP_07832662.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Clostridium sp. HGF2]
 gi|312956077|gb|EFR37720.1| tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding
           domain protein [Clostridium sp. HGF2]
          Length = 282

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 183/289 (63%), Gaps = 10/289 (3%)

Query: 1   MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC 60
           MG+++ G  +A  +   + E +  L+++      L V+LVG++PAS SYV+ K +  +  
Sbjct: 1   MGTILYGSEIAKDIRTSLKEQIDELREKGKRIPKLVVILVGDNPASLSYVTGKEKACREI 60

Query: 61  GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD 120
           G  ++      D ++  L   +  LN D S+ GILVQLPLP  + E  ++ +I P KDVD
Sbjct: 61  GMENILLRLQEDTTEEALLAEIHRLNTDTSVDGILVQLPLPKHMDEHKVLFAIDPLKDVD 120

Query: 121 GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL 180
           G H  N GK+M+ + T   +PCTP G + +++     DLSG  AVVIGRSN+ GKP+ QL
Sbjct: 121 GFHPYNIGKLMLQEDT--YLPCTPKGILRMLDTAGYSDLSGLRAVVIGRSNIVGKPVAQL 178

Query: 181 LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP 240
           LL+RNATVT+ HS+T+N+ EIC  ADIL+ +VG PR+V  DW+K G++VIDVGINR++  
Sbjct: 179 LLNRNATVTICHSRTRNIEEICAEADILIASVGSPRLVTADWVKKGAVVIDVGINRVDGR 238

Query: 241 QLGKTVLVGDVADEC-KSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
                 L GDV  E  K     ITPVP GVGPMTIAML+ NT + +YR 
Sbjct: 239 ------LCGDVDFETVKDKAAVITPVPKGVGPMTIAMLLENT-LESYRK 280


>gi|169837618|ref|ZP_02870806.1| methylenetetrahydrofolate dehydrogenase [candidate division TM7
           single-cell isolate TM7a]
          Length = 285

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 186/287 (64%), Gaps = 10/287 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++IDGK ++    ++I E    L+++TG + GLAV++VG +PAS  YV  K R  +  GF
Sbjct: 2   TIIDGKALSEKTLEEIKEVHGELQEKTGRKAGLAVIIVGENPASKIYVRNKIRACEKVGF 61

Query: 63  HSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGL 122
           HS       +IS+ +L   +  LN DDSI GILVQLPLP  + E  +I +I  EKDVDG 
Sbjct: 62  HSETIRLDENISEENLLLEIEKLNNDDSIDGILVQLPLPKHIDELEVINAISAEKDVDGF 121

Query: 123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLL 182
           H  N GK+MIGD  TG +PCTP G I + E++ G +L G+  VVIG+SN+ GKPM  LL+
Sbjct: 122 HTTNIGKMMIGD-ETGFLPCTPFGVIQMFEEY-GIELPGKDIVVIGQSNIVGKPMSLLLM 179

Query: 183 SRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL 242
            ++ATV   +S+TKNL E  + ADI++ A G P++V+   +K G  VID+GINR++    
Sbjct: 180 QKHATVQTCNSRTKNLSEKLQKADIIIAAAGSPKLVKGSDVKDGVAVIDIGINRVD---- 235

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRS 288
           GK  + GDV  DE       ITPVPGGVGPMTIAML+ NT + +Y+ 
Sbjct: 236 GK--ICGDVDFDEVSKKALFITPVPGGVGPMTIAMLIKNT-LKSYKQ 279


>gi|126653061|ref|ZP_01725196.1| methylenetetrahydrofolate dehydrogenase [Bacillus sp. B14905]
 gi|126590162|gb|EAZ84286.1| methylenetetrahydrofolate dehydrogenase [Bacillus sp. B14905]
          Length = 284

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/288 (46%), Positives = 187/288 (64%), Gaps = 10/288 (3%)

Query: 3   SLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGF 62
           ++I+GK +   + + +AE V  LK E G+  GLAVVLVG++ AS +YV  K +  +  G 
Sbjct: 4   AIINGKEIGQE