RPSBLAST alignment for GI: 254780506 and conserved domain: PRK14184

>gnl|CDD|172672 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 286
 Score =  275 bits (705), Expect = 1e-74
 Identities = 132/286 (46%), Positives = 175/286 (61%), Gaps = 14/286 (4%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           L+DGK  A+ + +++   VA L    G   GLAV+LVG DPAS  YV  K R  +  G  
Sbjct: 3   LLDGKATAATIREELKTEVAALTARHGRAPGLAVILVGEDPASQVYVRNKERACEDAGIV 62

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +  P D +Q +LE+ +  LN    I GIL+QLPLP  +  Q  ++ I P KDVDG H
Sbjct: 63  SEAFRLPADTTQEELEDLIAELNARPDIDGILLQLPLPKGLDSQRCLELIDPAKDVDGFH 122

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
             N G++ +G    G  PCTPAG + L+E++ G   +G+ AVV+GRSN+ GKP+  +L +
Sbjct: 123 PENMGRLALG--LPGFRPCTPAGVMTLLERY-GLSPAGKKAVVVGRSNIVGKPLALMLGA 179

Query: 184 ----RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINS 239
                NATVT+ HS+T +L E CR AD L VA+GRPR V  D +K G++V+DVGINR + 
Sbjct: 180 PGKFANATVTVCHSRTPDLAEECREADFLFVAIGRPRFVTADMVKPGAVVVDVGINRTD- 238

Query: 240 PQLGKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIA 284
                  LVGD   +    V  AITPVPGGVGPMTIA L+ NTV +
Sbjct: 239 -----DGLVGDCDFEGLSDVASAITPVPGGVGPMTIAQLLVNTVQS 279