RPSBLAST alignment for GI: 254780506 and conserved domain: PRK14191

>gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 285
 Score =  288 bits (739), Expect = 1e-78
 Identities = 112/283 (39%), Positives = 173/283 (61%), Gaps = 9/283 (3%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           L+DGK ++  +   +   +  L  +TG +  LAV+LVG DPAS +YV+ K +  +  G  
Sbjct: 3   LLDGKALSYKIEKDLKNKIQILTAQTGKRPKLAVILVGKDPASQTYVNMKIKACERVGMD 62

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S  +    + ++ +L + +  LN D +I GILVQLPLP  +  + ++++I P KDVDG H
Sbjct: 63  SDLHTLQENTTEAELLSLIKDLNTDQNIDGILVQLPLPRHIDTKMVLEAIDPNKDVDGFH 122

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N GK+       G VP TP G + L++ +   ++ G+  V+IG SN+ GKP+  L+L+
Sbjct: 123 PLNIGKLCSQ--LDGFVPATPMGVMRLLKHY-HIEIKGKDVVIIGASNIVGKPLAMLMLN 179

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQLG 243
             A+V++ H  TK+L    + ADI+ V VG+P +++   +K G++V+D+GINR+N    G
Sbjct: 180 AGASVSVCHILTKDLSFYTQNADIVCVGVGKPDLIKASMVKKGAVVVDIGINRLND---G 236

Query: 244 KTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAA 285
           +  LVGDV  +        ITPVPGGVGPMTI  L+ NT+IAA
Sbjct: 237 R--LVGDVDFENVAPKASFITPVPGGVGPMTIVSLLENTLIAA 277