RPSBLAST alignment for GI: 254780506 and conserved domain: PRK14175

>gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 286
 Score =  239 bits (612), Expect = 6e-64
 Identities = 133/292 (45%), Positives = 190/292 (65%), Gaps = 12/292 (4%)

Query: 4   LIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHCGFH 63
           ++DGK +A      + + V  LK E G    L+V+LVGND AS SYV +K + A+  G  
Sbjct: 5   ILDGKQIAKDYRQGLQDQVEALK-EKGFTPKLSVILVGNDGASQSYVRSKKKAAEKIGMI 63

Query: 64  SVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVDGLH 123
           S   +     ++ ++ N +  LN DDS+ GILVQ+PLP  VSEQ I+++I PEKDVDG H
Sbjct: 64  SEIVHLEETATEEEVLNELNRLNNDDSVSGILVQVPLPKQVSEQKILEAINPEKDVDGFH 123

Query: 124 VVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLS 183
            +N GK+ I + T   VPCTP G I+ I +    DL G++AVVIGRS++ G+P+ +LLL 
Sbjct: 124 PINIGKLYIDEQT--FVPCTPLG-IMEILKHADIDLEGKNAVVIGRSHIVGQPVSKLLLQ 180

Query: 184 RNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSPQL- 242
           +NA+VT+ HS++K++    + AD++V AVG+P +V  D +K G+++IDVG    N+P   
Sbjct: 181 KNASVTILHSRSKDMASYLKDADVIVSAVGKPGLVTKDVVKEGAVIIDVG----NTPDEN 236

Query: 243 GKTVLVGDVA-DECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKS 293
           GK  L GDV  D  K + GAITPVPGGVGP+TI M++ NT++A     G+ S
Sbjct: 237 GK--LKGDVDYDAVKEIAGAITPVPGGVGPLTITMVLNNTLLAEKMRRGIDS 286