RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780508|ref|YP_003064921.1| hypothetical protein CLIBASIA_01975 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) >gnl|CDD|147556 pfam05430, DUF752, Protein of unknown function (DUF752). This family contains several uncharacterized bacterial proteins with no known function. Length = 124 Score = 28.4 bits (64), Expect = 0.53 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Query: 84 YLDAARVVADLF----KKQLQEID--ADGTYHDGFCESLNP 118 RV DL+ + L E+D AD + DGF + NP Sbjct: 25 EFAGGRVTLDLWFGDARAALPELDFKADAWFLDGFSPAKNP 65 >gnl|CDD|39724 KOG4524, KOG4524, KOG4524, Uncharacterized conserved protein [Function unknown]. Length = 1014 Score = 26.5 bits (58), Expect = 2.1 Identities = 17/81 (20%), Positives = 29/81 (35%), Gaps = 9/81 (11%) Query: 12 VLKRVIAVIDNENKNLKN---------NSQFDISISNDHKGRCLHELSVLILSCEEISWD 62 +L+ ++ + ++EN L + N Q +S+ H LS L S ++ Sbjct: 320 LLESLVHLENDENPKLPSHCVKLLEVLNEQLHNKLSDIILFENAHRLSRLSFSITDLEKF 379 Query: 63 HLEQIRTLHEKLALNSSLLES 83 L L L ES Sbjct: 380 AELDTMILEVVNKLFELLNES 400 >gnl|CDD|144772 pfam01295, Adenylate_cycl, Adenylate cyclase, class-I. Length = 830 Score = 25.7 bits (57), Expect = 3.0 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Query: 73 KLALNSSLLESYLD---AARVVADLFKKQLQEIDADGTYHDGFCESL 116 K L LLE+Y R+++ FK++L E D + D + L Sbjct: 264 KAVLKILLLEAYSSEYPNTRLISKEFKQRLLEGDTVSYHFDPYLLML 310 >gnl|CDD|36107 KOG0889, KOG0889, KOG0889, Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms, Chromatin structure and dynamics, Replication, recombination and repair, Cell cycle control, cell division, chromosome partitioning]. Length = 3550 Score = 25.7 bits (56), Expect = 3.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 80 LLESYLDAARVVADLFKKQLQEID 103 L S+ D+ + D+F K L EI Sbjct: 2898 WLLSFDDSLGTLGDVFDKFLGEIP 2921 >gnl|CDD|113104 pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide. Length = 284 Score = 25.7 bits (57), Expect = 3.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 86 DAARVVADLFKKQLQEIDADGTYH 109 D A + L +K+L+ GTYH Sbjct: 186 DLADALLALIRKRLRGPALAGTYH 209 >gnl|CDD|146405 pfam03747, ADP_ribosyl_GH, ADP-ribosylglycohydrolase. This family includes enzymes that ADP-ribosylations, for example ADP-ribosylarginine hydrolase EC:3.2.2.19 cleaves ADP-ribose-L-arginine. The family also includes dinitrogenase reductase activating glycohydrolase. Most surprisingly the family also includes jellyfish crystallins, these proteins appear to have lost the presumed active site residues. Length = 281 Score = 25.4 bits (56), Expect = 3.8 Identities = 16/37 (43%), Positives = 20/37 (54%) Query: 74 LALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHD 110 LAL SLLE+ D A L+ + L+E ADG D Sbjct: 53 LALAESLLENGYDPEDFAARLYVRWLKEGFADGPPRD 89 >gnl|CDD|35273 KOG0050, KOG0050, KOG0050, mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification, Cell cycle control, cell division, chromosome partitioning]. Length = 617 Score = 25.0 bits (54), Expect = 5.0 Identities = 11/53 (20%), Positives = 21/53 (39%) Query: 47 HELSVLILSCEEISWDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQL 99 ++ LIL +ISW L L + + + + R++ D + L Sbjct: 284 YKRDKLILPAPDISWRELRLFVKFGSALLRSRFIQITKVYGIRLLKDYIFRNL 336 >gnl|CDD|146798 pfam04350, PilO, Pilus assembly protein, PilO. PilO proteins are involved in the assembly of pilin. However, the precise function of this family of proteins is not known. Length = 144 Score = 24.8 bits (55), Expect = 6.7 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 79 SLLESYLDAARVVADL--FKKQLQEIDAD 105 +L + + + AR A+L +KKQL+E++ Sbjct: 10 TLKQEFEEKARQAANLPAYKKQLEELEER 38 >gnl|CDD|133058 cd06436, GlcNAc-1-P_transferase, N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine. N-acetyl-glucosamine transferase is responsible for the synthesis of bacteria Poly-beta-1,6-N-acetyl-D-glucosamine (PGA). Poly-beta-1,6-N-acetyl-D-glucosamine is a homopolymer that serves as an adhesion for the maintenance of biofilm structural stability in diverse eubacteria. N-acetyl-glucosamine transferase is the product of gene pgaC. Genetic analysis indicated that all four genes of the pgaABCD locus were required for the PGA production, pgaC being a glycosyltransferase. Length = 191 Score = 24.7 bits (54), Expect = 7.8 Identities = 12/45 (26%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Query: 75 ALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPC 119 + L+E D RV+ + IDADG E++ P Sbjct: 76 QIRQILIEEGADPERVIIAV-------IDADGRLDPNALEAVAPY 113 >gnl|CDD|37085 KOG1874, KOG1874, KOG1874, KEKE-like motif-containing transcription regulator (Rlr1)/suppressor of sin4 [Transcription]. Length = 1477 Score = 24.3 bits (52), Expect = 8.1 Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 55 SCEEISWDHLEQIRTLHEKLALNSS 79 S E++S + L+ R+ + L S Sbjct: 761 SKEKVSSEVLDAERSASQSKILESI 785 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.131 0.374 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,369,368 Number of extensions: 61526 Number of successful extensions: 174 Number of sequences better than 10.0: 1 Number of HSP's gapped: 174 Number of HSP's successfully gapped: 19 Length of query: 123 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 41 Effective length of database: 4,491,799 Effective search space: 184163759 Effective search space used: 184163759 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)