BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780508|ref|YP_003064921.1| hypothetical protein CLIBASIA_01975 [Candidatus Liberibacter asiaticus str. psy62] (123 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780508|ref|YP_003064921.1| hypothetical protein CLIBASIA_01975 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 253 bits (645), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEIS 60 MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEIS Sbjct: 1 MSTSSDYRIQTVLKRVIAVIDNENKNLKNNSQFDISISNDHKGRCLHELSVLILSCEEIS 60 Query: 61 WDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCK 120 WDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCK Sbjct: 61 WDHLEQIRTLHEKLALNSSLLESYLDAARVVADLFKKQLQEIDADGTYHDGFCESLNPCK 120 Query: 121 TTT 123 TTT Sbjct: 121 TTT 123 >gi|254781196|ref|YP_003065609.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str. psy62] Length = 119 Score = 24.3 bits (51), Expect = 0.80, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 65 EQIRTLHEKLALNSSLLESYLDAARVVADLFKKQ 98 +++ TL K N LES+LD A+ V L K + Sbjct: 25 KKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGE 58 >gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str. psy62] Length = 119 Score = 24.3 bits (51), Expect = 0.82, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 65 EQIRTLHEKLALNSSLLESYLDAARVVADLFKKQ 98 +++ TL K N LES+LD A+ V L K + Sbjct: 25 KKLLTLEAKFLPNKRALESWLDKAKKVTSLSKGE 58 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.131 0.374 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,240 Number of Sequences: 1233 Number of extensions: 2805 Number of successful extensions: 6 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 5 length of query: 123 length of database: 328,796 effective HSP length: 64 effective length of query: 59 effective length of database: 249,884 effective search space: 14743156 effective search space used: 14743156 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)