HHsearch alignment for GI: 254780509 and conserved domain: PRK12712

>PRK12712 flgJ peptidoglycan hydrolase; Provisional.
Probab=99.88  E-value=1.2e-22  Score=143.93  Aligned_cols=92  Identities=12%  Similarity=0.209  Sum_probs=76.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             61135543336887544323120789999987022855479999999999999999999951021123357533368999
Q gi|254780509|r    8 NISHSQSMGGNLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQE   87 (112)
Q Consensus         8 ~is~~~~M~gnla~is~~~~s~q~~~~Lk~~~~~~~~~~~l~~~a~~fEa~fl~~~lksmr~~~~~~~lggg~a~d~~~s   87 (112)
T Consensus         5 ~~~~~~dls~------~~a~D~~~l~~Lk~~a~~~~~~~al~~va~qFEalF~q~mlKsMR~a~~~~~~~~s~~~~~y~~   78 (344)
T PRK12712          5 TLSAQADLSQ------RFALDTQGFEALKHSARGGADAGTLQAAARQFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYMS   78 (344)
T ss_pred             CCCCCCCHHH------HHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
T ss_conf             8786433034------5562677799999998539817899999999999999999999984677788878716789999


Q ss_pred             HHHHHHHHHHHHCCCCCCC
Q ss_conf             9999999999980798756
Q gi|254780509|r   88 ILAENISDVIVKQQRITLD  106 (112)
Q Consensus        88 Ml~ee~a~~iAk~ggiGL~  106 (112)
T Consensus        79 m~DqQla~~ls~~-G~GLa   96 (344)
T PRK12712         79 MMDQQLAQQMSSR-GIGLA   96 (344)
T ss_pred             HHHHHHHHHHHHC-CCCHH
T ss_conf             9999999998546-88899