RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780509|ref|YP_003064922.1| hypothetical protein CLIBASIA_01980 [Candidatus Liberibacter asiaticus str. psy62] (112 letters) >gnl|CDD|145766 pfam02782, FGGY_C, FGGY family of carbohydrate kinases, C-terminal domain. This domain adopts a ribonuclease H-like fold and is structurally related to the N-terminal domain. Length = 193 Score = 28.4 bits (64), Expect = 0.45 Identities = 9/42 (21%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Query: 55 LQGIMFQY------FIKSILPEETVKSLGGGFNGDFWQEILA 90 L+G+ Q + P + + + GGG ++LA Sbjct: 124 LEGLALQLRQILEALAELGAPIDRIIASGGGSRNPLLLQLLA 165 >gnl|CDD|31268 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]. Length = 502 Score = 26.1 bits (57), Expect = 2.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 69 PEETVKSLGGGFNGDFWQEILA 90 P V+ +GGG W +ILA Sbjct: 401 PPSRVRVVGGGARSPLWLQILA 422 >gnl|CDD|146600 pfam04053, Coatomer_WDAD, Coatomer WD associated region. This region is composed of WD40 repeats. Length = 435 Score = 26.0 bits (58), Expect = 2.4 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 7/40 (17%) Query: 18 NLAKISQ----DDSSFQSFLQLKDVQEACD---KSKSVPE 50 LAKI++ +S+FQ+ L L DV++ D K+ +PE Sbjct: 386 KLAKIAEERGDYNSAFQNALYLGDVEKCVDILIKTGRLPE 425 >gnl|CDD|29948 cd00955, Transaldolase_like, Transaldolase-like proteins from plants and bacteria. Transaldolase is found in the non-oxidative branch of the pentose phosphate pathway, that catalyze the reversible transfer of a dihydroxyacetone group from fructose-6-phosphate to erythrose-4-phosphate yielding sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate. They are members of the class I aldolases, who are characterized by using a Schiff-base mechanism for stabilization of the reaction intermediates.. Length = 338 Score = 24.9 bits (54), Expect = 5.7 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Query: 9 ISHSQSMGGNLAKISQDDSSFQSF---LQLKDVQEACDKSKSVPEMTQKLQG 57 I+ S + + + ++ L ++D+Q+ACD V E T G Sbjct: 40 IAGSAAYDDQIRALKGQGLDAEAIYEALAIEDIQDACDLLAPVYEQTGGNDG 91 >gnl|CDD|34517 COG4908, COG4908, Uncharacterized protein containing a NRPS condensation (elongation) domain [General function prediction only]. Length = 439 Score = 24.1 bits (52), Expect = 8.7 Identities = 6/20 (30%), Positives = 9/20 (45%) Query: 79 GFNGDFWQEILAENISDVIV 98 G FWQ IL + + + Sbjct: 63 GEKRPFWQRILDFEVDQIAI 82 >gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase. LCAD is an acyl-CoA dehydrogenases (ACAD), which is found in the mitochondria of eukaryotes and in some prokaryotes. It catalyzes the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of LCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. LCAD acts as a homodimer. Length = 372 Score = 24.0 bits (52), Expect = 8.8 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Query: 57 GIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98 G M +Y I + V+ + GG EI+ E IS +V Sbjct: 336 GYMREYPIARAYRDARVQPIYGGTT-----EIMKELISRQMV 372 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.132 0.363 Gapped Lambda K H 0.267 0.0670 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,240,333 Number of extensions: 54135 Number of successful extensions: 117 Number of sequences better than 10.0: 1 Number of HSP's gapped: 117 Number of HSP's successfully gapped: 14 Length of query: 112 Length of database: 6,263,737 Length adjustment: 78 Effective length of query: 34 Effective length of database: 4,578,235 Effective search space: 155659990 Effective search space used: 155659990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.5 bits)