RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780509|ref|YP_003064922.1| hypothetical protein
CLIBASIA_01980 [Candidatus Liberibacter asiaticus str. psy62]
         (112 letters)



>gnl|CDD|145766 pfam02782, FGGY_C, FGGY family of carbohydrate kinases, C-terminal
           domain.  This domain adopts a ribonuclease H-like fold
           and is structurally related to the N-terminal domain.
          Length = 193

 Score = 28.4 bits (64), Expect = 0.45
 Identities = 9/42 (21%), Positives = 17/42 (40%), Gaps = 6/42 (14%)

Query: 55  LQGIMFQY------FIKSILPEETVKSLGGGFNGDFWQEILA 90
           L+G+  Q         +   P + + + GGG       ++LA
Sbjct: 124 LEGLALQLRQILEALAELGAPIDRIIASGGGSRNPLLLQLLA 165


>gnl|CDD|31268 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate
           transport and metabolism].
          Length = 502

 Score = 26.1 bits (57), Expect = 2.0
 Identities = 9/22 (40%), Positives = 12/22 (54%)

Query: 69  PEETVKSLGGGFNGDFWQEILA 90
           P   V+ +GGG     W +ILA
Sbjct: 401 PPSRVRVVGGGARSPLWLQILA 422


>gnl|CDD|146600 pfam04053, Coatomer_WDAD, Coatomer WD associated region.  This
           region is composed of WD40 repeats.
          Length = 435

 Score = 26.0 bits (58), Expect = 2.4
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 7/40 (17%)

Query: 18  NLAKISQ----DDSSFQSFLQLKDVQEACD---KSKSVPE 50
            LAKI++     +S+FQ+ L L DV++  D   K+  +PE
Sbjct: 386 KLAKIAEERGDYNSAFQNALYLGDVEKCVDILIKTGRLPE 425


>gnl|CDD|29948 cd00955, Transaldolase_like, Transaldolase-like proteins from
          plants and bacteria. Transaldolase is found in the
          non-oxidative branch of the pentose phosphate pathway,
          that catalyze the reversible transfer of a
          dihydroxyacetone group from fructose-6-phosphate to
          erythrose-4-phosphate yielding
          sedoheptulose-7-phosphate and
          glyceraldehyde-3-phosphate. They are members of the
          class I aldolases, who are characterized by using a
          Schiff-base mechanism for stabilization of the reaction
          intermediates..
          Length = 338

 Score = 24.9 bits (54), Expect = 5.7
 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 3/52 (5%)

Query: 9  ISHSQSMGGNLAKISQDDSSFQSF---LQLKDVQEACDKSKSVPEMTQKLQG 57
          I+ S +    +  +       ++    L ++D+Q+ACD    V E T    G
Sbjct: 40 IAGSAAYDDQIRALKGQGLDAEAIYEALAIEDIQDACDLLAPVYEQTGGNDG 91


>gnl|CDD|34517 COG4908, COG4908, Uncharacterized protein containing a NRPS
          condensation (elongation) domain [General function
          prediction only].
          Length = 439

 Score = 24.1 bits (52), Expect = 8.7
 Identities = 6/20 (30%), Positives = 9/20 (45%)

Query: 79 GFNGDFWQEILAENISDVIV 98
          G    FWQ IL   +  + +
Sbjct: 63 GEKRPFWQRILDFEVDQIAI 82


>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase.  LCAD is an
           acyl-CoA dehydrogenases (ACAD), which is found in the
           mitochondria of eukaryotes and in some prokaryotes.  It
           catalyzes the alpha, beta dehydrogenation of the
           corresponding trans-enoyl-CoA by FAD, which becomes
           reduced. The reduced form of LCAD is reoxidized in the
           oxidative half-reaction by electron-transferring
           flavoprotein (ETF), from which the electrons are
           transferred to the mitochondrial respiratory chain
           coupled with ATP synthesis. LCAD acts as a homodimer.
          Length = 372

 Score = 24.0 bits (52), Expect = 8.8
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 5/42 (11%)

Query: 57  GIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
           G M +Y I     +  V+ + GG       EI+ E IS  +V
Sbjct: 336 GYMREYPIARAYRDARVQPIYGGTT-----EIMKELISRQMV 372


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.315