RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780509|ref|YP_003064922.1| hypothetical protein CLIBASIA_01980 [Candidatus Liberibacter asiaticus str. psy62] (112 letters) >gnl|CDD|139170 PRK12710, flgJ, flagellar rod assembly protein/muramidase FlgJ; Provisional. Length = 291 Score = 27.8 bits (61), Expect = 0.62 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Query: 27 SSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGD--- 83 S FQ +LK VQ + +++PE+ ++ +GI Q +KS+ + F+G Sbjct: 9 SDFQGLNELK-VQAKNNAKEALPEVAKQFEGIFLQSMLKSMRMGQHFLDESSPFSGKNEA 67 Query: 84 FWQEILAENISDVIVKQQRITL 105 +QE+L + I + + I L Sbjct: 68 TFQEMLDTQYASTIAESKGIGL 89 >gnl|CDD|162297 TIGR01312, XylB, D-xylulose kinase. D-xylulose kinase (XylB) generally is found with xylose isomerase (XylA) and acts in xylose utilization. Length = 481 Score = 26.5 bits (59), Expect = 1.7 Identities = 7/24 (29%), Positives = 17/24 (70%) Query: 68 LPEETVKSLGGGFNGDFWQEILAE 91 +P ++++ +GGG W+++LA+ Sbjct: 389 IPIQSIRLIGGGAKSPAWRQMLAD 412 >gnl|CDD|131814 TIGR02767, TraG-Ti, Ti-type conjugative transfer system protien TraG. This protein is found in the Agrobacterium tumefaciens Ti plasmid tra region responsible for conjugative transfer of the entire plasmid among Agrobacterium strains. The protein is distantly related to the F-type conjugation system TraG protein. Both of these systems are examples of type IV secretion systems. Length = 623 Score = 25.6 bits (56), Expect = 3.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 25 DDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQG 57 + SF S+ +KD+ A SK +MT ++ G Sbjct: 521 ESCSFISYAAIKDLDTADYISKRCGDMTVEVDG 553 >gnl|CDD|172350 PRK13822, PRK13822, conjugal transfer coupling protein TraG; Provisional. Length = 641 Score = 25.3 bits (56), Expect = 3.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 28 SFQSFLQLKDVQEACDKSKSVPEMTQKLQG 57 S+ SF +KD+ A S+ EMT ++ Sbjct: 536 SWISFAAIKDLDTADYISERCGEMTVEVDQ 565 >gnl|CDD|163169 TIGR03168, 1-PFK, hexose kinase, 1-phosphofructokinase family. This family consists largely of 1-phosphofructokinases, but also includes tagatose-6-kinases and 6-phosphofructokinases. Length = 303 Score = 25.2 bits (56), Expect = 3.9 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Query: 71 ETVKSLG--GGFNGDFWQEILAE-NISD--VIVKQQ-RITLDLPEISK 112 V + G GGF G+F + +LAE I + V VK + RI + + E S Sbjct: 50 AEVVATGFLGGFTGEFIEALLAEEGIKNDFVEVKGETRINVKIKESSG 97 >gnl|CDD|150771 pfam10135, Rod-binding, Rod binding protein. Members of this family are involved in the assembly of the prokaryotic flagellar rod. Length = 49 Score = 25.2 bits (56), Expect = 3.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Query: 76 LGGGFNGDFWQEILAENISDVIVKQQRITL 105 G GF D ++ +L + ++ + K+ I L Sbjct: 13 FGSGFAEDMFRSMLDQQLAKQLAKRGGIGL 42 >gnl|CDD|180749 PRK06920, dnaE, DNA polymerase III DnaE; Reviewed. Length = 1107 Score = 25.1 bits (55), Expect = 4.2 Identities = 6/23 (26%), Positives = 11/23 (47%) Query: 89 LAENISDVIVKQQRITLDLPEIS 111 L ENI I ++ +D+ + Sbjct: 545 LLENIIKFIEQKTGKEIDIRNLP 567 >gnl|CDD|163540 TIGR03828, pfkB, 1-phosphofructokinase. This enzyme acts in concert with the fructose-specific phosphotransferase system (PTS) which imports fructose as fructose-1-phosphate. The action of 1-phosphofructokinase results in beta-D-fructose-1,6-bisphosphate and is an entry point into glycolysis (GenProp0688). Length = 304 Score = 24.9 bits (55), Expect = 5.3 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 6/46 (13%) Query: 73 VKSLG--GGFNGDFWQEILAEN-ISD--VIVKQQ-RITLDLPEISK 112 V +LG GGF GDF + +L E I V V + RI + + E S Sbjct: 52 VVALGFLGGFTGDFIEALLREEGIKTDFVRVPGETRINVKIKEPSG 97 >gnl|CDD|173403 PTZ00111, PTZ00111, DNA replication licensing factor MCM4; Provisional. Length = 915 Score = 24.6 bits (53), Expect = 5.5 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 18 NLAKISQDDSSF-QSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKSIL 68 L ++S+ ++F ++F + DV E D+ +S PE T+ FIK L Sbjct: 84 RLEELSERFTNFLKNFTEFSDVLEFKDEQQSKPEYTELYYLWKLMNFIKENL 135 >gnl|CDD|172707 PRK14219, PRK14219, camphor resistance protein CrcB; Provisional. Length = 132 Score = 24.8 bits (54), Expect = 5.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 66 SILPEETVKSLGGGFNGDF 84 +ILP + + +G GF G F Sbjct: 58 NILPSDVITGIGTGFIGSF 76 >gnl|CDD|128349 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD). Many of these domains function as calcium-dependent carbohydrate binding modules. Length = 126 Score = 24.5 bits (53), Expect = 6.8 Identities = 7/22 (31%), Positives = 11/22 (50%), Gaps = 2/22 (9%) Query: 13 QSMGGNLAKISQDDSSFQSFLQ 34 QS+G +LA I + F+ Sbjct: 30 QSLGAHLASI--HSEAENDFVA 49 >gnl|CDD|162104 TIGR00915, 2A0602, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. This family is one of several subfamilies within the scope of pfam model pfam00873. Length = 1044 Score = 24.3 bits (53), Expect = 7.4 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Query: 5 PISNISHSQSMGG-NLAKISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQ 61 +N+ ++ G + A Q +S +F++LKD +E K SV + + G Q Sbjct: 602 EKANVESVFTVNGFSFAGRGQ--NSGMAFIRLKDWEERTGKENSVFAIAGRATGHFSQ 657 >gnl|CDD|180729 PRK06850, PRK06850, hypothetical protein; Provisional. Length = 507 Score = 24.2 bits (53), Expect = 7.9 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 25 DDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQGIMFQYFIKS 66 D S F S + ++E C + E+ +KL + QY S Sbjct: 407 DQSLFGS-DEADLLEELCQEDGLHLELVRKLLDLERQYRGLS 447 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.132 0.363 Gapped Lambda K H 0.267 0.0785 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,711,195 Number of extensions: 90513 Number of successful extensions: 189 Number of sequences better than 10.0: 1 Number of HSP's gapped: 189 Number of HSP's successfully gapped: 23 Length of query: 112 Length of database: 5,994,473 Length adjustment: 78 Effective length of query: 34 Effective length of database: 4,309,049 Effective search space: 146507666 Effective search space used: 146507666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (22.9 bits)