RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780509|ref|YP_003064922.1| hypothetical protein
CLIBASIA_01980 [Candidatus Liberibacter asiaticus str. psy62]
         (112 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 34.1 bits (78), Expect = 0.008
 Identities = 20/126 (15%), Positives = 45/126 (35%), Gaps = 38/126 (30%)

Query: 5   PISNISHSQSMGGNLA-KISQDDSSFQSFLQLKDVQEACDKSKSVPEMTQKLQG------ 57
           P++ +SH     G+L   +    +SF    QL++       +K +PE T+          
Sbjct: 8   PLT-LSH-----GSLEHVLLVPTASFFIASQLQE-----QFNKILPEPTEGFAADDEPTT 56

Query: 58  -----IMFQYFIKSILPEET-------VKSLGGGFNGDFWQ--EI---LAENISD---VI 97
                  F  ++ S++           +      F   + +  +I    A+ + +    +
Sbjct: 57  PAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTL 116

Query: 98  VKQQRI 103
           VK + +
Sbjct: 117 VKTKEL 122



 Score = 29.1 bits (65), Expect = 0.27
 Identities = 9/81 (11%), Positives = 23/81 (28%), Gaps = 28/81 (34%)

Query: 13  QSMGGNLAKISQDDSSFQSFLQLK-DVQEACDKSKSVPE---------------MTQKLQ 56
           +     L+++ +     +       ++ E  +   + P+               + Q   
Sbjct: 189 KFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQ--- 245

Query: 57  GIMFQYFIKSILPEETVKSLG 77
             +  Y +       T K LG
Sbjct: 246 --LAHYVV-------TAKLLG 257


>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics,
           NPPSFA, national project on protein structural and
           functional analyses; 2.80A {Thermus thermophilus}
          Length = 495

 Score = 28.3 bits (62), Expect = 0.47
 Identities = 7/49 (14%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 50  EMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
            +  +++ ++     ++ +  + +K+ GG      + +I A ++  V V
Sbjct: 379 GVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQA-DLLGVPV 426


>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,,
           transferase, structural genomics, PSI-2; 2.00A
           {Bifidobacterium adolescentis ATCC15703}
          Length = 515

 Score = 28.0 bits (61), Expect = 0.48
 Identities = 4/42 (9%), Positives = 13/42 (30%), Gaps = 6/42 (14%)

Query: 55  LQGIMFQY------FIKSILPEETVKSLGGGFNGDFWQEILA 90
           ++G++                   +  +GGG   +  + +  
Sbjct: 404 VEGLLCSQRDCLELIRSLGASITRILLIGGGAKSEAIRTLAP 445


>3gbt_A Gluconate kinase; LBA0354, FGGY kinase family, carbohydrate
           metabolic process, transferase, structural genomics,
           PSI-2; 2.40A {Lactobacillus acidophilus ncfm}
          Length = 504

 Score = 27.4 bits (59), Expect = 0.88
 Identities = 10/40 (25%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 59  MFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
                IK+      + + GG    DF +++ A NI +V +
Sbjct: 383 AASNLIKNTKKPVAINATGGFLKSDFVRQLCA-NIFNVPI 421


>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose,
           transferase, structural genomics, PSI-2, protein
           structure initiative; HET: ATP DXP XUL ADP; 2.00A
           {Lactobacillus acidophilus} PDB: 3gbt_A*
          Length = 504

 Score = 27.0 bits (59), Expect = 0.98
 Identities = 10/40 (25%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 59  MFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
                IK+      + + GG    DF +++ A NI +V +
Sbjct: 383 AASNLIKNTKKPVAINATGGFLKSDFVRQLCA-NIFNVPI 421


>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics,
           protein structure initiative; HET: MSE XUL EPE; 1.61A
           {Yersinia pseudotuberculosis} PDB: 3gg4_A*
          Length = 554

 Score = 26.9 bits (58), Expect = 1.1
 Identities = 7/50 (14%), Positives = 18/50 (36%), Gaps = 7/50 (14%)

Query: 55  LQGIMFQY------FIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
           +Q +            ++    +T+ + GGG     + +  A N +   +
Sbjct: 422 IQALALGTRHIIETMNQNGYNIDTMMASGGGTKNPIFVQEHA-NATGCAM 470


>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain
           DSM 12444, SGX, transferase, structural genomics; 2.50A
           {Novosphingobium aromaticivorans DSM12444}
          Length = 482

 Score = 26.8 bits (58), Expect = 1.1
 Identities = 7/46 (15%), Positives = 10/46 (21%), Gaps = 2/46 (4%)

Query: 55  LQGIMFQYF--IKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
                      +  I     +   G     D +   LA    D  V
Sbjct: 371 CLYAALVADTALDLIGSTGRILVEGRFAEADVFVRALASLRPDCAV 416


>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase;
           HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A
          Length = 484

 Score = 26.9 bits (58), Expect = 1.3
 Identities = 9/41 (21%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 59  MFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVK 99
                    +  ++V  +GGG   ++W+++LA +IS   + 
Sbjct: 376 GMDVVHACGIKPQSVTLIGGGARSEYWRQMLA-DISGQQLD 415


>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism,
           nucleotide-binding, transferase, structural genomics;
           HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB:
           3ge1_A*
          Length = 501

 Score = 25.9 bits (56), Expect = 2.2
 Identities = 9/52 (17%), Positives = 22/52 (42%), Gaps = 8/52 (15%)

Query: 55  LQGIMFQYFI-------KSILPEETVKSLGGGFNGDFWQEILAENISDVIVK 99
           L+ + +Q           S +  ++++  GG    +F  +  A +I +  V+
Sbjct: 383 LESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQFQA-DIVNTSVE 433


>2w40_A Glycerol kinase, putative; closed conformation, malaria,
           transferase, sugar kinase/HSP70/actin superfamily, open
           conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A*
          Length = 503

 Score = 25.7 bits (55), Expect = 2.3
 Identities = 3/30 (10%), Positives = 11/30 (36%), Gaps = 1/30 (3%)

Query: 69  PEETVKSLGGGFNGDFWQEILAENISDVIV 98
               ++  GG      + +  + +I +  +
Sbjct: 407 MLHVLRCDGGMTKNKPFMQFNS-DIINTKI 435


>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif,
           actin- like ATPase domain, transferase; 2.30A
           {Cellulomonas SP}
          Length = 504

 Score = 25.3 bits (54), Expect = 3.0
 Identities = 5/36 (13%), Positives = 13/36 (36%), Gaps = 1/36 (2%)

Query: 69  PEETVKSLGGGFNGDFWQEILAENISDVIVKQQRIT 104
               ++  GG    +   +  A +   V V + ++ 
Sbjct: 403 DLTELRVDGGMVANELLMQFQA-DQLGVDVVRPKVA 437


>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism,
           nucleotide-binding, phosphoprotein, transferase; 1.73A
           {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X
           3h45_X 3d7e_O 1r59_O 1xup_O
          Length = 506

 Score = 25.5 bits (55), Expect = 3.1
 Identities = 8/31 (25%), Positives = 13/31 (41%), Gaps = 1/31 (3%)

Query: 69  PEETVKSLGGGFNGDFWQEILAENISDVIVK 99
               +K  GG    D   +  A +I D+ V+
Sbjct: 403 DIPLLKVDGGAAKNDLLMQFQA-DILDIDVQ 432


>3fhd_A ORF 37; enase like PD-(D/E)XK superfamily, hydrolase; 1.85A
          {Human herpesvirus 8 type M}
          Length = 508

 Score = 25.3 bits (55), Expect = 3.6
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 27 SSFQSFLQLKDVQEACDKSKSVPEM 51
           SF  FL+   V++ C ++K  P M
Sbjct: 57 LSFSKFLKHAKVRDWCAQAKIQPSM 81


>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural
           genomics, transferase, PSI-2, protein structure
           initiative; 2.30A {Rhodospirillum rubrum atcc 11170}
          Length = 508

 Score = 25.1 bits (53), Expect = 3.8
 Identities = 6/41 (14%), Positives = 12/41 (29%), Gaps = 1/41 (2%)

Query: 59  MFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIVK 99
                       +   +  GG     W  I+A ++    V+
Sbjct: 390 HVAVLDDIGHAPQRFFASDGGTRSRVWMGIMA-DVLQRPVQ 429


>3hz6_A Xylulokinase; xylulose, structural genomic, manolate, transferase,
           structural genomics, PSI-2, protein structure
           initiative; HET: ADP XUL; 1.65A {Chromobacterium
           violaceum}
          Length = 511

 Score = 25.0 bits (53), Expect = 3.9
 Identities = 6/20 (30%), Positives = 11/20 (55%)

Query: 71  ETVKSLGGGFNGDFWQEILA 90
             +K +GGG   + W  ++A
Sbjct: 404 GLLKVVGGGARSEAWLRMIA 423


>2p3r_A Glycerol kinase; glycerol metabolism, allosteric regulation,
           microfluidics,; 2.00A {Escherichia coli} SCOP: c.55.1.4
           c.55.1.4 PDB: 3ezw_A 1gla_G 1bo5_O* 1bot_O 1glb_G*
           1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y*
           1gll_Y*
          Length = 510

 Score = 25.2 bits (54), Expect = 3.9
 Identities = 5/36 (13%), Positives = 14/36 (38%), Gaps = 1/36 (2%)

Query: 69  PEETVKSLGGGFNGDFWQEILAENISDVIVKQQRIT 104
               ++  GG    +F  +  + +I    V++  + 
Sbjct: 401 RLHALRVDGGAVANNFLMQFQS-DILGTRVERPEVR 435


>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer,
           hexokinase-HSP70- actin superfamily, L-rhamnulose
           kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB:
           2cgk_A 2cgj_A* 2cgl_A*
          Length = 489

 Score = 25.0 bits (53), Expect = 4.3
 Identities = 5/49 (10%), Positives = 15/49 (30%), Gaps = 1/49 (2%)

Query: 50  EMTQKLQGIMFQYFIKSILPEETVKSLGGGFNGDFWQEILAENISDVIV 98
            +      ++ +           +  +GGG       ++ A +   + V
Sbjct: 374 SLALLYADVLHELAQLRGEDFSQLHIVGGGCQNTLLNQLCA-DACGIRV 421


>2oxg_Y SOXY protein; immunoglobulin-like beta-sandwich fold, transport
           protein; 1.40A {Paracoccus denitrificans} PDB: 2oxh_Y*
           2ox5_Y*
          Length = 124

 Score = 24.8 bits (54), Expect = 5.7
 Identities = 7/26 (26%), Positives = 10/26 (38%)

Query: 85  WQEILAENISDVIVKQQRITLDLPEI 110
             E+ A         +  +TL  PEI
Sbjct: 15  VDELTAAFTGGAATGEGGLTLTAPEI 40


  Database: pdb70
    Post