RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >gnl|CDD|183889 PRK13199, psaB, photosystem I P700 chlorophyll a apoprotein A2; Provisional. Length = 742 Score = 26.3 bits (58), Expect = 2.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 110 RQYDDENNNDNIEQRIL 126 R YD E N DN+ R+L Sbjct: 401 RDYDPEANKDNVLARVL 417 >gnl|CDD|179375 PRK02126, PRK02126, ribonuclease Z; Provisional. Length = 334 Score = 26.4 bits (59), Expect = 2.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 27 LAYTISERKKINILREKL 44 LA+ + E+ INI + +L Sbjct: 167 LAFALEEKAHINIDKNRL 184 >gnl|CDD|150064 pfam09265, Cytokin-bind, Cytokinin dehydrogenase 1, FAD and cytokinin binding. Members of this family adopt an alpha+beta sandwich structure with an antiparallel beta-sheet, in a ferredoxin-like fold. They are predominantly found in plant cytokinin dehydrogenase 1, where they are capable of binding both FAD and cytokinin substrates. The substrate displays a 'plug-into-socket' binding mode that seals the catalytic site and precisely positions the carbon atom undergoing oxidation in close contact with the reactive locus of the flavin. Length = 280 Score = 25.0 bits (55), Expect = 7.4 Identities = 9/38 (23%), Positives = 17/38 (44%) Query: 88 LSEKIKIDRLTEMKDETYLLEERQYDDENNNDNIEQRI 125 S+ +I L Y LE +Y D++ ++Q + Sbjct: 58 PSDPKRIASLASNGGVLYCLEVAKYYDDSTAATVDQEV 95 >gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component). dihydrolipoamide acetyltransferase. The seed for this model includes mitochondrial and Gram-negative bacterial forms. Mycobacterial candidates are highly derived, differ in having and extra copy of the lipoyl-binding domain at the N-terminus. They score below the trusted cutoff, but above the noise cutoff and above all examples of dihydrolipoamide acetyltransferase. Length = 403 Score = 24.7 bits (54), Expect = 7.8 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Query: 20 KSIAESNLAYTISE-RKKINILR----EKLKDSINSTALM 54 + A++ +T E R K+ LR E+LK++ NSTA++ Sbjct: 161 AAAAKAPANFTRPEERVKMTRLRQRIAERLKEAQNSTAML 200 >gnl|CDD|179363 PRK02083, PRK02083, imidazole glycerol phosphate synthase subunit HisF; Provisional. Length = 253 Score = 24.6 bits (55), Expect = 8.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 45 KDSINSTALMNPAL 58 K SINS A+ NP L Sbjct: 99 KVSINSAAVANPEL 112 >gnl|CDD|162146 TIGR00986, 3a0801s05tom22, mitochondrial import receptor subunit Tom22. translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom22 proteins. Length = 145 Score = 24.5 bits (53), Expect = 8.9 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Query: 96 RLTEMKDETYLLEERQY------DDENNND 119 +LTE++DE + E+Q DDE+ D Sbjct: 3 QLTEVEDEHFQQPEQQTVVEPEEDDEDFTD 32 >gnl|CDD|173589 PTZ00398, PTZ00398, phosphoenolpyruvate carboxylase; Provisional. Length = 974 Score = 24.4 bits (53), Expect = 9.4 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 9/81 (11%) Query: 38 NILREKLKDSINSTALMN--PALASHYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKID 95 N+LR KLK + N L+ L + + S+ + +A L+Q L Sbjct: 880 NLLRNKLKKTTNLILLVTKEKQLLDNDIVTKRSILLRFKWVAPCNLIQIEAL-------K 932 Query: 96 RLTEMKDETYLLEERQYDDEN 116 RL ++ D TY + + ++ Sbjct: 933 RLRKINDSTYDEDTKNEIEDT 953 >gnl|CDD|182265 PRK10144, PRK10144, formate-dependent nitrite reductase complex subunit NrfF; Provisional. Length = 126 Score = 24.4 bits (53), Expect = 9.5 Identities = 9/40 (22%), Positives = 18/40 (45%) Query: 16 QCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMN 55 QC +++ ESN +S R ++ + + K + M Sbjct: 45 QCQNQNLLESNAPVAVSMRHQVYSMVAEGKSEVEIIGWMT 84 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.128 0.335 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,026,529 Number of extensions: 112837 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 246 Number of HSP's successfully gapped: 27 Length of query: 137 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 53 Effective length of database: 4,179,401 Effective search space: 221508253 Effective search space used: 221508253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (23.8 bits)