RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Score = 25.8 bits (56), Expect = 1.3 Identities = 10/32 (31%), Positives = 20/32 (62%) Query: 24 ESNLAYTISERKKINILREKLKDSINSTALMN 55 + N+ ++SE+ K N + K K + N+TA++ Sbjct: 274 DKNIHQSVSEQIKKNFAKSKWKQAFNATAVVR 305 >d2ohwa1 d.79.8.1 (A:3-130) Uncharacterized protein YueI {Bacillus subtilis [TaxId: 1423]} Length = 128 Score = 23.5 bits (51), Expect = 6.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Query: 27 LAYTISERKKINILRE---KLKDSINSTALMNPALASHYLKFYHSLSQ 71 LA T + + +E +LK+S N T L+N L Y ++ Sbjct: 36 LALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMAS 83 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.128 0.335 Gapped Lambda K H 0.267 0.0546 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 440,825 Number of extensions: 17774 Number of successful extensions: 28 Number of sequences better than 10.0: 1 Number of HSP's gapped: 28 Number of HSP's successfully gapped: 6 Length of query: 137 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 61 Effective length of database: 1,364,116 Effective search space: 83211076 Effective search space used: 83211076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (22.7 bits)