BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] Length = 137 Score = 275 bits (703), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 137/137 (100%), Positives = 137/137 (100%) Query: 1 MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALAS 60 MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALAS Sbjct: 1 MRSRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPALAS 60 Query: 61 HYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDN 120 HYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDN Sbjct: 61 HYLKFYHSLSQNDQKMASLQLVQENTLLSEKIKIDRLTEMKDETYLLEERQYDDENNNDN 120 Query: 121 IEQRILFNAVSRKFMSL 137 IEQRILFNAVSRKFMSL Sbjct: 121 IEQRILFNAVSRKFMSL 137 >gi|254781202|ref|YP_003065615.1| hypothetical protein CLIBASIA_05545 [Candidatus Liberibacter asiaticus str. psy62] Length = 864 Score = 23.9 bits (50), Expect = 1.3, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 18/23 (78%) Query: 33 ERKKINILREKLKDSINSTALMN 55 ERK+INIL++K+ + +++ L N Sbjct: 606 ERKEINILKDKVSNKMHALVLDN 628 >gi|255764489|ref|YP_003065094.2| stationary phase survival protein SurE [Candidatus Liberibacter asiaticus str. psy62] Length = 250 Score = 23.5 bits (49), Expect = 1.7, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 24 ESNLAYTISERKKINILREKLKDSINSTALMN 55 E+ + + +SE +LR+ LK I +T L N Sbjct: 130 ENMIPWEVSETHAPRVLRQLLKTQIPNTTLCN 161 >gi|254780826|ref|YP_003065239.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Score = 22.7 bits (47), Expect = 2.7, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 66 YHSLSQNDQKMASLQLVQENTLLSEKIKI 94 ++ + DQKM L L+ EN ++IKI Sbjct: 481 WNDVEAYDQKMRELLLMFENNAEKKQIKI 509 >gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 22.3 bits (46), Expect = 3.4, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 8/47 (17%) Query: 3 SRKSRALYKIITAQCCIKSIAESNLAYTISERKKINILREKLKDSIN 49 +RK +L K T QC ++SI I+E++ ++ L L+ ++ Sbjct: 12 TRKGHSLMKNSTVQCALRSI--------IAEKRGLSSLESSLQGELS 50 >gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 21.9 bits (45), Expect = 4.9, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 36 KINILREKLKDSINSTALMNPALAS 60 K+NI+++ LKD +TA+ LAS Sbjct: 2 KMNIVKDFLKDESGATAIEYGLLAS 26 >gi|254780763|ref|YP_003065176.1| hypothetical protein CLIBASIA_03260 [Candidatus Liberibacter asiaticus str. psy62] Length = 107 Score = 21.2 bits (43), Expect = 7.3, Method: Compositional matrix adjust. Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 17/85 (20%) Query: 25 SNLAYTISERKKINILREKLKDSINSTALMNPALASHYLKFYHSLSQNDQKMASLQLVQE 84 SN+ + + K+I EK+K+SI S + M S+++ + Sbjct: 2 SNIMKMVGQFKEIQGKMEKMKESITS---------------LEAEGNAGGGMVSVRINGK 46 Query: 85 NTLLSEKIKIDRLTEMKDETYLLEE 109 N L +KIDR +D +LE+ Sbjct: 47 NMLTG--VKIDRSLLFEDNVEILED 69 >gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Score = 20.8 bits (42), Expect = 9.7, Method: Compositional matrix adjust. Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 12/100 (12%) Query: 12 IITAQCCIKSIAESNLAYTISERKKINILREKLKDSINSTALMNPA---LASHYLKFYHS 68 +T++ C+ +AE + + IN DS S ++M A + SH +KF S Sbjct: 187 FVTSEGCLVYLAE-DFGFKSLYLWPIN------SDSERSPSMMRHAINQMRSHKIKFIFS 239 Query: 69 LSQNDQKMASLQLVQENTLLSEKIKIDRLT--EMKDETYL 106 S N + A + N + +D L+ + TYL Sbjct: 240 ESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYL 279 >gi|254780190|ref|YP_003064603.1| fumarate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 463 Score = 20.8 bits (42), Expect = 9.8, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Query: 9 LYKIITAQCCIKSI---AESNLAYTISERKKINILREKLKDSINSTALMNPALAS 60 +YK + A ++SI ++S ++TI+ + I +E ++ S+N + ++ AL S Sbjct: 360 VYKPMIAYNVLQSIQLLSDSIDSFTINCIEGIQARKENIQLSLNRSLMLVTALTS 414 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.128 0.335 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,208 Number of Sequences: 1233 Number of extensions: 2726 Number of successful extensions: 19 Number of sequences better than 100.0: 16 Number of HSP's better than 100.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 16 length of query: 137 length of database: 328,796 effective HSP length: 65 effective length of query: 72 effective length of database: 248,651 effective search space: 17902872 effective search space used: 17902872 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 34 (17.7 bits)