BLAST/PSIBLAST alignment of GI: 254780511 and GI: 315122292 at iteration 1
>gi|315122292|ref|YP_004062781.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247
>gi|313495694|gb|ADR52293.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 247
 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 216/243 (88%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M  SPEII+MSLFLI CR+GSCIM LPG SM Y+PMQVR  F+M FSIVLLPFLWDTIDL
Sbjct: 1   MIASPEIIIMSLFLICCRIGSCIMFLPGFSMPYVPMQVRFFFSMTFSIVLLPFLWDTIDL 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q F +RAYY KLV+VELFLGCVHG+L+R+YT GLQF GSVISTAIGLNLQ+SMGISDS+ 
Sbjct: 61  QIFADRAYYLKLVIVELFLGCVHGVLVRIYTFGLQFMGSVISTAIGLNLQSSMGISDSIP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET  +SLIG IGLLALW+IDFHHQ+FYALVKSYGT PIG+EL+F NIFSS +N+LQ TF+
Sbjct: 121 ETSFSSLIGTIGLLALWIIDFHHQIFYALVKSYGTTPIGKELHFDNIFSSLINILQMTFI 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFLFFY+VFNISIG LNK+VPQIP+YFISTPY++GLG LFL  SIE+I+YQF 
Sbjct: 181 IMLRLSSPFLFFYVVFNISIGFLNKIVPQIPVYFISTPYMVGLGFLFLYSSIEMIIYQFI 240

Query: 241 HSF 243
           HSF
Sbjct: 241 HSF 243