BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein
FliR [Candidatus Liberibacter asiaticus str. psy62]
         (248 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040188|gb|ACT56984.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 248

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL
Sbjct: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA
Sbjct: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM
Sbjct: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS
Sbjct: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240

Query: 241 HSFLYGFF 248
           HSFLYGFF
Sbjct: 241 HSFLYGFF 248


>gi|315122292|ref|YP_004062781.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495694|gb|ADR52293.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 247

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 216/243 (88%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M  SPEII+MSLFLI CR+GSCIM LPG SM Y+PMQVR  F+M FSIVLLPFLWDTIDL
Sbjct: 1   MIASPEIIIMSLFLICCRIGSCIMFLPGFSMPYVPMQVRFFFSMTFSIVLLPFLWDTIDL 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q F +RAYY KLV+VELFLGCVHG+L+R+YT GLQF GSVISTAIGLNLQ+SMGISDS+ 
Sbjct: 61  QIFADRAYYLKLVIVELFLGCVHGVLVRIYTFGLQFMGSVISTAIGLNLQSSMGISDSIP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET  +SLIG IGLLALW+IDFHHQ+FYALVKSYGT PIG+EL+F NIFSS +N+LQ TF+
Sbjct: 121 ETSFSSLIGTIGLLALWIIDFHHQIFYALVKSYGTTPIGKELHFDNIFSSLINILQMTFI 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFLFFY+VFNISIG LNK+VPQIP+YFISTPY++GLG LFL  SIE+I+YQF 
Sbjct: 181 IMLRLSSPFLFFYVVFNISIGFLNKIVPQIPVYFISTPYMVGLGFLFLYSSIEMIIYQFI 240

Query: 241 HSF 243
           HSF
Sbjct: 241 HSF 243


>gi|222084893|ref|YP_002543422.1| flagellar byosinthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722341|gb|ACM25497.1| flagellar byosinthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 250

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 156/244 (63%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL  CR+G C+M+LPG S   +P Q+RL  A A S+ +LP LW+TI  
Sbjct: 1   MISDPQGTILALFLAFCRIGGCVMVLPGFSSGRVPPQIRLLLAAALSMAILPLLWNTIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +   + A Y  L+  E  +G ++G++ R+YTLGLQF G+VIS  IG N    M + +   
Sbjct: 61  EVSKSSATYISLIFTETVIGLMYGMMARLYTLGLQFAGTVISMLIGFNAPGGMDVIEDSN 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L SLI   GL+ L+V+DFHH V  ALV+SY  IP G  ++      S  + L TT  
Sbjct: 121 ETSLTSLISFCGLMILFVLDFHHYVLQALVESYSVIPFGGHVDVRASLISVTDTLATTTF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SPFL + ++F ISIG +NKL PQIPIYFISTPYL+  G   L LSI  ++ QFS
Sbjct: 181 IMLRLASPFLLYGLMFQISIGFINKLAPQIPIYFISTPYLLMGGLFMLYLSIAAMISQFS 240

Query: 241 HSFL 244
            +FL
Sbjct: 241 GAFL 244


>gi|209547954|ref|YP_002279871.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533710|gb|ACI53645.1| type III secretion system inner membrane R protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 250

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 161/247 (65%), Gaps = 8/247 (3%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A+A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIALALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L++ E  +G ++G+L R+YTLG+QF  ++I+T +G    T  G +D + 
Sbjct: 61  AVHTGSGTYIGLIVSESLIGVMYGMLARIYTLGMQFAATIIATMVGY---TQPGSADIIE 117

Query: 121 ETPLNSLIGII---GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
           +TP +SL G I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ 
Sbjct: 118 DTPESSLSGFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFSDTLEQ 177

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC-LSIEIIV 236
           T  IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL   SI  +V
Sbjct: 178 TTYIMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLVYFSIAALV 236

Query: 237 YQFSHSF 243
            QF  SF
Sbjct: 237 SQFGQSF 243


>gi|218681681|ref|ZP_03529482.1| flagellar biosynthesis protein FliR [Rhizobium etli CIAT 894]
          Length = 250

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 161/247 (65%), Gaps = 8/247 (3%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C+++LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLVLPGFSSARVPEQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++GLL R+YTLG+QF  ++++T +G    T  G +D + 
Sbjct: 61  AVHTGSPTYIGLIFSESLVGVMYGLLARIYTLGMQFAATILATMVGY---TQPGSADIIE 117

Query: 121 ETPLNSLIGII---GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
           +TP +SL G I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ 
Sbjct: 118 DTPESSLSGFITFAGIMILFMMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFTDTLEQ 177

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC-LSIEIIV 236
           T  IMLRL+SPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL   SI  +V
Sbjct: 178 TTYIMLRLASPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLIYFSIAAMV 236

Query: 237 YQFSHSF 243
            QFS SF
Sbjct: 237 SQFSQSF 243


>gi|116250508|ref|YP_766346.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255156|emb|CAK06230.1| putative flagellar biosynthetic protein FliR [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 250

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPQQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  S+ +  +G     S  I +   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAASITAMMVGYTQPGSADILEDTP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L++ I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ T  
Sbjct: 121 ETSLSAFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC-LSIEIIVYQF 239
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL   SI  +V QF
Sbjct: 181 IMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLIYFSIAAMVSQF 239

Query: 240 SHSF 243
             SF
Sbjct: 240 GQSF 243


>gi|86356338|ref|YP_468230.1| flagellar biosynthesis protein FliR [Rhizobium etli CFN 42]
 gi|86280440|gb|ABC89503.1| flagellar byosinthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 250

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C+++LPG S + +P Q+R+  A+A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLVLPGFSSARVPEQLRVFIALALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                 A Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  + +   
Sbjct: 61  AVHTGSATYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVIEDSP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L + I   G++ L+++DFHH VF AL+ SY T+P G          SF + L+ T  
Sbjct: 121 ETSLTAFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL-CLSIEIIVYQF 239
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL  +S+  +V QF
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLFYVSVAALVSQF 239

Query: 240 SHSF 243
             +F
Sbjct: 240 GQAF 243


>gi|241203132|ref|YP_002974228.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857022|gb|ACS54689.1| type III secretion system inner membrane R protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 250

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 157/247 (63%), Gaps = 8/247 (3%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPDQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G    T  G +D L 
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGY---TQPGSADILE 117

Query: 121 ETPLNSLIGII---GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
           +TP  SL G I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ 
Sbjct: 118 DTPETSLSGFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFTDTLEQ 177

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC-LSIEIIV 236
           T  IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL   SI  +V
Sbjct: 178 TTYIMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLIYFSIAAMV 236

Query: 237 YQFSHSF 243
            QF  SF
Sbjct: 237 SQFGQSF 243


>gi|218463239|ref|ZP_03503330.1| flagellar biosynthesis protein FliR [Rhizobium etli Kim 5]
          Length = 250

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI +LP LWDT+  
Sbjct: 1   MISDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIAVLPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  +++   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVTEDSP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L++ I   G++ L+++DFHH VF AL+ SY T+P G          SF + L+ T  
Sbjct: 121 ETSLSAFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL-CLSIEIIVYQF 239
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL  +S+  +V QF
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLFYVSVAALVSQF 239

Query: 240 SHSF 243
             +F
Sbjct: 240 GQAF 243


>gi|190890390|ref|YP_001976932.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695669|gb|ACE89754.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 250

 Score =  204 bits (519), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI L+P LWDT+  
Sbjct: 1   MIADPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIALMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  + +   
Sbjct: 61  AVHTGAGTYIGLIFSESLVGLMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVIEDAP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L+  I   G++ L+++DFHH VF ALV SY T+P G          SF + L+ T  
Sbjct: 121 ETSLSGFITFAGIMILFIMDFHHIVFRALVDSYTTMPFGGVTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL-CLSIEIIVYQF 239
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL  +S+  +V QF
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLFYVSVAALVSQF 239

Query: 240 SHSF 243
             +F
Sbjct: 240 GQAF 243


>gi|218662875|ref|ZP_03518805.1| flagellar biosynthesis protein FliR [Rhizobium etli IE4771]
          Length = 250

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MISDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  + +   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVIEDSP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L++ I   G++ L+++DFHH VF AL+ SY T+P G          SF + L+ T  
Sbjct: 121 ETSLSAFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL-CLSIEIIVYQF 239
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+ +G LFL  +S+  +V QF
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLL-MGGLFLFYVSVAALVSQF 239

Query: 240 SHSF 243
             +F
Sbjct: 240 GQAF 243


>gi|222147597|ref|YP_002548554.1| flagellar biosynthesis protein FliR [Agrobacterium vitis S4]
 gi|221734585|gb|ACM35548.1| flagellar biosynthetic protein FLIR [Agrobacterium vitis S4]
          Length = 250

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 156/244 (63%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+GSC M +PG + S IP Q+RL  A+A S+   P +WDT+  
Sbjct: 1   MITDPQGSVLALFLVFCRIGSCFMTMPGFASSRIPTQIRLLLAVAVSMACTPLVWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +     + +  L+  E  +G V GL+ R +TLGLQF G++++  IG N   +  + +  A
Sbjct: 61  KVSSGGSIFVALIFTETLIGAVFGLITRFFTLGLQFAGAILTMMIGFNSTATADVLEDGA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  + ++I   GL+ L+++DFHH VF AL+ SY  +P+G   +   +  +  +    T+M
Sbjct: 121 ENQMTNMISFCGLMMLFMMDFHHVVFRALIDSYTVMPMGGVPDTQKMLITLTDTASRTYM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +MLRLSSPF+ + ++FN+ +GL+NKL PQIP+Y+ISTPYLI  G L +  SI +++ QF+
Sbjct: 181 LMLRLSSPFIIYGLMFNLGVGLVNKLAPQIPVYYISTPYLITGGMLLVYWSIGVMMRQFA 240

Query: 241 HSFL 244
            +F+
Sbjct: 241 DAFI 244


>gi|15964440|ref|NP_384793.1| flagellar biosynthesis protein FliR [Sinorhizobium meliloti 1021]
 gi|307311582|ref|ZP_07591223.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti BL225C]
 gi|15073617|emb|CAC45259.1| Probable flagellar biosynthetic transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306899599|gb|EFN30228.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti BL225C]
          Length = 250

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 152/244 (62%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE ++++LF   CR+G C+M++PG S + +PMQ+RL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGMVLALFAAFCRIGGCVMIMPGFSTARVPMQIRLFIAVALSMAILPIMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  LV  E  +G V GL+ R Y LGLQF G+ I+  +G     +  + +  A
Sbjct: 61  QVTGKGHDYLYLVATETAIGAVIGLVARYYVLGLQFAGTAITMLMGFGSPPAADVLEDTA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L S+IG  GL+ L+++DFHH +F A+ +SY  +PIG   +      +  N L  TFM
Sbjct: 121 ENQLTSMIGFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGTLITLTNSLGQTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC-LSIEIIVYQF 239
           IMLRL+SPF+ + ++FN++IG++NKL PQIP+YFIS PYLI +G LFL  L I  ++  F
Sbjct: 181 IMLRLASPFVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLI-MGGLFLLYLGIAAMLRLF 239

Query: 240 SHSF 243
           +  F
Sbjct: 240 ADGF 243


>gi|307318937|ref|ZP_07598368.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti AK83]
 gi|306895351|gb|EFN26106.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti AK83]
          Length = 250

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 151/244 (61%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G C+M++PG S + +PMQ+RL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGTVLALFAAFCRIGGCVMIMPGFSTARVPMQIRLFIAVALSMAILPIMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  LV  E  +G V GL+ R Y LGLQF G+ I+  +G     +  + +  A
Sbjct: 61  QVTGKGHDYLYLVATETAVGAVIGLVARYYVLGLQFAGTAITMLMGFGSPPAADVLEDTA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L S+IG  GL+ L+++DFHH +F A+ +SY  +PIG   +      +  N L  TFM
Sbjct: 121 ENQLTSMIGFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGTLITLTNSLGQTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC-LSIEIIVYQF 239
           IMLRL+SPF+ + ++FN++IG++NKL PQIP+YFIS PYLI +G LFL  L I  ++  F
Sbjct: 181 IMLRLASPFVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLI-MGGLFLLYLGIAAMLRLF 239

Query: 240 SHSF 243
           +  F
Sbjct: 240 ADGF 243


>gi|325291970|ref|YP_004277834.1| flagellar biosynthesis protein FliR [Agrobacterium sp. H13-3]
 gi|325059823|gb|ADY63514.1| flagellar biosynthesis protein FliR [Agrobacterium sp. H13-3]
          Length = 251

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 156/244 (63%), Gaps = 1/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL +CR+G+C M +PG S S I  Q+R+   +A S+ LLP LWDTI  
Sbjct: 1   MITDPQGTIIALFLAICRIGACFMTMPGFSSSRISPQIRILLCVAVSMALLPVLWDTIYP 60

Query: 61  Q-NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           + +  ++     L+  E+ +G ++GL+ R YTLG QFTG++I  +IGL+        + +
Sbjct: 61  KVSGASQGAVVGLIFTEIVIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGADAVEDV 120

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
            E  +++ I   GL+ L+++DFHH V  ALV SY T P+G  ++   +  +  + L+ +F
Sbjct: 121 QENQISNFITFGGLMVLFILDFHHIVLRALVDSYATTPVGALISGQKMLITLTDTLRASF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            IMLRL+SPF+ + ++FN+++GL+NKL PQIP+YFISTP+++  G   L LSI  ++ QF
Sbjct: 181 SIMLRLASPFVIYGLMFNVAVGLINKLAPQIPVYFISTPFVLAGGIFMLYLSIAALIRQF 240

Query: 240 SHSF 243
              F
Sbjct: 241 VDGF 244


>gi|150395511|ref|YP_001325978.1| flagellar biosynthesis protein FliR [Sinorhizobium medicae WSM419]
 gi|150027026|gb|ABR59143.1| flagellar biosynthetic protein FliR [Sinorhizobium medicae WSM419]
          Length = 250

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 149/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G CIM++PG S + +PMQ+RL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQIRLFVAVAISMAILPVMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  LV  E  +G V GL+ R Y LGLQF G+ ++  +G +   +  + +  A
Sbjct: 61  QVTGKGHDYLYLVATETAVGAVIGLVARYYVLGLQFAGTAMTMMMGFSPPPTADVLEDTA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L SLI   GL+ L+++DFHH +F A+ +SY  +PIG   +   +  +  N L+ TFM
Sbjct: 121 ENQLTSLISFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGMLITLTNSLEQTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SP + + ++FN++IG++NKL PQIP+YFIS PYLI  G   L L I  ++  F+
Sbjct: 181 IMLRLASPLVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLIMGGLFLLYLGIAAMLRLFA 240

Query: 241 HSF 243
             F
Sbjct: 241 DGF 243


>gi|227820883|ref|YP_002824853.1| flagellar biosynthesis protein FliR [Sinorhizobium fredii NGR234]
 gi|227339882|gb|ACP24100.1| flagellar biosynthesis protein FliR [Sinorhizobium fredii NGR234]
          Length = 250

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 137/218 (62%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G CIM++PG S + +PMQVRL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQVRLFIAVALSMAILPIMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  L+  E  +G V GL+ R Y LGLQF G+ I+  IG N   +  + +  A
Sbjct: 61  QVAGKGHTYIYLIATESVIGAVIGLVARYYVLGLQFAGTAITMLIGFNPPPATDVLEETA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L S+I   GL+ L+++DFHH +F A+ +SY  +PIG   +   +  +  N L  TF+
Sbjct: 121 ENQLTSMISFAGLMLLFMLDFHHVIFEAIAQSYRVMPIGIGFDPQGMLITLTNSLGQTFL 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           IMLRL+SPF+ + ++FN++IG++N+L PQ+P+YFIS P
Sbjct: 181 IMLRLASPFVIYGLLFNVAIGMVNRLAPQVPVYFISQP 218


>gi|159184373|ref|NP_353608.2| flagellar biosynthesis protein FliR [Agrobacterium tumefaciens str.
           C58]
 gi|159139686|gb|AAK86393.2| flagellar biosynthetic protein FLIR [Agrobacterium tumefaciens str.
           C58]
          Length = 240

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 148/233 (63%), Gaps = 1/233 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ-NFVNRAYYS 70
           +FL +CR+G+C M +PG S S I  Q+R+   +A S+ LLP LWDTI  + +  ++    
Sbjct: 1   MFLAICRIGACFMTMPGFSSSRISPQIRMLLCVAVSMALLPVLWDTIYPKVSGASQGAVV 60

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+  E+ +G ++GL+ R YTLG QFTG++I  +IGL+        + + E  + + I  
Sbjct: 61  GLIFSEVLIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGADPIEDVQENQIANFITF 120

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            GLL L+++DFHH V  ALV SY   P+G  ++   +  +  + L+ +F IMLRL+SPF+
Sbjct: 121 GGLLVLFMMDFHHIVLKALVDSYSATPVGALISGQKMLITLTDTLRASFSIMLRLASPFV 180

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            + ++FN+++GL+NKL PQIP++FISTP+++  G   L LS+  ++ QF   F
Sbjct: 181 IYGLMFNVAVGLINKLAPQIPVFFISTPFVLAGGLFMLYLSVAALIRQFVDGF 233


>gi|163758040|ref|ZP_02165128.1| flagellar biosynthesis protein R [Hoeflea phototrophica DFL-43]
 gi|162284329|gb|EDQ34612.1| flagellar biosynthesis protein R [Hoeflea phototrophica DFL-43]
          Length = 251

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 130/218 (59%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G CIM+LPG S   +P+Q+RL  A+A S+ LLP LW+T+  
Sbjct: 1   MMSDPEGTILALFAAFCRIGGCIMVLPGFSSFRVPVQIRLFIAVAISMALLPMLWETLYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  EL +G   GL+ R   L LQF G+ +S AIG N     G+ ++  
Sbjct: 61  NVQTGGGIYIGLIGTELLIGVTFGLIARYIVLALQFAGTGLSMAIGFNAAPGGGLLETEQ 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  + SLI    +L L++ DFHH V  AL++SY  +P+G   +      +  + L   FM
Sbjct: 121 EGNITSLITFTAVLLLFLSDFHHMVIEALLRSYDFMPLGSGFDPQMALMTLTDTLAGAFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           ++LRL+SPFL + + FN+SIGL+NKL P IP+YFI+ P
Sbjct: 181 LVLRLASPFLVYSMAFNLSIGLINKLAPAIPVYFITIP 218


>gi|110632632|ref|YP_672840.1| flagellar biosynthesis protein FliR [Mesorhizobium sp. BNC1]
 gi|110283616|gb|ABG61675.1| flagellar biosynthetic protein FliR [Chelativorans sp. BNC1]
          Length = 248

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 133/240 (55%), Gaps = 1/240 (0%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
           PE  +++ FL  CRVG+C ML+PGL  + +PMQVRL  A+  S+ LL  LWD I      
Sbjct: 2   PETAILAAFLAFCRVGACFMLMPGLGSARVPMQVRLFVAVGASLALLAHLWDVIAPHASD 61

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTS-MGISDSLAETP 123
                  L+  E+ +G + GL+ R+Y L LQF GS I+   G  +    + I ++  +  
Sbjct: 62  RPDILLLLIGSEILIGSLIGLVARLYVLALQFIGSAIALMTGFGMAAGGVAIEENEPQPA 121

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           + +LI    L+ L+V++FHH +  ALV SY   PI    +     +   + L   F +M+
Sbjct: 122 VAALISFSALMLLFVLNFHHAIIEALVASYRLAPIEALFDPRAALTDIADTLSEAFFVMI 181

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           RL SPF+ + I+ N++ G +NKL PQIPIYFIS P++I  G L L   I   +  F+  F
Sbjct: 182 RLGSPFVAYAILINLAFGFINKLTPQIPIYFISLPFVIAGGLLLLYFGIGTFLSLFADGF 241


>gi|13472611|ref|NP_104178.1| flagellar biosynthesis protein FliR [Mesorhizobium loti MAFF303099]
 gi|14023357|dbj|BAB49964.1| flagellar biosynthesis protein; FliR [Mesorhizobium loti
           MAFF303099]
          Length = 250

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 136/244 (55%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++  + ++++ FL  CR+G+C ML+PGLS + +P+QVRL  A+A +  LL FLWD I  
Sbjct: 1   MSVLSQSVVIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDRIIP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ EL +G + G + R+Y   L+F GS I+  IG        I +   
Sbjct: 61  FVDPRPQILVPMIISELLIGGLIGAMTRLYMEALRFMGSAIAMLIGYGGSGGPAIEEPEP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L ++I    LL L+V DF H++  ALV SY   P+    N         + +  TF 
Sbjct: 121 QAALAAIISFSALLMLFVFDFDHEIVRALVASYTVAPVNVFFNPQAALVDITDTVSDTFF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +++RL SPF+ + I+ N++IG +NKL PQIPIYFIS P++I  G +    +I  ++  F 
Sbjct: 181 LVIRLGSPFVAYAILVNLTIGFVNKLTPQIPIYFISQPFVIAGGMIIFYFAIGTMLSLFV 240

Query: 241 HSFL 244
             F+
Sbjct: 241 DGFV 244


>gi|319781654|ref|YP_004141130.1| flagellar biosynthetic protein FliR [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167542|gb|ADV11080.1| flagellar biosynthetic protein FliR [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 250

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 136/244 (55%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++  + ++++ FL  CR+G+C ML+PGLS + +P+QVRL  A+A +  LL FLWD I  
Sbjct: 1   MSVLSQGVVIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDKIFP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ EL +G + G + R+Y   L+F GS I+  +G        I +   
Sbjct: 61  FVDPRPQILVPMIISELLVGGLIGAMTRLYMEALRFMGSAIAMLVGYGGTGGPAIEEPEP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L ++I    LL L+V DF H++  ALV SY   P+    N         + +  TF 
Sbjct: 121 QAALAAIISFSALLMLFVFDFDHEIIRALVSSYTVAPVNIFFNPQAALVDVTDTVSDTFF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +++RL SPF+ + I+ N++IG +NKL PQIPIYFIS P++I  G +    ++  ++  F 
Sbjct: 181 LVIRLGSPFVAYAILVNLTIGFVNKLTPQIPIYFISQPFIIAGGMIIFYFAVGTMLSLFV 240

Query: 241 HSFL 244
             F+
Sbjct: 241 DGFV 244


>gi|260466592|ref|ZP_05812780.1| flagellar biosynthetic protein FliR [Mesorhizobium opportunistum
           WSM2075]
 gi|259029598|gb|EEW30886.1| flagellar biosynthetic protein FliR [Mesorhizobium opportunistum
           WSM2075]
          Length = 250

 Score =  147 bits (372), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 136/244 (55%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++  + ++++ FL  CR+G+C ML+PGLS + +P+QVRL  A+A +  LL FLWD I  
Sbjct: 1   MSVLSQSVVIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDKIFP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ EL +G + G + R+Y   L+F GS I+  IG        I +   
Sbjct: 61  FVDARPQILVPMIISELLVGGLIGAMTRLYMEALRFMGSAIAMLIGYGGSGGPAIEEPEP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L ++I    LL L+V DF H++  ALV SY   P+    N         + +  TF 
Sbjct: 121 QAALAAIISFSALLMLFVFDFDHEIIRALVTSYTVAPVNIFFNPQAALVDVADTVSDTFF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +++RL SPF+ + ++ N++IG +NKL PQIPIYFIS P++I  G +    +I  ++  F 
Sbjct: 181 LVIRLGSPFVAYALLVNLTIGFVNKLTPQIPIYFISQPFVIVGGMIIFYFAIGTMLSLFV 240

Query: 241 HSFL 244
             F+
Sbjct: 241 DGFV 244


>gi|90418351|ref|ZP_01226263.1| putative flagellar biosynthesis protein FliR [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90338023|gb|EAS51674.1| putative flagellar biosynthesis protein FliR [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 251

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 139/246 (56%), Gaps = 5/246 (2%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++    ++ SLFLI CR GSC++L+PG S S +P+QVRL  ++A S+ L P L  T  L
Sbjct: 1   MSVELSELVFSLFLIFCRFGSCLLLMPGFSSSRVPLQVRLFLSLAVSVALSPALLPT--L 58

Query: 61  QNFVNRAYYS---KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD 117
           Q  V  A  +    L++ E+  G   GLL R + + LQF G V++ +IG+ +Q  + I +
Sbjct: 59  QPLVAAADDNGKLALMISEILNGLFIGLLGRSFMIALQFAGHVVANSIGMGMQMGVPIDE 118

Query: 118 SLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
           S     + SLI +     ++V++ H ++  ALV SY  +P     +      +  + L  
Sbjct: 119 SDPMPAVASLITLTATTLIFVLNLHAEIARALVASYTAMPAAAGFSIRGSLVNITDNLDE 178

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
            F++ LR+SSPF+ + +V N +IGL NKL P IPIYFIS P+++  G + L  +I   + 
Sbjct: 179 AFLLCLRISSPFVLYGVVVNFAIGLANKLTPTIPIYFISLPFVLAGGLVLLGYTISDFLI 238

Query: 238 QFSHSF 243
            F   F
Sbjct: 239 LFMQDF 244


>gi|239834419|ref|ZP_04682747.1| flagellar biosynthetic protein FliR [Ochrobactrum intermedium LMG
           3301]
 gi|239822482|gb|EEQ94051.1| flagellar biosynthetic protein FliR [Ochrobactrum intermedium LMG
           3301]
          Length = 255

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 131/220 (59%), Gaps = 2/220 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPF-LWDTIDLQNFV 64
           EII+ ++ L  CR+G+C+ML+PGLS + IP+QVRL  A+A S  +LP  L   I + +  
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGLSSARIPLQVRLFIALACSFAVLPLVLQRIITVVDAG 68

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                 +L+  E+F+G V G+L  +Y   LQF  S ++ +IG +   +  I++S  +  L
Sbjct: 69  QPLTLFRLMASEIFIGAVIGILAHIYFWALQFMASTMAVSIGYSGSPADAITESEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   ++ D H ++F AL+ SY  IP+  +     +   F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFITDMHLEIFRALLNSYVAIPVDGQFRPDAVMIDFTDALSGAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +++PF+ F I+ N +IGL+NKL P IP+YF+S P+++G G
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPTIPVYFVSMPFVLGGG 228


>gi|153011500|ref|YP_001372714.1| flagellar biosynthesis protein FliR [Ochrobactrum anthropi ATCC
           49188]
 gi|151563388|gb|ABS16885.1| flagellar biosynthetic protein FliR [Ochrobactrum anthropi ATCC
           49188]
          Length = 255

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 130/220 (59%), Gaps = 2/220 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PGLS + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGLSSARIPLQVRLYIALACSFAVLPLVLQRIVTVVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L+  E+F+G V G+L  +Y   LQF  S ++ ++G +   +  I++S  +  L
Sbjct: 69  QPWTLFRLMASEMFVGAVIGILAHIYFWALQFMASTMAVSVGYSGSPADAITESEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   ++ D H ++F AL+ SY  IP+  +         F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFITDMHLEIFRALLNSYVAIPVDGQFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +++PF+ F I+ N +IGL+NKL P IP+YF+S P+++G G
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPTIPVYFVSMPFVLGGG 228


>gi|256059812|ref|ZP_05450007.1| flagellar biosynthesis protein FliR [Brucella neotomae 5K33]
 gi|261323792|ref|ZP_05962989.1| flagellar biosynthetic protein FliR [Brucella neotomae 5K33]
 gi|261299772|gb|EEY03269.1| flagellar biosynthetic protein FliR [Brucella neotomae 5K33]
          Length = 255

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 140/238 (58%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY TIP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVTIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|158422279|ref|YP_001523571.1| flagellar biosynthesis protein FliR [Azorhizobium caulinodans ORS
           571]
 gi|158329168|dbj|BAF86653.1| type III secretion system inner membrane R protein [Azorhizobium
           caulinodans ORS 571]
          Length = 249

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 132/218 (60%), Gaps = 8/218 (3%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           ++ ++S FL+ CR+GSCIM++PGLS   +P++VRL  A+A S+ +LP ++D  DL NF+ 
Sbjct: 5   DVSILSAFLVFCRIGSCIMMMPGLSGYRLPVRVRLLLAVAVSLAILPLMYD--DLVNFIR 62

Query: 66  RAYYSKLVM---VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            A  ++L++    E+  G + G L R++ L LQ     I+  IGL+  + MG+ +     
Sbjct: 63  NANSAQLLLSIGTEMATGAIIGTLARIFYLMLQMMLVAIAQFIGLS--SPMGLPEDGEVL 120

Query: 123 P-LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
           P L +L+ +     +++ D H+++   L+ SY  IP+G             + L    MI
Sbjct: 121 PSLATLMILAATTMMFLTDQHYEMLRGLIASYRQIPVGVGFGGRGALIQASDQLSAALMI 180

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY 219
            +RL+SPFL + ++ N ++GL+NKLVPQIP+YFIS P+
Sbjct: 181 AMRLASPFLIYSLIINFAVGLINKLVPQIPVYFISAPF 218


>gi|23500846|ref|NP_700286.1| flagellar biosynthesis protein FliR [Brucella suis 1330]
 gi|161621174|ref|YP_001595060.1| flagellar biosynthesis protein FliR [Brucella canis ATCC 23365]
 gi|254699255|ref|ZP_05161083.1| flagellar biosynthesis protein FliR [Brucella suis bv. 5 str. 513]
 gi|254702375|ref|ZP_05164203.1| flagellar biosynthesis protein FliR [Brucella suis bv. 3 str. 686]
 gi|254711811|ref|ZP_05173622.1| flagellar biosynthesis protein FliR [Brucella ceti M644/93/1]
 gi|254714879|ref|ZP_05176690.1| flagellar biosynthesis protein FliR [Brucella ceti M13/05/1]
 gi|256015890|ref|YP_003105899.1| flagellar biosynthesis protein FliR [Brucella microti CCM 4915]
 gi|260568722|ref|ZP_05839191.1| flagellar biosynthesis protein FliR [Brucella suis bv. 4 str. 40]
 gi|261216568|ref|ZP_05930849.1| flagellar biosynthetic protein FliR [Brucella ceti M13/05/1]
 gi|261319439|ref|ZP_05958636.1| flagellar biosynthetic protein FliR [Brucella ceti M644/93/1]
 gi|261749694|ref|ZP_05993403.1| flagellar biosynthetic protein FliR [Brucella suis bv. 5 str. 513]
 gi|261752938|ref|ZP_05996647.1| flagellar biosynthetic protein FliR [Brucella suis bv. 3 str. 686]
 gi|23464510|gb|AAN34291.1| flagellar biosynthesis protein FliR, putative [Brucella suis 1330]
 gi|161337985|gb|ABX64289.1| flagellar biosynthetic protein FliR [Brucella canis ATCC 23365]
 gi|255998550|gb|ACU50237.1| flagellar biosynthesis protein FliR [Brucella microti CCM 4915]
 gi|260155387|gb|EEW90468.1| flagellar biosynthesis protein FliR [Brucella suis bv. 4 str. 40]
 gi|260921657|gb|EEX88225.1| flagellar biosynthetic protein FliR [Brucella ceti M13/05/1]
 gi|261292129|gb|EEX95625.1| flagellar biosynthetic protein FliR [Brucella ceti M644/93/1]
 gi|261739447|gb|EEY27373.1| flagellar biosynthetic protein FliR [Brucella suis bv. 5 str. 513]
 gi|261742691|gb|EEY30617.1| flagellar biosynthetic protein FliR [Brucella suis bv. 3 str. 686]
          Length = 255

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 139/238 (58%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|225628421|ref|ZP_03786455.1| flagellar biosynthetic protein FliR [Brucella ceti str. Cudo]
 gi|254711211|ref|ZP_05173022.1| flagellar biosynthesis protein FliR [Brucella pinnipedialis B2/94]
 gi|256030160|ref|ZP_05443774.1| flagellar biosynthesis protein FliR [Brucella pinnipedialis
           M292/94/1]
 gi|256158339|ref|ZP_05456243.1| flagellar biosynthesis protein FliR [Brucella ceti M490/95/1]
 gi|256252727|ref|ZP_05458263.1| flagellar biosynthesis protein FliR [Brucella ceti B1/94]
 gi|260166788|ref|ZP_05753599.1| flagellar biosynthesis protein FliR [Brucella sp. F5/99]
 gi|261219805|ref|ZP_05934086.1| flagellar biosynthetic protein FliR [Brucella ceti B1/94]
 gi|261318802|ref|ZP_05957999.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis B2/94]
 gi|261756165|ref|ZP_05999874.1| flagellar biosynthesis protein FliR [Brucella sp. F5/99]
 gi|265987191|ref|ZP_06099748.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis
           M292/94/1]
 gi|265996854|ref|ZP_06109411.1| flagellar biosynthetic protein FliR [Brucella ceti M490/95/1]
 gi|225616267|gb|EEH13315.1| flagellar biosynthetic protein FliR [Brucella ceti str. Cudo]
 gi|260918389|gb|EEX85042.1| flagellar biosynthetic protein FliR [Brucella ceti B1/94]
 gi|261298025|gb|EEY01522.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis B2/94]
 gi|261736149|gb|EEY24145.1| flagellar biosynthesis protein FliR [Brucella sp. F5/99]
 gi|262551151|gb|EEZ07312.1| flagellar biosynthetic protein FliR [Brucella ceti M490/95/1]
 gi|264659388|gb|EEZ29649.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis
           M292/94/1]
          Length = 255

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 139/238 (58%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|306845411|ref|ZP_07477985.1| flagellar biosynthetic protein FliR [Brucella sp. BO1]
 gi|306274154|gb|EFM55970.1| flagellar biosynthetic protein FliR [Brucella sp. BO1]
          Length = 255

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 138/238 (57%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L+  E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMAGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|254720780|ref|ZP_05182591.1| flagellar biosynthesis protein FliR [Brucella sp. 83/13]
 gi|265985839|ref|ZP_06098574.1| flagellar biosynthetic protein FliR [Brucella sp. 83/13]
 gi|306840129|ref|ZP_07472914.1| flagellar biosynthetic protein FliR [Brucella sp. NF 2653]
 gi|264664431|gb|EEZ34692.1| flagellar biosynthetic protein FliR [Brucella sp. 83/13]
 gi|306404774|gb|EFM61068.1| flagellar biosynthetic protein FliR [Brucella sp. NF 2653]
          Length = 255

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 139/238 (58%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  ++++  +  L
Sbjct: 69  QPWMLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSVTENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|261313959|ref|ZP_05953156.1| LOW QUALITY PROTEIN: flagellar biosynthetic protein FliR [Brucella
           pinnipedialis M163/99/10]
 gi|261302985|gb|EEY06482.1| LOW QUALITY PROTEIN: flagellar biosynthetic protein FliR [Brucella
           pinnipedialis M163/99/10]
          Length = 255

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 131/220 (59%), Gaps = 2/220 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGEG 228


>gi|294852959|ref|ZP_06793631.1| flagellar biosynthetic protein FliR [Brucella sp. NVSL 07-0026]
 gi|294818614|gb|EFG35614.1| flagellar biosynthetic protein FliR [Brucella sp. NVSL 07-0026]
          Length = 245

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 130/218 (59%), Gaps = 2/218 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIG 222
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLG 226


>gi|62317950|ref|YP_223803.1| flagellar biosynthesis protein FliR [Brucella abortus bv. 1 str.
           9-941]
 gi|83269927|ref|YP_419218.1| flagellar biosynthesis protein FliR [Brucella melitensis biovar
           Abortus 2308]
 gi|189023201|ref|YP_001932942.1| flagellar biosynthesis protein FliR [Brucella abortus S19]
 gi|237817495|ref|ZP_04596486.1| flagellar biosynthetic protein FliR [Brucella abortus str. 2308 A]
 gi|254691620|ref|ZP_05154874.1| flagellar biosynthesis protein FliR [Brucella abortus bv. 6 str.
           870]
 gi|254695084|ref|ZP_05156912.1| flagellar biosynthesis protein FliR [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698181|ref|ZP_05160009.1| flagellar biosynthesis protein FliR [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731626|ref|ZP_05190204.1| flagellar biosynthesis protein FliR [Brucella abortus bv. 4 str.
           292]
 gi|256256807|ref|ZP_05462343.1| flagellar biosynthesis protein FliR [Brucella abortus bv. 9 str.
           C68]
 gi|260544134|ref|ZP_05819955.1| flagellar biosynthesis protein FliR [Brucella abortus NCTC 8038]
 gi|260757250|ref|ZP_05869598.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 6 str.
           870]
 gi|260759385|ref|ZP_05871733.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 4 str.
           292]
 gi|260762628|ref|ZP_05874960.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883054|ref|ZP_05894668.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 9 str.
           C68]
 gi|261215436|ref|ZP_05929717.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 3 str.
           Tulya]
 gi|297250158|ref|ZP_06933859.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 5 str.
           B3196]
 gi|62198143|gb|AAX76442.1| hypothetical FliR, flagellar biosynthesis protein [Brucella abortus
           bv. 1 str. 9-941]
 gi|82940201|emb|CAJ13254.1| Bacterial export protein, family 1:Flagellar biosynthesis protein
           FliR [Brucella melitensis biovar Abortus 2308]
 gi|189021775|gb|ACD74496.1| Flagellar biosynthesis protein FliR [Brucella abortus S19]
 gi|237787330|gb|EEP61547.1| flagellar biosynthetic protein FliR [Brucella abortus str. 2308 A]
 gi|260097405|gb|EEW81279.1| flagellar biosynthesis protein FliR [Brucella abortus NCTC 8038]
 gi|260669703|gb|EEX56643.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 4 str.
           292]
 gi|260673049|gb|EEX59870.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677358|gb|EEX64179.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 6 str.
           870]
 gi|260872582|gb|EEX79651.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 9 str.
           C68]
 gi|260917043|gb|EEX83904.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174027|gb|EFH33391.1| flagellar biosynthetic protein FliR [Brucella abortus bv. 5 str.
           B3196]
          Length = 255

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 138/238 (57%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QV L  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVCLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|17988512|ref|NP_541145.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 1 str.
           16M]
 gi|225686878|ref|YP_002734850.1| flagellar biosynthesis protein FliR [Brucella melitensis ATCC
           23457]
 gi|256261987|ref|ZP_05464519.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 2 str.
           63/9]
 gi|17984304|gb|AAL53409.1| flagellar biosynthetic protein flir [Brucella melitensis bv. 1 str.
           16M]
 gi|225642983|gb|ACO02896.1| flagellar biosynthetic protein FliR [Brucella melitensis ATCC
           23457]
 gi|263091471|gb|EEZ16007.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 2 str.
           63/9]
 gi|326411294|gb|ADZ68358.1| flagellar biosynthesis protein FliR [Brucella melitensis M28]
 gi|326554583|gb|ADZ89222.1| flagellar biosynthesis protein FliR [Brucella melitensis M5-90]
          Length = 255

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 138/238 (57%), Gaps = 2/238 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQNFV 64
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  VLL  L   +   +  
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLLLVLQRIVTAVDAG 68

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                 +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|254503465|ref|ZP_05115616.1| Bacterial export protein, family 1 [Labrenzia alexandrii DFL-11]
 gi|222439536|gb|EEE46215.1| Bacterial export protein, family 1 [Labrenzia alexandrii DFL-11]
          Length = 258

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 133/243 (54%), Gaps = 7/243 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++++ FL+ CR+G+C+M++PG   + IPM+VRL  A   S+ L P L   I  Q   + A
Sbjct: 15  LVLATFLLFCRIGACLMVIPGFGSNRIPMRVRLFVAFGISLALSPLLVPDIQ-QALPDEA 73

Query: 68  --YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
               S  +  EL  G   G L R++   L+   +++S AIGL+    M I    A  P+ 
Sbjct: 74  LGTVSFFIGAELLTGLFIGFLGRIFIAALETLTTLVSMAIGLSNMPGMPIDGVDALPPVA 133

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +L  +     +++ D H ++   LV+SY  IP G+ L        F   L  TF++ LR+
Sbjct: 134 NLFTLTATAMIFIADQHWEILRGLVQSYEVIPPGRPLAAMASLEQFAEQLARTFVLALRV 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            SPF+ + IV N+++GL+NKL PQIP+YFIS P++I  G  FL L    +  +    FL 
Sbjct: 194 VSPFIVYTIVVNLAVGLINKLTPQIPVYFISLPFVIAGGLYFLYL----VAAEAIMIFLD 249

Query: 246 GFF 248
           G+F
Sbjct: 250 GYF 252


>gi|256112184|ref|ZP_05453105.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 3 str.
           Ether]
 gi|265993611|ref|ZP_06106168.1| flagellar biosynthetic protein FliR [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764481|gb|EEZ10513.1| flagellar biosynthetic protein FliR [Brucella melitensis bv. 3 str.
           Ether]
          Length = 255

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 129/220 (58%), Gaps = 2/220 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQNFV 64
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  VLL  L   +   +  
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLLLVLQRIVTAVDAG 68

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                 +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F   LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFPATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGG 228


>gi|118589958|ref|ZP_01547362.1| flagellar biosynthesis protein [Stappia aggregata IAM 12614]
 gi|118437455|gb|EAV44092.1| flagellar biosynthesis protein [Stappia aggregata IAM 12614]
          Length = 258

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 132/242 (54%), Gaps = 5/242 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR- 66
           +++++FL+ CR+G+C+M++PG   + +P+ VRL  A++ ++ L P L   +       + 
Sbjct: 15  LLLAVFLLFCRIGACLMVIPGFGSNRVPVHVRLFIALSVALALSPLLAPGVQASLPDEQL 74

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
              +  +  EL  G   G L R++   L+   +++S AIGL+    M I    +  P+ +
Sbjct: 75  GTVAGFIGAELLTGAFIGFLGRIFLAALETLTTLVSMAIGLSNMPGMPIDGVDSLPPVAN 134

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  +     +++ + H ++   L  SY  IP+GQ L        F   L  TF++ LR+ 
Sbjct: 135 LFTVTATAMVFITNQHWEILRGLAASYEAIPVGQPLAAVTGLEQFAEQLAKTFLLALRVC 194

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           SPF+ + +V N ++GL+NKL PQIP+YFIS P++I  G  FL L    ++ +    FL G
Sbjct: 195 SPFIVYTVVVNFAVGLVNKLTPQIPVYFISMPFVIAGGLYFLYL----VIAEAIMIFLDG 250

Query: 247 FF 248
           +F
Sbjct: 251 YF 252


>gi|148558044|ref|YP_001257996.1| flagellar biosynthesis protein FliR [Brucella ovis ATCC 25840]
 gi|148369329|gb|ABQ62201.1| flagellar biosynthetic protein FliR [Brucella ovis ATCC 25840]
          Length = 239

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 123/211 (58%), Gaps = 2/211 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ ++ L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +   I       
Sbjct: 10  EIILAAV-LAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAG 68

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           + +   +L++ E+F+G + G+L  +Y    QF  ++++ A+G +   +  I+++  +  L
Sbjct: 69  QPWTLFRLMVGEMFIGALIGILAHIYFWAQQFMANMMAMAVGYSGSPADSITENEPQATL 128

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR
Sbjct: 129 ATIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLR 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFI 215
           +++PF+ F I+ N +IGL+NKL P IP+YFI
Sbjct: 189 IAAPFIVFAILVNFAIGLVNKLTPAIPVYFI 219


>gi|121602553|ref|YP_989418.1| flagellar biosynthesis protein FliR [Bartonella bacilliformis
           KC583]
 gi|120614730|gb|ABM45331.1| flagellar biosynthetic protein FliR [Bartonella bacilliformis
           KC583]
          Length = 265

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 125/216 (57%), Gaps = 2/216 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-DLQNFVNRAYYSKL 72
           L+  RVG+C+ML+PG+S   IP+QVRL  A++FS+++LP + D   D     + A + + 
Sbjct: 27  LVFARVGACLMLMPGVSSIRIPVQVRLFIAVSFSLIILPMVADFFKDFGEKPDFALFVRA 86

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G   G++  VY   LQF  ++I+ ++G + Q    + DS  ET +  L+ ++G
Sbjct: 87  LCSEMLIGVTFGVIAHVYLWALQFMATIIAMSMGYSGQPGHNVIDSTPETQIAHLLVLVG 146

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++  +  D H      L+ SY  +      N       + + L   F+  LR+++PF+ +
Sbjct: 147 VMLFFASDLHMFAIRGLLASYDVVSPVFIPNPEAALIDYRDALSKAFLTTLRIAAPFIVY 206

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
            ++ NI++GL+NKL P IP+YFIS P+++  G LFL
Sbjct: 207 AVLVNIAVGLVNKLTPNIPVYFISLPFVVA-GGLFL 241


>gi|328545480|ref|YP_004305589.1| Bacterial export protein, family 1 [polymorphum gilvum SL003B-26A1]
 gi|326415221|gb|ADZ72284.1| Bacterial export protein, family 1 [Polymorphum gilvum SL003B-26A1]
          Length = 258

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 137/230 (59%), Gaps = 2/230 (0%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-DLQN 62
            P+ ++ + FL+ CR+G+C+M++PG S   I +++RL  A+A ++ L P L   + +   
Sbjct: 12  GPQAVLAT-FLLFCRIGACLMVIPGFSSDRIAVRIRLLVAVAATLALAPLLLPVMSEALP 70

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            ++ A   + ++ ELF+G + GLL R +   L+  G++++ AIG++    + I  + A  
Sbjct: 71  DMSLATTVRFIVAELFVGLLIGLLGRAFMAALETIGTLVAMAIGMSNIPGVAIDGADALP 130

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
           PL SL+ +     +++   H +VF  L  SY T+P G  ++  +    F   L TTF++ 
Sbjct: 131 PLASLMTLTATALIFISGHHWEVFRGLAASYETLPPGGAISLRSGLEQFTEQLATTFVLA 190

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           LR+ SPF+ + +V N +IGL NKL PQIP+YFI+ P++I  G  FL +++
Sbjct: 191 LRIGSPFIVYSVVVNFAIGLTNKLTPQIPVYFIAMPFVIAGGLYFLFVAV 240


>gi|115523201|ref|YP_780112.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisA53]
 gi|115517148|gb|ABJ05132.1| type III secretion system inner membrane R protein
           [Rhodopseudomonas palustris BisA53]
          Length = 248

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 133/237 (56%), Gaps = 5/237 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRA 67
           ++++FLI CRVG+C+M+ PG S S IPMQVRL  A+  +++L P L  T+  L       
Sbjct: 9   VLAVFLIFCRVGTCMMVAPGYSRSNIPMQVRLFLAINVTLMLSPLLVATVRPLVEGAAAP 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNS 126
               ++  EL +G V GL  RV+   L+   ++I++AIGLNL    G ++     P L  
Sbjct: 69  AIIAIIWSELVVGLVIGLTARVFFAALETMATMIASAIGLNLA---GTTEDTEHVPALVP 125

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           LI +   +  ++ D H ++   L+ SY        ++  N  +  V  L   F + LR++
Sbjct: 126 LITLTATVLFFITDQHWELLRGLISSYRVWVPAVGISGENGLAQLVEHLSQAFTLALRIA 185

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           SPF+ + I+ N++IGL NKL P IP+YFIS P+++  G L L L+    V QFS +F
Sbjct: 186 SPFVVYSIIVNLAIGLANKLTPSIPVYFISLPFVLFGGLLLLYLTSREAVLQFSIAF 242


>gi|319405382|emb|CBI79001.1| Flagellar biosynthetic protein fliR [Bartonella sp. AR 15-3]
          Length = 259

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 123/216 (56%), Gaps = 2/216 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSKL 72
           L+  RVG+C+ML+PG+S   IPM +RL   ++FS+ +LP + D+   L +  + A   + 
Sbjct: 23  LVFSRVGACLMLMPGMSSVRIPMSLRLFIGISFSLAILPLVTDSFKTLGDKPDLALLVRA 82

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G + G++   Y   LQF  S+I  +IG + Q S  I++S  E+ + +++    
Sbjct: 83  LFAEMLIGAILGIIAHAYLWALQFMASIIGMSIGFSGQPSHSITESTPESHVANVLVFAT 142

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++  +  D H      L+ SY  IP+    N     + +   L   F+  L +++PF+ +
Sbjct: 143 IILFFASDLHIITIQRLLASYDIIPLAFIPNPEAALTDYHEALSRAFLTTLSIAAPFIIY 202

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
            I+ NI+IGLLNKL P IP+YFIS P+++  G LFL
Sbjct: 203 AILINITIGLLNKLTPTIPVYFISLPFVM-CGGLFL 237


>gi|304392485|ref|ZP_07374425.1| flagellar biosynthetic protein flir [Ahrensia sp. R2A130]
 gi|303295115|gb|EFL89475.1| flagellar biosynthetic protein flir [Ahrensia sp. R2A130]
          Length = 237

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 121/229 (52%), Gaps = 6/229 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVR--LCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           CRVG C ++LPGLS   IP   R  L  A+A SI          + Q  +  +   +L+ 
Sbjct: 6   CRVGGCFIVLPGLSSGRIPGPARIYLTLAVALSIAF----ARGGEGQAVIYGSGLLRLIF 61

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            E  +G   GL  R+  L L F G+ I   IG N     G+ DS ++  L +LI    L+
Sbjct: 62  AESLVGLFIGLAARMMMLALSFAGTSIGMVIGFNNLFGQGVEDSESQAALTTLITFSALV 121

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            L+ +DFHH V  +L +SY   P G       +  +   +L + F I+L L+ PFL + +
Sbjct: 122 LLFQMDFHHAVIASLHRSYEIFPQGAVPEPQMLLVNITRILSSAFFIVLGLAGPFLVYGL 181

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +FN +IG+LNKL PQIPI+F+S P LI  G +   L++  ++ +F  +F
Sbjct: 182 IFNTAIGVLNKLTPQIPIFFVSLPVLIMGGLMLAYLALPELLRRFVDAF 230


>gi|114705550|ref|ZP_01438453.1| flagellar biosynthesis protein [Fulvimarina pelagi HTCC2506]
 gi|114538396|gb|EAU41517.1| flagellar biosynthesis protein [Fulvimarina pelagi HTCC2506]
          Length = 250

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/228 (37%), Positives = 133/228 (58%), Gaps = 8/228 (3%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M+ +    + + FL+ CR+G+C+MLLPG S + IP QVRL  A A S+ L P L   I+ 
Sbjct: 1   MSEAASAFVFAHFLVFCRIGTCLMLLPGYSSNRIPAQVRLFLAFAISLALSPLLLPLIEP 60

Query: 61  QNF-VNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
                + A   +LV  E+  G   GLL R + + L F G VI+ AIG+  Q      DS 
Sbjct: 61  LVVGASDARRLELVFSEMMTGFFIGLLGRCFLIALSFVGYVIANAIGMGQQLGPVYEDS- 119

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM---LQ 176
            +  + +LI +   + +++ + H ++  ALV SY  +P  +   FG I +S VN+   L+
Sbjct: 120 PDPAIGTLITMTATVLIFITNLHAEIARALVASYTALPAAE--GFG-IQASLVNLTDNLK 176

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            TF++ LR++SPF+ + I+ N +IGL NKL PQIP+YF+S P+++  G
Sbjct: 177 LTFVLCLRIASPFVLYAIIVNFAIGLANKLTPQIPVYFVSLPFVLAGG 224


>gi|319409206|emb|CBI82850.1| Flagellar biosynthetic protein fliR [Bartonella schoenbuchensis R1]
          Length = 261

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 125/228 (54%), Gaps = 1/228 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-DLQNFVNRAYYSKL 72
           L+  RVG+C+ML+PG+S   IPM  RL  A+AFS V+LP + D   +L +  + A  ++ 
Sbjct: 23  LVFARVGACLMLMPGISSLRIPMNFRLFLAIAFSFVMLPLVVDFFKELGDKPDIAVLTRA 82

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G   G++  VY   LQF  ++I+ ++G + Q    + DS+ ET +  L  +  
Sbjct: 83  LFSEMLIGASLGVIAHVYLWALQFMATIIAMSMGYSGQPGHSVIDSMPETQIAHLFVLAA 142

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++  +  D H      L+ SY  +      N       + ++L   F+  L +++PF+ +
Sbjct: 143 VMLFFASDLHMVTIRGLLASYDVVSPSFVPNPEAALIDYRDVLSRAFLTTLSIAAPFITY 202

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            I+ NI IGL+NKL P IP+YFIS P+++  G   L   I  +++ FS
Sbjct: 203 AILINIGIGLVNKLTPTIPVYFISLPFVVAGGVFLLYFLIPELLHFFS 250


>gi|319406958|emb|CBI80595.1| Flagellar biosynthetic protein fliR [Bartonella sp. 1-1C]
          Length = 261

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 126/231 (54%), Gaps = 1/231 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSKL 72
           LI  RVG+C+ML+PG+S   IPM +RL   ++FS+ +LP + ++   L +  N A   + 
Sbjct: 23  LIFARVGACLMLMPGMSSVRIPMSLRLFIGISFSLAILPLVTESFKVLGDKPNLALLVRS 82

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G   G++   Y   LQF  S+I  +IG + Q    I +S  E+ + +++    
Sbjct: 83  LFAEMLIGSTFGIIAHAYLWALQFMASIIGMSIGFSGQPGHSIIESTPESHVANVLVFAA 142

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++  +  D H      L+ SY  +P+    N     + +   L   F+  L +++PF+ +
Sbjct: 143 IILFFASDLHIITIQGLLASYDIVPLAFIPNPEAALTDYHEALSRAFLTTLSIAAPFIIY 202

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            I+ NI+IGLLNKL P IP+YFIS P+++  G   L + I  +++ F+  F
Sbjct: 203 AILINITIGLLNKLTPTIPVYFISLPFVMCGGLFLLYILIPELLHLFNSEF 253


>gi|90422632|ref|YP_531002.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisB18]
 gi|90104646|gb|ABD86683.1| type III secretion system inner membrane R protein
           [Rhodopseudomonas palustris BisB18]
          Length = 248

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 88/245 (35%), Positives = 139/245 (56%), Gaps = 8/245 (3%)

Query: 3   ISP-EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-- 59
           I+P  I ++ +FLI CRVG+C+M+ PG S S IP+QVRL  A++ +++L P L  T+   
Sbjct: 2   IAPASISVLVVFLIFCRVGTCMMVAPGYSRSNIPVQVRLFLALSVTLMLSPLLEATVRPA 61

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           L+     A    L+  EL +G + GL  RV+   L+   + +++AIGLNL    G  D  
Sbjct: 62  LEGAAAPAILG-LIWSELVVGLMIGLTARVFFAALETLATFVASAIGLNLA---GTVDDG 117

Query: 120 AETP-LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT 178
              P L  LI +   +  ++ + H Q+   L+ SY        +  G+  +  V+ L   
Sbjct: 118 EHVPALVPLITVSATVLFFMTEQHWQLLRGLLGSYRIWLPATGVGIGDGVAQLVDHLSQA 177

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
           F + LR++SPF+ + ++ N++IGL NKL P IP+YFIS P+++  G L L L+   +V Q
Sbjct: 178 FTLALRVASPFVIYSVIVNLAIGLANKLTPSIPVYFISLPFVLFGGLLLLYLTGREMVLQ 237

Query: 239 FSHSF 243
           FS +F
Sbjct: 238 FSIAF 242


>gi|296445188|ref|ZP_06887148.1| type III secretion system inner membrane R protein [Methylosinus
           trichosporium OB3b]
 gi|296257362|gb|EFH04429.1| type III secretion system inner membrane R protein [Methylosinus
           trichosporium OB3b]
          Length = 251

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 132/244 (54%), Gaps = 1/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-D 59
           MT+  E +  +LF++ CR+G CIM +PG S   IP+Q RL  A+A +I L P L + +  
Sbjct: 1   MTLGVEALAATLFVLFCRIGGCIMAMPGFSSPRIPVQARLYIAIAITIALAPRLVEVVAP 60

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           + +  +    + L++ EL +G + G L R++   L+   +   TA GL       + ++ 
Sbjct: 61  IASSASATGLAVLLVGELLVGVLIGSLARLFFFALETLATAGVTAAGLGNVLGAPMEEAE 120

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
               ++S I +     ++++D H ++   +  SY  IPI       N+ S +  +L   F
Sbjct: 121 PLPAMSSFIMLGATALIFLLDLHWEMVRGVFLSYTAIPIRDAFQARNMLSEYTKVLTQAF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           ++ LR+SSP L F ++ N++ G LN++ PQ+P++F+STP LIGLG  +  L  +     F
Sbjct: 181 LVALRISSPLLLFGLIVNLAFGFLNRMTPQVPVFFVSTPLLIGLGCYWFYLMADDFFAAF 240

Query: 240 SHSF 243
             SF
Sbjct: 241 ISSF 244


>gi|319898617|ref|YP_004158710.1| flagellar biosynthetic protein FliR [Bartonella clarridgeiae 73]
 gi|319402581|emb|CBI76126.1| Flagellar biosynthetic protein FliR [Bartonella clarridgeiae 73]
          Length = 259

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 119/216 (55%), Gaps = 2/216 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL-QNFVNRAYYSKL 72
           LI  RVG+C+ML+PG+S   IPM +RL   ++FS+ +LP + D   +  +  + A   + 
Sbjct: 21  LIFSRVGTCLMLMPGISSVRIPMSLRLFIGISFSLAILPMVTDFFKVFSDKSDLALLIRA 80

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G   G++   Y   LQF  S+I  +IG + Q    I DS  E+ + +++    
Sbjct: 81  LFAEMLIGATFGVIAHAYLWALQFMSSIIGMSIGFSGQPGHSIIDSTPESHVANILVFAA 140

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++  +  D H      L+ SY  +P+    N     + +   L   F+  L +++PF+ +
Sbjct: 141 IMLFFASDLHIITIRGLLASYDIVPLAFIPNPEAALTDYREALSRAFLTTLSIAAPFIIY 200

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
            I+ NI+IGLLNKL P IP+YFIS P+++  G LFL
Sbjct: 201 AILINIAIGLLNKLTPTIPVYFISLPFVM-CGGLFL 235


>gi|319403941|emb|CBI77529.1| Flagellar biosynthetic protein fliR [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 261

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 120/216 (55%), Gaps = 2/216 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSKL 72
           LI  RVG+C+ML+PG+S   IPM +RL   ++FS+ +LP + ++   L +  N A   + 
Sbjct: 23  LIFARVGACLMLMPGMSSVRIPMSLRLFIGISFSLAILPLVTESFKVLGDKPNLALLVRA 82

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G   G++   Y   LQF  S+I  +IG + Q    I +S  E+ + +++    
Sbjct: 83  LFAEMLIGSTFGVIAHAYLWALQFMASIIGMSIGFSGQPGHSIIESTPESHVANILVFAA 142

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++  +  D H      L+ SY  +P+    N     + +   L   F+  L +++PF+ +
Sbjct: 143 VILFFASDLHIITIQGLLTSYDIVPLAFIPNPEAALTDYHEALSRAFLTTLSIAAPFIIY 202

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
            I+ NI+IGLLNKL P IP+YFIS P+++  G LFL
Sbjct: 203 AILINITIGLLNKLTPTIPVYFISLPFVM-CGGLFL 237


>gi|323136993|ref|ZP_08072073.1| type III secretion system inner membrane R protein [Methylocystis
           sp. ATCC 49242]
 gi|322397754|gb|EFY00276.1| type III secretion system inner membrane R protein [Methylocystis
           sp. ATCC 49242]
          Length = 250

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 123/222 (55%), Gaps = 5/222 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  +   F+I CR+G C+M+ PG S   +P+++RL  A+  ++ L P L DT  LQ  + 
Sbjct: 5   ESAIAPTFIIFCRIGGCLMVAPGFSSERVPVRIRLYIAIGVTLALAPALIDT--LQPGLR 62

Query: 66  RAYYSKL---VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            A   KL   +M EL +G   GLL R+Y L L+   + ++  IGL       + ++    
Sbjct: 63  GADPLKLGAIIMGELTIGVFIGLLARLYFLALETLATAVAMTIGLGNIFGSALIEAEPAP 122

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L++ + I  ++ ++V D H ++   L  SY T P+       +  +    +L  ++++ 
Sbjct: 123 ALSTFVVICAIMLVFVTDQHLEMIRGLYLSYQTTPVFSPAAPESYLNELTRVLTQSYLLA 182

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           LR+SSPFL F ++ N++ G L +L PQ+P+YFIS P++I LG
Sbjct: 183 LRISSPFLLFGLIVNLAFGFLARLTPQVPVYFISGPFVIVLG 224


>gi|240137265|ref|YP_002961734.1| Flagellar biosynthesis protein FliR [Methylobacterium extorquens
           AM1]
 gi|240007231|gb|ACS38457.1| Flagellar biosynthesis protein FliR [Methylobacterium extorquens
           AM1]
          Length = 256

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 123/240 (51%), Gaps = 7/240 (2%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           + +FLI CR+G C++++PG S   +P QVRL  A   S+ + P L      +  + +A  
Sbjct: 15  LGVFLIFCRIGGCLLIVPGFSSPRVPAQVRLLIAGGVSLAVTPLLLPLFQTK-LLGQAPT 73

Query: 70  SKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             L  +  E   G + GLL R++   L+   + +ST +G        +  + A   + SL
Sbjct: 74  ETLTWIASETVTGLLIGLLGRIFVFVLETVMNAVSTMVGFGSMPGTPVEGTDAIPAVESL 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I    +  ++  D H ++F  LV SYG IP G+            + +   F + LR+++
Sbjct: 134 IVFTAVALMFAADLHWELFRGLVDSYGRIPPGEGFGTQTALVRIADQIAEAFTLALRIAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+ + +  N++ G +NKL P IP+YF++TP+++  G+L L  ++     +F   FL G+
Sbjct: 194 PFIIYAVAVNLAAGFVNKLTPTIPVYFVATPFVM-FGALLLLYTLS---SEFMTQFLSGY 249


>gi|182680488|ref|YP_001834634.1| flagellar biosynthesis protein FliR [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636371|gb|ACB97145.1| flagellar biosynthesis protein FliR [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 251

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 140/249 (56%), Gaps = 7/249 (2%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID- 59
           MT SP  +++ + ++ CR+G C+MLLPG S   IP++VRL  A+A ++ L PFL + +  
Sbjct: 1   MTFSPSHLVLFVTILFCRIGFCVMLLPGFSSPRIPLKVRLALALALTLTLTPFLAEEVRP 60

Query: 60  -LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDS 118
            L++       + L++ E  +G   G   R++   L+ T + ++  IG+       +++ 
Sbjct: 61  ALRD-ETPLLLAHLMISESLMGFFIGFSARIFFAALETTANAMAMMIGMTNVLGAPVNEE 119

Query: 119 LAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT 178
                L++L+ +   + L+++D H ++   LV SY  +P+    N         + L   
Sbjct: 120 EPLPVLSALVTLSATVLLFIMDLHWEILRGLVGSYKAVPVIDHFNARLDLVQVADSLSKA 179

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
           F +  RL+ PF+ F I+ N+++GL+NK++PQIPIYFI+ P+++ +G LFL  +    +++
Sbjct: 180 FFLSFRLAGPFIIFSIIVNLAVGLINKMIPQIPIYFITMPFVL-IGGLFLFFATSTQLFE 238

Query: 239 FSHSFLYGF 247
               F++GF
Sbjct: 239 L---FMFGF 244


>gi|163850131|ref|YP_001638174.1| flagellar biosynthesis protein FliR [Methylobacterium extorquens
           PA1]
 gi|218528735|ref|YP_002419551.1| flagellar biosynthesis protein FliR [Methylobacterium
           chloromethanicum CM4]
 gi|254559276|ref|YP_003066371.1| flagellar biosynthesis protein FliR [Methylobacterium extorquens
           DM4]
 gi|163661736|gb|ABY29103.1| putative flagellar biosynthetic protein [Methylobacterium
           extorquens PA1]
 gi|218521038|gb|ACK81623.1| flagellar biosynthesis protein FliR [Methylobacterium
           chloromethanicum CM4]
 gi|254266554|emb|CAX22318.1| Flagellar biosynthesis protein FliR [Methylobacterium extorquens
           DM4]
          Length = 256

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 122/240 (50%), Gaps = 7/240 (2%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           + +FLI CR+G C++++PG S   +P QVRL  A   S+ + P L      +    +A  
Sbjct: 15  LGVFLIFCRIGGCLLIVPGFSSPRVPAQVRLLIAGGVSLAVTPLLLPLFQTK-LSGQAPT 73

Query: 70  SKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             L  +  E   G + GLL R++   L+   + +ST +G        +  + A   + SL
Sbjct: 74  ETLTWIASETVTGLLIGLLGRIFVFVLETVMNAVSTMVGFGSMPGTPVEGTDAIPAVESL 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I    +  ++  D H ++F  LV SYG IP G+            + +   F + LR+++
Sbjct: 134 IVFTAVALMFAADLHWELFRGLVDSYGRIPPGEGFGTQTALVRIADQIAEAFTLALRIAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+ + +  N++ G +NKL P IP+YF++TP+++  G+L L  ++     +F   FL G+
Sbjct: 194 PFIIYAVAVNLAAGFVNKLTPTIPVYFVATPFVM-FGALLLLYTLS---SEFMTQFLSGY 249


>gi|300024562|ref|YP_003757173.1| type III secretion system inner membrane R protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526383|gb|ADJ24852.1| type III secretion system inner membrane R protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 254

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 117/220 (53%), Gaps = 1/220 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           ++ CRVG+C M+LPG S   IP+Q+RL  A+A S+ ++P ++D +             ++
Sbjct: 14  IVFCRVGACFMVLPGFSSDRIPVQLRLFVAIAISLAIMPIVYDDVRPVAAGPAEGLVSII 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E   G   G ++R++ L L+F    ++   G     S  I  +   TP +  + +  +
Sbjct: 74  VTESLAGLFLGFIVRIFFLALEFAAIAMANLAGYGSAFSHAIEGNDPSTPYSVFVTLPAV 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           +  +V D H  +   L  SY  + +G E       S  V+   + F + L+LS+  + + 
Sbjct: 134 VMFFVADLHIAIIRMLHNSYAALKVGSEFAAPPNLSMIVSTFGSAFKLTLQLSAALVVYS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
           ++ N++ G LNK++PQIP YF+STP+++ LG L + L I+
Sbjct: 194 VMVNLAFGFLNKMIPQIPSYFVSTPFVV-LGGLIILLQID 232


>gi|288962717|ref|YP_003453011.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288914983|dbj|BAI76467.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 256

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 128/220 (58%), Gaps = 2/220 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F+++ RV + I LLPG   + +PM+VR   A+  ++VLLP + D +  +         ++
Sbjct: 20  FVVLARVAAAIGLLPGFGEAAVPMRVRAALAIIVTLVLLPGV-DGLPDRMPEQPVEMLRI 78

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E  +G   GL  R++   LQ TG++ +  +GL+   SM  +     + L+ ++ I G
Sbjct: 79  LAGETLVGAYLGLGARLFMAALQTTGALAAQVVGLSNPFSMAAAGFEGGSVLSGVLLIGG 138

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L  L+  D H+ +  AL +SYG+ P  +  + G +   F  +L TTF + + L++PF+ +
Sbjct: 139 LALLFASDVHYLMIGALARSYGSWPAAEFPDLGMVAQRFAELLATTFRLGVGLAAPFILY 198

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG-SLFLCLS 231
            +V N+++GL+N+++P +P+YF++TP ++ LG  LF+  +
Sbjct: 199 GLVMNLALGLVNRVMPAMPVYFVATPGVLMLGLGLFMATA 238


>gi|188579933|ref|YP_001923378.1| flagellar biosynthesis protein FliR [Methylobacterium populi BJ001]
 gi|179343431|gb|ACB78843.1| putative flagellar biosynthetic protein [Methylobacterium populi
           BJ001]
          Length = 256

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 121/240 (50%), Gaps = 7/240 (2%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +S+FLI CR+G C++++PG S   +P QVRL  A   S+ + P L           +A  
Sbjct: 15  LSVFLIFCRIGGCLLIVPGFSSPRVPAQVRLLIAAGVSLAVTPLLLPLFQ-GRLPGQAPT 73

Query: 70  SKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             LV +  E   G + G L R++   L+   + +ST +G        +  + A   + SL
Sbjct: 74  ETLVWIASESITGLLIGFLGRIFVFVLETVMNAVSTMVGFGSMPGTPVEGTDAIPAVESL 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I    +  ++  D H ++F  LV SY  IP G+            + +   F + LR+++
Sbjct: 134 IVFTAVALMFAADLHWELFRGLVDSYARIPPGEGFGTQTALVRIADQIGEAFTLALRIAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+ + +  N++ G +NKL P IP+YFI+TP+++  G+L L  ++     +F   FL G+
Sbjct: 194 PFIIYAVAVNLAAGFVNKLTPTIPVYFIATPFVM-FGALILLYTLS---SEFMTQFLSGY 249


>gi|170748117|ref|YP_001754377.1| flagellar biosynthesis protein FliR [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654639|gb|ACB23694.1| putative flagellar biosynthetic protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 248

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 125/225 (55%), Gaps = 12/225 (5%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +SP+ I+  +F+I CRVG C+++ PGLS + +  ++RL  A+  ++ + P L     L  
Sbjct: 1   MSPDTIL-GVFVIFCRVGGCLLVAPGLSSARVAPRIRLLVALTVTLAVAPLL-----LPR 54

Query: 63  FVNRAYYSKLVMVELFLGC--VHGLLI----RVYTLGLQFTGSVISTAIGLNLQTSMGIS 116
           F      +  V +  ++GC  + GL I    R +   L+   S ++T IGL       ++
Sbjct: 55  FGAGLRDAAPVDILWWIGCETLTGLAIGFFGRSFYFALETLASGVATMIGLGGIPGNPVA 114

Query: 117 DSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ 176
           D+ A +   SLI +   + ++ +D H ++F  L+ SY  IP G       + +  V+   
Sbjct: 115 DTEAASLAGSLIVMAATILVFALDLHWELFRGLIASYDRIPPGHPFGSRLMLAGLVDRTG 174

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
             F + LR++SPF+ + ++ N+++GL NKL PQIP++FI+TP+++
Sbjct: 175 AAFAMALRVTSPFIIYSVIVNLALGLANKLTPQIPVFFIATPFIL 219


>gi|312115272|ref|YP_004012868.1| type III secretion system inner membrane R protein [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220401|gb|ADP71769.1| type III secretion system inner membrane R protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 255

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 117/219 (53%), Gaps = 1/219 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVNRA 67
           ++S+FL++CR+G C+M+LP +  + +P++VRL   +A S+ +   L +     ++  +  
Sbjct: 13  VLSIFLVLCRIGGCLMVLPAIGGARVPVRVRLMVCLAISVAVAFALGNFESARESLSSTP 72

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               LV+VE   G V G++IR++    +F     S A+GL +  +    D     PL   
Sbjct: 73  SLVSLVLVETAKGLVIGIMIRLFFASFKFLAVAGSAALGLAMPVNAVEEDGETTPPLAEF 132

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +         D H +V  AL++SY  +PIG  +      S  V+ L+   ++ L++ +
Sbjct: 133 VSLTAAFLFLATDQHLEVLKALLQSYTVLPIGTGIGLAPSLSGVVDTLRDACLVSLQVVA 192

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSL 226
           P L F  + N+  G+LN++ PQ P YF+S P++IG G L
Sbjct: 193 PLLVFAFLVNLLFGVLNRIAPQTPAYFLSMPFVIGGGML 231


>gi|27381961|ref|NP_773490.1| flagellar biosynthesis protein FliR [Bradyrhizobium japonicum USDA
           110]
 gi|27355131|dbj|BAC52115.1| fliR [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 114/211 (54%), Gaps = 5/211 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F++ CR+G+C+M +PG S   +P QVRL  A+  +  L P L     L+   ++A    L
Sbjct: 13  FIVFCRIGACLMFVPGYSSVNVPAQVRLFIALVTTFALTPILIAV--LKPLTDQAAPLTL 70

Query: 73  VMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
            ++   E+ +G V GL  RV+ L LQ   +V+++AIGL+      I D+     L  LI 
Sbjct: 71  ALLIGSEVLVGSVIGLGGRVFFLALQTMATVMASAIGLSNIPGTPIGDTDPAPALVPLIM 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
                  ++ D H QV   L+ SY     G  L         V+ L   F++ LR++SPF
Sbjct: 131 ASVTTLFFMTDQHWQVLRGLMNSYDVWHPGARLGGSMALDQLVSRLSEAFVLTLRIASPF 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
           + + ++ N+++GL+NKL P IP+YFIS P++
Sbjct: 191 IVYSVIVNLAVGLINKLTPAIPVYFISVPFV 221


>gi|197104397|ref|YP_002129774.1| flagellar biosynthesis protein FliR [Phenylobacterium zucineum
           HLK1]
 gi|196477817|gb|ACG77345.1| flagellar biosynthesis protein FliR [Phenylobacterium zucineum
           HLK1]
          Length = 253

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 123/222 (55%), Gaps = 1/222 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G+ IML+PGL  ++IP ++RL FA+A +++L P L  T         A   + V
Sbjct: 15  LVFARLGAIIMLIPGLGETFIPARIRLSFALALALMLFPVLGATAPPIPASAGALAGE-V 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + EL +G + G ++R++ L L   G ++S    L+   +     +     L++ +G++G+
Sbjct: 74  IRELLIGLMIGAILRIFMLSLATAGEIVSLGTTLSFAQTANPMQAQPTPTLSTFLGMLGI 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + +   D HH    ALV+SY   P G+E+  G+     +      F + L+L++P +   
Sbjct: 134 VLILTTDLHHMFLAALVRSYAIFPFGREVPVGDAGQLAIQTTSRAFALGLQLAAPVVVLS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           ++ N+++GL+ +++P   ++FI++P L+ LG     +S+ +I
Sbjct: 194 LIVNVAVGLVGRVMPTFQVFFIASPLLVLLGLSVFAVSLGVI 235


>gi|170744552|ref|YP_001773207.1| flagellar biosynthesis protein FliR [Methylobacterium sp. 4-46]
 gi|168198826|gb|ACA20773.1| putative flagellar biosynthetic protein [Methylobacterium sp. 4-46]
          Length = 256

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 128/238 (53%), Gaps = 7/238 (2%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAM----AFSIVLLPFLWDTIDLQNFVN 65
           + +FL+ CR+G C++++PG+S + IP+QVRL  A+    A S ++LP     +  Q    
Sbjct: 15  LGIFLMFCRIGGCLLVVPGVSSARIPVQVRLFLALSVTFALSPLILPLFRGRLAAQE--- 71

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A     ++ E   G + GLL RV+   L+   + ++ A+G        +  +  +  L 
Sbjct: 72  PAVTFLWILSESLTGFLIGLLGRVFLFVLETVMTAVTMAVGFGTIPGTPMEGNEPQGALV 131

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           SL+ +     L+    H ++F  LV SY  +P G+ L         V+ + + F++ LR+
Sbjct: 132 SLVMVAATALLFSAGLHWELFRGLVDSYARLPPGEGLGSQAALVQIVDQITSVFVLGLRI 191

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +SPF+ + IV N+++G  NKL P IP+YFI+TP+++  G L L L    ++ QF  S+
Sbjct: 192 TSPFIVYSIVVNLAVGFANKLTPTIPVYFIATPFVMVGGILMLYLISGEVLMQFLGSY 249


>gi|217976248|ref|YP_002360395.1| type III secretion system inner membrane R protein [Methylocella
           silvestris BL2]
 gi|217501624|gb|ACK49033.1| type III secretion system inner membrane R protein [Methylocella
           silvestris BL2]
          Length = 249

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 131/240 (54%), Gaps = 11/240 (4%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++ F++ CR+G+C+M++PG+S + IP++VRL    A ++ L P L D +  +      +
Sbjct: 7   VLTAFVLFCRIGACLMIMPGISSARIPVRVRLFVGFAITLGLTPILSDEVGPKISAESPF 66

Query: 69  -YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
              + ++ E  +G + G L R++   L    + I+ AIGL+   +    D+     + SL
Sbjct: 67  ILVQTILSESLIGGLIGFLGRIFFGALDALANAIAMAIGLSSPLAPPTDDNEPAPAIVSL 126

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ--ELNFGNIFSSFVNMLQTTFMIMLRL 185
           I +  L+  ++ + H +V   L+ SY   P+    E   G +     N L  +F + LR+
Sbjct: 127 ISLGALVLFFLTNLHWEVLRGLLASYSVWPVSGLFEARLGLV--EIGNSLARSFALALRV 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL----CLS-IEIIVYQFS 240
           SSPF+ + ++ N++IG+ ++  PQIPIYFI+ P  +  G LFL    C S +E+ V  FS
Sbjct: 185 SSPFIVYALIVNLAIGIASRFAPQIPIYFITVPA-VAAGGLFLLYITCRSLLELFVAGFS 243


>gi|162138518|ref|YP_487378.2| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           HaA2]
          Length = 255

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 118/216 (54%), Gaps = 5/216 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  RVG+ +MLLP L  S IP +++L  A+  ++++LP   +   +D+ +      
Sbjct: 14  AFMLVFARVGAMVMLLPTLGESNIPTRIKLSIALGLTLIILPLHRNAYQVDMSSLTPLLV 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + +
Sbjct: 74  ---LMIQEIIIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+G+  L+  D HH V  AL  SY     G+ LN G++ +        +F I ++L++P
Sbjct: 131 TILGVTMLFATDSHHLVIEALSDSYKIFAPGELLNSGDVAALATKAFAASFKIGMQLAAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           FL F +VFNI +G+L +L+PQ+ +YF+  P  I +G
Sbjct: 191 FLVFGLVFNIGLGILARLMPQMQVYFVGVPLSIMIG 226


>gi|75675329|ref|YP_317750.1| flagellar biosynthesis protein FliR [Nitrobacter winogradskyi
           Nb-255]
 gi|74420199|gb|ABA04398.1| Flagellar biosynthesis protein FliR [Nitrobacter winogradskyi
           Nb-255]
          Length = 256

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 114/210 (54%), Gaps = 5/210 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  RVG+ +MLLPG    YIP++V+L  A+  + ++LP       +D+Q+    A 
Sbjct: 14  AFMLVFARVGAMVMLLPGFGEGYIPVRVKLAIALLLTFIILPLHRAAYHVDMQSV---AP 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + L++ E+ +G V G   RV    L   GSVI+  +GL   TS+  +       + + +
Sbjct: 71  LAVLLVHEIIIGVVLGATARVTLAALHVAGSVIAQQLGLGFVTSVDPTQGQQGALMGNFL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  L+  D H+ V  AL  SY     G+ +  G++ +         F I L+LS+P
Sbjct: 131 TLLGIALLFATDTHYLVIAALNDSYKIFSPGELMPSGDVAALATRAFAGAFKIGLQLSAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           FL F +VFNI +G+L +L+PQ+ +YF+  P
Sbjct: 191 FLVFGLVFNIGLGVLARLMPQMQVYFVGVP 220


>gi|86573910|gb|ABD08467.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           HaA2]
          Length = 283

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 118/216 (54%), Gaps = 5/216 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  RVG+ +MLLP L  S IP +++L  A+  ++++LP   +   +D+ +      
Sbjct: 42  AFMLVFARVGAMVMLLPTLGESNIPTRIKLSIALGLTLIILPLHRNAYQVDMSSLTPLLV 101

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + +
Sbjct: 102 ---LMIQEIIIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFL 158

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+G+  L+  D HH V  AL  SY     G+ LN G++ +        +F I ++L++P
Sbjct: 159 TILGVTMLFATDSHHLVIEALSDSYKIFAPGELLNSGDVAALATKAFAASFKIGMQLAAP 218

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           FL F +VFNI +G+L +L+PQ+ +YF+  P  I +G
Sbjct: 219 FLVFGLVFNIGLGILARLMPQMQVYFVGVPLSIMIG 254


>gi|148256776|ref|YP_001241361.1| flagellar biosynthesis protein FliR [Bradyrhizobium sp. BTAi1]
 gi|146408949|gb|ABQ37455.1| Flagellar biosynthetic protein fliR [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 121/227 (53%), Gaps = 9/227 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAYYSKLVM 74
            R+G+ +MLLPGL    IP++++L  A+  ++++LP       +DLQ     A    LVM
Sbjct: 20  ARIGAMVMLLPGLGEVNIPVRIKLATALLLTMIVLPLHRQAYQVDLQ-----ALSPLLVM 74

Query: 75  V--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + + ++G
Sbjct: 75  MVHEIVIGIVLGATARVTLSALQVAGSVIAQQMGLGFVTAVDPTQGQQGVLIGNFLTMLG 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +  L+  D HH V  AL  SY     G+ +  G++ S         F I L+LS+PFL F
Sbjct: 135 VTLLFSTDSHHLVIAALSDSYKIFAPGEVIPSGDVASLATRAFAAAFKIGLQLSAPFLVF 194

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            +VFNI +G+L +L+PQ+ +YF+  P  I +G L   L +  ++  F
Sbjct: 195 GLVFNIGLGVLARLMPQMQVYFVGAPLSILIGFLIFGLVLAAMMGTF 241


>gi|91976175|ref|YP_568834.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisB5]
 gi|91682631|gb|ABE38933.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           BisB5]
          Length = 255

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 126/237 (53%), Gaps = 9/237 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  R+G+ +ML P L  S IP++++L  A+  ++++LP       +D+ +      
Sbjct: 14  AFMLVFARIGAMVMLFPTLGESNIPVRIKLSIALGLTLIILPLHRSAYQVDMSSLT---- 69

Query: 69  YSKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
              LVM+  E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + +
Sbjct: 70  -PLLVMMIQEIIIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+G+  L+  D HH V  AL  SY     G+ L+ G++ +        +F I ++L+
Sbjct: 129 FLTILGVTMLFATDSHHLVIQALSDSYKIFAPGELLSSGDVAALATKAFAASFKIGMQLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +PFL F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L   +  ++  F + F
Sbjct: 189 APFLVFGLVFNIGLGILARLMPQMQVYFVGVPLSIAIGFIILAAVLTTMMSTFLNYF 245


>gi|316932837|ref|YP_004107819.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           DX-1]
 gi|315600551|gb|ADU43086.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           DX-1]
          Length = 268

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 122/228 (53%), Gaps = 5/228 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAYYSK 71
           L+  R+G+ +ML+P L  S IP +++L  A+  ++++LP       ID+ +         
Sbjct: 30  LVFARIGAMVMLMPALGESNIPTRIKLSIALLLTMIMLPLHRSAYQIDMSSLTPLLV--- 86

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ E+ +G V G   RV    LQ  G+VI+  +GL   +++  +       + + + ++
Sbjct: 87  LMVQEIAIGIVLGATARVTLSALQVAGAVIAQQLGLGFVSAVDPTQGQQGVLVGNFLTLL 146

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           G+  L+  D HH V  AL  SY     G+ LN G++ +         F + L+L++PFL 
Sbjct: 147 GVTMLFATDMHHLVIQALSDSYKVFAPGELLNTGDVAALATQAFAAAFKLGLQLAAPFLV 206

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L + +  ++  F
Sbjct: 207 FGLVFNIGLGVLARLMPQMQVYFVGVPLSIVIGFIVLAVVLTTMMGAF 254


>gi|83594154|ref|YP_427906.1| flagellar biosynthesis protein FliR [Rhodospirillum rubrum ATCC
           11170]
 gi|83577068|gb|ABC23619.1| Flagellar biosynthesis protein FliR [Rhodospirillum rubrum ATCC
           11170]
          Length = 253

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 127/233 (54%), Gaps = 1/233 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G+ +++LPGLS +Y+ + +R+  A+  ++V LP +   +      N A+   L+
Sbjct: 15  LVFVRLGTAMLVLPGLSSTYVSVNIRILLAVTITLVALPTVGAALPPAP-DNTAFLVLLI 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
            VE  +G   G++ +   + + F G+++  + GL +  +   + +     +   +G + +
Sbjct: 74  AVEATIGVFLGMMAQFLLVPVSFAGNIMGFSTGLMMAQAFDPTTAQQSALIAGFLGEVAM 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + ++V   HH +  A+V SY   P GQ  + G++    V +L + F + L+L++PF+ + 
Sbjct: 134 VMVFVTGMHHLMIEAVVNSYDAFPPGQMPDTGDMVQLLVTILSSGFRLGLQLAAPFIIYA 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           I+FN ++G++ +L+PQ+ + F++ P  I  G   L  ++  ++Y F   F  G
Sbjct: 194 IIFNATLGVIARLMPQLNVLFVAMPAQILFGLALLMTTVPFLIYSFLGHFERG 246


>gi|115523574|ref|YP_780485.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisA53]
 gi|115517521|gb|ABJ05505.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           BisA53]
          Length = 256

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 116/211 (54%), Gaps = 1/211 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+ +ML+PG   S IP +++L  A+  ++++LP       + +  + A    L++ E+
Sbjct: 21  RIGTMVMLMPGFGESNIPARIKLSIALGLTLIILPLHRSAYQV-DMTSMAPLIVLMLHEI 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G V G  +RV    LQ  GSVI+  +GL   T++  +       + + + ++GL  L+
Sbjct: 80  VIGIVLGATVRVTLAALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFLTLLGLTLLF 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
             D HH V  AL +SY     G+ L  G+I +         F I ++L++PFL F +VFN
Sbjct: 140 ATDSHHLVIAALNESYRVFSPGELLPSGDIAALATRAFSAAFKIGMQLAAPFLVFGLVFN 199

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
           I +G+L +L+PQ+ +YF+  P  I +G L L
Sbjct: 200 IGLGVLARLMPQMQVYFVGVPLSIVVGFLIL 230


>gi|260564095|ref|ZP_05834580.1| LOW QUALITY PROTEIN: flagellar biosynthesis protein FliR [Brucella
           melitensis bv. 1 str. 16M]
 gi|260151738|gb|EEW86831.1| LOW QUALITY PROTEIN: flagellar biosynthesis protein FliR [Brucella
           melitensis bv. 1 str. 16M]
          Length = 221

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 99/172 (57%)

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L +++  
Sbjct: 41  RLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLATIVTF 100

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+++PF+
Sbjct: 101 SALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRIAAPFI 160

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 161 VFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 212


>gi|254502657|ref|ZP_05114808.1| flagellar biosynthetic protein FliR [Labrenzia alexandrii DFL-11]
 gi|222438728|gb|EEE45407.1| flagellar biosynthetic protein FliR [Labrenzia alexandrii DFL-11]
          Length = 257

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 111/218 (50%), Gaps = 1/218 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+G+ IMLLP L  S IP + RL  A+A ++VL P            N A
Sbjct: 11  VAAAFMLMFARLGTMIMLLPALGESSIPTRFRLTIALAMTLVLYPVGSQLYPADLVSNPA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NS 126
               L++ E+ +G   GL  ++ T  +Q  G +++   GL       IS+   +  L  +
Sbjct: 71  QLGVLLISEIVIGVAIGLCAKLVTSAVQIAGVIMANQSGLAFALGTDISNEGQQGALYGN 130

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G+  ++  D H+ V  AL  S+   P G     G+   +F   +   F I +R+S
Sbjct: 131 FLALVGITLIFTTDTHYLVIAALHDSFTLFPPGSMPPVGDFSENFAETVAMVFSIAVRMS 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +PFL   +VF   +GLLNKL+PQ+ I+FI+ P  I +G
Sbjct: 191 APFLVVGLVFYFGLGLLNKLMPQMQIFFIAMPVNIAIG 228


>gi|256042857|ref|ZP_05445803.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265989293|ref|ZP_06101850.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|262999962|gb|EEZ12652.1| flagellar biosynthesis protein FliR [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 203

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 99/172 (57%)

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L +++  
Sbjct: 23  RLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLATIVTF 82

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+++PF+
Sbjct: 83  SALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRIAAPFI 142

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 143 VFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 194


>gi|146341891|ref|YP_001206939.1| flagellar biosynthesis protein FliR [Bradyrhizobium sp. ORS278]
 gi|146194697|emb|CAL78722.1| Flagellar biosynthetic protein fliR [Bradyrhizobium sp. ORS278]
          Length = 255

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 116/219 (52%), Gaps = 11/219 (5%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAYYSKLVM 74
            R+ + +MLLPGL    IP++++L  A+  ++++LP       +DLQ        S LV+
Sbjct: 20  ARIAAMVMLLPGLGEVNIPVRIKLATALLLTMIVLPLNRQAYQVDLQAL------SPLVV 73

Query: 75  V---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +   E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + + ++
Sbjct: 74  MMVHEIVIGIVLGATARVTLSALQVAGSVIAQQMGLGFVTAVDPTQGQQGVLIGNFLTML 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           G+  L+  D HH V  AL  SY     G+ +  G++ S         F I L+LS+PFL 
Sbjct: 134 GVTLLFATDSHHLVIAALSDSYKIFAPGELVPSGDVASLATKAFAAAFKIGLQLSAPFLV 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           F +VFNI +G+L +L+PQ+ +YF+  P  I +G L   L
Sbjct: 194 FGLVFNIGLGVLARLMPQMQVYFVGAPLSILIGFLIFAL 232


>gi|306841284|ref|ZP_07473995.1| flagellar biosynthesis protein FliR [Brucella sp. BO2]
 gi|306288686|gb|EFM60017.1| flagellar biosynthesis protein FliR [Brucella sp. BO2]
          Length = 203

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 98/172 (56%)

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           +L+  E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L +++  
Sbjct: 23  RLMAGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLATIVTF 82

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+++PF+
Sbjct: 83  SALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRIAAPFI 142

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 143 VFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 194


>gi|307945651|ref|ZP_07660987.1| flagellar biosynthetic protein FliR [Roseibium sp. TrichSKD4]
 gi|307771524|gb|EFO30749.1| flagellar biosynthetic protein FliR [Roseibium sp. TrichSKD4]
          Length = 257

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 119/221 (53%), Gaps = 2/221 (0%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
           P+I  + L L+  R+G+ IML+P L  + IP ++RL  A+  ++VL P +  +       
Sbjct: 9   PQITAIFL-LMFARIGTLIMLMPALGETSIPTRIRLTIALGITLVLYPVISGSYPAGLTD 67

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           N A     +  E+ +G   GL IR++T  LQ  G +++   GL       +++   +  L
Sbjct: 68  NPARLLVFMGGEMIIGFAVGLCIRLFTTTLQTAGVIMANQSGLAFAFGADLANGGQQGTL 127

Query: 125 -NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
             + + ++G+  ++  D H+ V  AL  S+   P G+ +  G+  ++  N +   F I L
Sbjct: 128 FGNYLSMVGIAMVFATDSHYLVIAALHDSFTLFPPGELVPVGDFVTNATNTVAEVFSIAL 187

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           R+S+PF+   +VF   +GLLNKL+PQ+ I+FI+ P  I +G
Sbjct: 188 RMSAPFIVMGLVFYFGLGLLNKLMPQMQIFFIAMPVNIAIG 228


>gi|90423032|ref|YP_531402.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisB18]
 gi|90105046|gb|ABD87083.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           BisB18]
          Length = 256

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 116/211 (54%), Gaps = 7/211 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L+  R+ + +ML+PG   + IP++++L  A+  ++V+LP      D Q  V+    +
Sbjct: 14  AFMLVFARIAAMVMLMPGFGETNIPVRIKLAIALVLTLVILPLHRS--DYQ--VDMTSLT 69

Query: 71  KLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            L+++   E+ +G V G   RV    LQ  GSVI+  +GL   TS+  +       + + 
Sbjct: 70  PLIVLMLHEIVIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTSVDPTQGQQGAVIGNF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++GL  L+  D HH V  AL +SY     G+ ++ G++ S         F I ++LS+
Sbjct: 130 LTLLGLTLLFATDTHHLVIAALNESYRIFSPGEFMSSGDVASLATRAFAAAFKIGMQLSA 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           PFL F +VFNI +G+L +L+PQ+ +YF+  P
Sbjct: 190 PFLVFGLVFNIGLGVLARLMPQMQVYFVGVP 220


>gi|170743255|ref|YP_001771910.1| flagellar biosynthetic protein FliR [Methylobacterium sp. 4-46]
 gi|168197529|gb|ACA19476.1| flagellar biosynthetic protein FliR [Methylobacterium sp. 4-46]
          Length = 252

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 124/228 (54%), Gaps = 3/228 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            RVG+ +ML+PG+  + +  ++RL FA+  ++VL PF+   +  Q     A    L+  E
Sbjct: 17  ARVGTLVMLMPGIGETVVAPRLRLAFALLVALVLFPFVRPLLPQQAGTGPALIGVLIG-E 75

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G V GL +R     LQ TG++++  +GL    ++  + S  +  L S + ++G+  +
Sbjct: 76  IAVGLVLGLSVRAVLAALQTTGTIVAQQLGLAYAMTVDPTTSGQQATLGSFLTMLGITLV 135

Query: 137 WVIDFHHQVFYALVKSYGTIP-IGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              D HH     +  SY  +P IG     G+  +  +  +   F + +++++PF+ F I+
Sbjct: 136 LAADLHHLAIAGIRDSYALMPPIGVPAT-GDAAAFAIRAVARGFALAVQIAAPFIAFGIL 194

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           FN+ +G+L++L+PQ+ ++F++TP  I +G   L  S+ +++  F    
Sbjct: 195 FNLGLGVLSRLMPQMQVFFVATPASILIGMAVLLASLGVVMGVFVEDL 242


>gi|170748649|ref|YP_001754909.1| flagellar biosynthetic protein FliR [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655171|gb|ACB24226.1| flagellar biosynthetic protein FliR [Methylobacterium radiotolerans
           JCM 2831]
          Length = 253

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 117/223 (52%), Gaps = 2/223 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+G+ IML+PG+    +  ++RL FA+  ++VL P +   +     V       L+  E
Sbjct: 17  ARIGTLIMLMPGIGEQTVSPRLRLAFALLTALVLFPTVRPLLGGTEGVAGPRLIGLLFGE 76

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G V GL +R+    LQ  G +IS  +GL+   ++  S    +  + + + ++G+  +
Sbjct: 77  TIIGLVLGLTVRMILAALQTAGVIISAQVGLSYAMTVDPSQGGQQVAIGNFLSLLGITLI 136

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
           +  D HH     + +SY  +P     +F +        L   F + +++S PF+ F I+F
Sbjct: 137 FAADLHHLAIEGVARSYEVLPPDGVPSFSDALMLATKALARGFTLAVQISGPFIAFGILF 196

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFL--CLSIEIIVY 237
           N+ +G+L++L+PQ+ ++F++ P  + +G L L  CL + + V+
Sbjct: 197 NLGLGVLSRLMPQMQVFFLAVPASVLIGMLLLMGCLGVMMGVF 239


>gi|167645348|ref|YP_001683011.1| flagellar biosynthesis protein FliR [Caulobacter sp. K31]
 gi|167347778|gb|ABZ70513.1| flagellar biosynthetic protein FliR [Caulobacter sp. K31]
          Length = 251

 Score =  101 bits (252), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 116/205 (56%), Gaps = 1/205 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G+ +ML+PG+  + +P ++RL FA+  +I+L P +  +I      +    +  V
Sbjct: 15  LVFARIGAMVMLMPGVGEAVVPPRIRLSFAVLMAILLAPLVSSSITTVPS-SVGAVAGAV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G++++++   L   G +IS    L+   +   + + + T + + + ++GL
Sbjct: 74  IHEVLIGLMIGMVLKLFVSSLTTAGEIISIQTTLSFAQTANPAGAPSSTAVATFLSMLGL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + + V D HH    A+VKSY   P  + +   +  +  V  +  +F + ++L++P L F 
Sbjct: 134 VLIMVTDLHHLFIGAMVKSYDIFPFSRAIPVNDAATLAVRTVADSFKLGVQLAAPVLVFS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTP 218
           IVFN++ GL+ +++P   I+F+++P
Sbjct: 194 IVFNLATGLVGRVMPSFQIFFVTSP 218


>gi|144900465|emb|CAM77329.1| Type III secretion system inner membrane R protein
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 254

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 131/238 (55%), Gaps = 9/238 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSK 71
           FLI  R+G+ +M++PGL  S +P +VRL FA+A S+VLLP L   +  L N ++  ++  
Sbjct: 14  FLIFTRIGAALMIVPGLGGSLVPTRVRLIFALAMSLVLLPVLGGGLPPLPNRLSNLFF-- 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI- 130
           L+  E  +G   G+L +     L   G+ I   +GL    S    D++AE   ++L    
Sbjct: 72  LIGSEAMIGVYLGILTQTLMSTLHVAGTFIGFQVGLTNAFSY---DAVAEQQSSTLTAFF 128

Query: 131 --IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
               L+A++V + HH +  A+  SY  +  GQ L  G+   +   +L  +F   L+L++P
Sbjct: 129 TNTALIAIFVTNLHHLMIEAIAGSYAVMVPGQPLPLGDFAETLSKLLSASFNFALQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            L F I++N+++GL+++L PQI ++FI+ P  +  G   + +++ +I+  F   F  G
Sbjct: 189 LLAFGIIYNVALGLMSRLSPQIQVFFIALPLQVMAGLWMMMVALPLIIILFLRWFQDG 246


>gi|220925377|ref|YP_002500679.1| flagellar biosynthetic protein FliR [Methylobacterium nodulans ORS
           2060]
 gi|219949984|gb|ACL60376.1| flagellar biosynthetic protein FliR [Methylobacterium nodulans ORS
           2060]
          Length = 254

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 124/232 (53%), Gaps = 5/232 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L   RVG+ IML+PG+  + +  ++RL FA+  ++VL P +   +   +        
Sbjct: 11  SYLLTFARVGTLIMLMPGIGEAVVSPRLRLAFALLVALVLFPAVRPLLPQPD--GAGAGP 68

Query: 71  KLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +L+ V   E+ +G V GL +R     LQ TG++I+  +GL    ++  + +  +  L + 
Sbjct: 69  RLIGVLIGEVAVGLVLGLSVRAVLAALQTTGTIIAQQLGLAYAMTVDPTAAGQQATLGTF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++G+  +   D HH     +  SY  +P       G+     +  +   F + +++S+
Sbjct: 129 LTLLGITLVLAADLHHLAIAGIRDSYALMPPVGVPATGDAADLVIRAVARGFALAVQISA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           PF+ F I+FN+ +G+L++L+PQ+ ++F++TP  I +G + L  +I +++  F
Sbjct: 189 PFIAFGILFNLGLGVLSRLMPQMQVFFVATPASILIGMMVLLATIGVVMGVF 240


>gi|23016624|ref|ZP_00056378.1| COG1684: Flagellar biosynthesis pathway, component FliR
           [Magnetospirillum magnetotacticum MS-1]
          Length = 254

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 117/236 (49%), Gaps = 5/236 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  R+G+ +ML PGL  S +  ++RL  A+A + V++P +         V ++    L
Sbjct: 14  FLVFTRIGAALMLFPGLGGSLVSTRIRLLLALAVAFVIMPVVAPVFPA---VPKSVGGML 70

Query: 73  VMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           + V  E  +G   G ++      L   GS+I    GL    S           L   +  
Sbjct: 71  LSVFGEAVVGAYIGTVVMFIMSTLNMAGSMIGYQTGLTNAFSFDPISQQQSQLLTGFLSN 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           IGL+A++  D HH +F A  +SY   P GQ L FG+   +  ++   TF +  + ++P +
Sbjct: 131 IGLVAVFATDLHHLMFQAAYESYALFPPGQPLQFGDYAETLGHLATDTFKVGTQFAAPLV 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            F +VF   +GLL++LVPQ+ ++F++ P  + +G     ++I +++  F   F  G
Sbjct: 191 VFGLVFYTGLGLLSRLVPQLQVFFVAMPVQVMVGMWLFMVTIPLVISLFLRFFESG 246


>gi|83309717|ref|YP_419981.1| flagellar biosynthesis protein FliR [Magnetospirillum magneticum
           AMB-1]
 gi|82944558|dbj|BAE49422.1| Flagellar biosynthesis pathway [Magnetospirillum magneticum AMB-1]
          Length = 254

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 122/239 (51%), Gaps = 11/239 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  R+G+ +ML PGL  S +  ++RL  A++ + V+LP +  +      V R+    L
Sbjct: 14  FLVFTRIGAALMLFPGLGGSLVSTRIRLLLALSVAFVMLPVVGASFPA---VPRSVGGML 70

Query: 73  VMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           + V  E  +G   G +I      L   GS+I    GL    S    D +A+     L G 
Sbjct: 71  LAVFGEAVVGVYLGTVIMFIMSTLNMAGSMIGYQTGLTNAFSF---DPIAQQQSQLLTGF 127

Query: 131 ---IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              IGL+A++  D HH +F A+ +SY   P GQ L FG+   +  ++   TF +  + ++
Sbjct: 128 LANIGLVAVFATDMHHLMFQAVFESYYLFPPGQPLQFGDYAETLGHLATDTFKVGTQFAA 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P + F +VF   +GLL++LVPQ+ ++F+  P  + +G     +++ +++  F   F  G
Sbjct: 188 PLVVFGLVFYTGLGLLSRLVPQLQVFFVGMPVQVMVGMWLFMVTMPLVISLFLRFFESG 246


>gi|329849683|ref|ZP_08264529.1| flagellar biosynthetic protein FliR [Asticcacaulis biprosthecum
           C19]
 gi|328841594|gb|EGF91164.1| flagellar biosynthetic protein FliR [Asticcacaulis biprosthecum
           C19]
          Length = 273

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSKL 72
           LI+ R+ S IML+PGL    +P ++R+  A+  ++V+ P + +T+  L N +       +
Sbjct: 33  LILLRLASMIMLMPGLGDQAVPARLRIGLALMLALVITPIVGNTLPPLPNSLGDML--GI 90

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + E+ +G + G L+RV    L   G ++S    L+   +   + +   T L + + ++G
Sbjct: 91  ALHEIIIGLMIGTLMRVLIFALVIAGEIMSLQTTLSFAQTANPAQAQPSTSLGTFLAMLG 150

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++ ++  + HH    A+V SY      +++  G+  +  +  +  TF++ L++S+P + F
Sbjct: 151 MVLIYATNLHHLFIRAMVDSYQVFAPTRDVMVGDATTLMLQTVTKTFLLALQMSAPLIAF 210

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
            ++FNI+ G + +++P  P++F +TP   L GL  + L L    +V+   +  L  +F
Sbjct: 211 ALIFNIATGFIGRMMPNFPVFFAATPVSVLAGLSIMALGLGATGMVFIEHYEELLAYF 268


>gi|299131772|ref|ZP_07024967.1| flagellar biosynthetic protein FliR [Afipia sp. 1NLS2]
 gi|298591909|gb|EFI52109.1| flagellar biosynthetic protein FliR [Afipia sp. 1NLS2]
          Length = 259

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 111/207 (53%), Gaps = 5/207 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAYYSK 71
           L+  R+G+ +MLLPG   + +P+++RL  A+  ++++LP       +DL +  +      
Sbjct: 17  LVFARIGAMMMLLPGFGEANVPVRLRLGIALMLTLIMLPLHRAAYHVDLSSMTS---VMV 73

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ E+ +G V G   R     L   GS+I+  +GL   T++  +       + + + I+
Sbjct: 74  LMVHEIIVGVVLGATARFTLAALSVAGSIIAQQVGLGFVTAVDPTQDQQSVIVANFLTIL 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           G+  ++  D H+ V  AL  SY     G+ +  G++ +         F I ++LS+PF+ 
Sbjct: 134 GIALIFATDTHYLVLAALSDSYTLFSPGELMPSGDVAALATKAFTVAFKIGVQLSAPFII 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTP 218
           F +VFN+ +G+L +++PQ+ +YF+  P
Sbjct: 194 FGLVFNLGLGMLARMMPQMQVYFVGVP 220


>gi|254292631|ref|YP_003058654.1| flagellar biosynthetic protein FliR [Hirschia baltica ATCC 49814]
 gi|254041162|gb|ACT57957.1| flagellar biosynthetic protein FliR [Hirschia baltica ATCC 49814]
          Length = 247

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 111/212 (52%), Gaps = 3/212 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSKL 72
           L+ CR+GS +ML PG   S +P Q RL  A+  ++ L+P L D +  +   V+++    L
Sbjct: 9   LLFCRIGSVLMLAPGWGESSVPAQFRLSAALLATMALVPNLIDQMPPVPELVSQSAL--L 66

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ E+ +G + G   R+    LQ  G +I  + GL + T    +   +   +   + +  
Sbjct: 67  IISEILIGIMMGAGARILMSALQVGGQIIGISSGLAMATQFDPTIGSSSAIIGVFMSMTA 126

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           ++ + +   H  +  A V SY     G+ L  G+     +  + + F + L++++P L  
Sbjct: 127 IVLIMIAGIHRDMLQAAVDSYQLFKPGEPLPIGDAAQWELGAMSSAFKLGLQIAAPILVV 186

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +VFN+SIGL+ +L+PQ+ ++FI+ P  + LG
Sbjct: 187 ALVFNLSIGLVARLIPQVQVFFIAMPIQVMLG 218


>gi|85716546|ref|ZP_01047516.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696547|gb|EAQ34435.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 256

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 114/210 (54%), Gaps = 5/210 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  R+G+ +MLLPG    +IP++V+L  A+  ++++LP       +D Q+    A 
Sbjct: 14  AFMLVFARIGAMVMLLPGFGEGFIPVRVKLAIALLLTLIILPLHRTAYHVDTQSI---AP 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + L++ E+ +G V G   RV    L   GS+I+  +GL   TS+  +       + + +
Sbjct: 71  LTVLLVHEIIIGVVLGATARVTLAALHVAGSIIAQQLGLGFVTSVDPTQGQQGALMGNFL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  L+  D H+ V  AL  SY     G+ +  G++ +         F I L+LS+P
Sbjct: 131 TLLGIALLFATDTHYLVIAALNDSYKIFSPGELMPSGDVAALATRAFAGAFKIGLQLSAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           FL F +VFNI +G+L +L+PQ+ +YF+  P
Sbjct: 191 FLVFGLVFNIGLGVLARLMPQMQVYFVGVP 220


>gi|92116949|ref|YP_576678.1| flagellar biosynthesis protein FliR [Nitrobacter hamburgensis X14]
 gi|91799843|gb|ABE62218.1| flagellar biosynthetic protein FliR [Nitrobacter hamburgensis X14]
          Length = 256

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 120/221 (54%), Gaps = 5/221 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  R+G+ +MLLPG    +IP++V+L  A+  ++++LP       +D+Q+    A 
Sbjct: 14  AFMLVFARIGAMVMLLPGFGEVFIPVRVKLAIALLLTLIILPLHRSAYHVDMQSV---AP 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + L++ E+ +G V G   RV    L   GSVI+  +GL   TS+  +       + + +
Sbjct: 71  LAVLMVHEIIIGVVLGATARVTLAALSVAGSVIAQQLGLGFVTSIDPTQGQQGALMGNFL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  L+  D H+ V  AL  SY     G+ +  G++ +         F I L+LS+P
Sbjct: 131 TLLGIALLFATDTHYLVIAALNDSYKIFSPGELMPSGDVAALATRAFAAAFKIGLQLSAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC 229
           FL F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L 
Sbjct: 191 FLVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIFIGFVILA 231


>gi|27380921|ref|NP_772450.1| flagellar biosynthesis protein FliR [Bradyrhizobium japonicum USDA
           110]
 gi|27354087|dbj|BAC51075.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 256

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 123/231 (53%), Gaps = 5/231 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  RVG+ +MLLPGL  + IP +V+L  A+  ++++LP       +D+ +    A 
Sbjct: 14  AFMLVFARVGAMVMLLPGLGETNIPTRVKLSIALLLTLIILPLHRSAYHVDMGSL---AP 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G V G   RV    LQ  GSVI+  +GL   TS+  +       + + +
Sbjct: 71  LLVLMLHEIAIGIVLGATARVTLSALQVAGSVIAQQMGLGFVTSVDPTQGQQGVLVGNFL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  L+  D HH V  AL  SY     G+ ++ G++ S         F + L+LS P
Sbjct: 131 TMLGVTLLFATDSHHLVIAALNDSYAIFSPGETVSSGDVASLATRAFAAAFRLGLQLSGP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           FL F +VFNI +G+L +L+PQ+ +YF+  P  I  G L L + +  ++  F
Sbjct: 191 FLVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIFAGFLVLAVVLTAMMGTF 241


>gi|315498432|ref|YP_004087236.1| flagellar biosynthetic protein flir [Asticcacaulis excentricus CB
           48]
 gi|315416444|gb|ADU13085.1| flagellar biosynthetic protein FliR [Asticcacaulis excentricus CB
           48]
          Length = 268

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 115/225 (51%), Gaps = 1/225 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ +  +I  RVGS  +L+PGL    +P ++RL FA  F+++L+P +   +         
Sbjct: 23  VVFTAMMIFVRVGSVAILIPGLGDQAVPPRMRLSFAFVFTLMLVPVVQSQMPALP-PKLG 81

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             + L++ E  +G + G+L+R +   L   G V+S    L+   +   + +   T + + 
Sbjct: 82  AMAGLIIHEAVIGLMLGMLMRTFLGALAIAGEVVSLQTTLSFAQTANPAQAQPSTSIGTF 141

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++GL+ ++  + HH     +  SY   P  + +  G+     +  +  TFM+ +++++
Sbjct: 142 LAMLGLVLIYATNLHHLFIAGMRDSYWVFPPMRPVMVGDATQLMIRTVGDTFMLAIQMTT 201

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           P L F ++ N++ G + +++P  PI+F  TP  + LG     LS+
Sbjct: 202 PILVFGLIINVAAGFIGRIMPAFPIFFAVTPVSVLLGLAIFALSL 246


>gi|218515804|ref|ZP_03512644.1| flagellar biosynthesis protein FliR [Rhizobium etli 8C-3]
          Length = 161

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 3/125 (2%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI L+P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIALMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G    T  G +D + 
Sbjct: 61  AVHTGAGTYIGLIFSESLVGLMYGMLARIYTLGMQFAATIIAMMVGY---TQPGSADVIE 117

Query: 121 ETPLN 125
           + P N
Sbjct: 118 DAPEN 122


>gi|254470011|ref|ZP_05083415.1| flagellar biosynthetic protein FliR [Pseudovibrio sp. JE062]
 gi|211960322|gb|EEA95518.1| flagellar biosynthetic protein FliR [Pseudovibrio sp. JE062]
          Length = 257

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 121/228 (53%), Gaps = 3/228 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           +I++S  L+  R+G+ IML+P    ++IP++VRL  A+  + V LP   +        + 
Sbjct: 10  VIVVSFLLMFARIGTMIMLVPAFGETFIPVRVRLTIALLLTYVFLPINSNLYPDDVMSSL 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-N 125
                L+  EL +G   GL +++ +  L   G++++   GL        ++S  +  L  
Sbjct: 70  PKLLALLGGELMVGFFIGLSMKLISYALSVAGTIMANQSGLAFAMGGDATNSGQQGALMG 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           + + ++G+  ++V + H+ +  A+  S+   P G  L  G++ +  V  +   F + +RL
Sbjct: 130 NFLNVLGICMVFVTNLHYVMIAAMQDSFVLFPPGNPLPVGDLSTLAVETVTHMFSVAVRL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLS 231
            +PF+   IVF  S+GLLNKL+PQ+ I+FI+ P   +IG G   L LS
Sbjct: 190 GAPFIVVGIVFYFSLGLLNKLMPQMQIFFIAMPVNIMIGFGIFLLLLS 237


>gi|16125328|ref|NP_419892.1| flagellar biosynthesis protein FliR [Caulobacter crescentus CB15]
 gi|221234067|ref|YP_002516503.1| flagellar biosynthesis protein FliR [Caulobacter crescentus NA1000]
 gi|3023777|sp|Q45975|FLIR_CAUCR RecName: Full=Flagellar biosynthetic protein fliR
 gi|535424|gb|AAA66207.1| FliR [Caulobacter crescentus CB15]
 gi|13422378|gb|AAK23060.1| flagellar biosynthesis protein FliR [Caulobacter crescentus CB15]
 gi|220963239|gb|ACL94595.1| flagellar biosynthesis protein FliR [Caulobacter crescentus NA1000]
          Length = 251

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 109/205 (53%), Gaps = 1/205 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  RVG+ +M +PG+    IP ++RL FA+  +++L P + +T+              V
Sbjct: 15  LVFARVGAMVMTMPGIGDQAIPARIRLSFALLMALILAPLVQNTVGPIP-STLGGLGGAV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G ++R++   L   G +IS    L+   S   S   + T + + + ++GL
Sbjct: 74  IHEVLIGLMIGSVLRLFMTSLTTAGEIISMQTTLSFAQSTNPSMEGSSTAVATFLSMLGL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
             +   D HH    A+VKSY   P  + +   +  +  V  +  +F + ++L++P + F 
Sbjct: 134 TLVMATDLHHLFIAAIVKSYTIFPFTRAVPVNDAAALAVQTVAQSFSLGVQLAAPVIVFS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTP 218
           +VFN++ GL+ +++P   I+F+++P
Sbjct: 194 LVFNLATGLVGRIMPAFQIFFVASP 218


>gi|118588697|ref|ZP_01546105.1| flagellar biosynthesis protein R [Stappia aggregata IAM 12614]
 gi|118438683|gb|EAV45316.1| flagellar biosynthesis protein R [Stappia aggregata IAM 12614]
          Length = 257

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 108/212 (50%), Gaps = 1/212 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G+ +MLLP L  S IP + RL  A+A ++VL P       ++   N      L+
Sbjct: 17  LMFARLGTMVMLLPALGESTIPTRFRLTIALALTMVLYPVGSQYYPVEVTSNTYRMIALL 76

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIG 132
             E+ +G   GL  ++ T  LQ  G +++   GL        ++   +  L  + + I+G
Sbjct: 77  FGEVAIGLGIGLCAKMITSVLQIAGMIMANQSGLAFALGTDFANQGQQGALFGNFLSILG 136

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +  ++V D H+ V  AL  S+   P G     G+   +    +   F I +R+S+PFL  
Sbjct: 137 ITLVFVSDSHYLVIAALHDSFMIFPPGLAPPVGDFSQNATETVAHVFSIAVRMSAPFLVV 196

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +VF   +GLLNKL+PQ+ I+FI+ P  I +G
Sbjct: 197 GLVFYFGLGLLNKLMPQMQIFFIAMPVNIAIG 228


>gi|163794130|ref|ZP_02188103.1| flagellar biosynthetic protein FliR [alpha proteobacterium BAL199]
 gi|159180744|gb|EDP65263.1| flagellar biosynthetic protein FliR [alpha proteobacterium BAL199]
          Length = 255

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 127/222 (57%), Gaps = 2/222 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            + L+  R  + ++LLPG+   +IP++VRL FA+A ++ + P +   +  +   + A   
Sbjct: 13  QIMLVFARTSAVLLLLPGIGEVFIPVRVRLLFAVALALAVAPVIAPQLPPEP-TSAAGLL 71

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            LV+ E+ +G   GL+ R+  L L   G VIS + GL   T    S S   + +  ++ +
Sbjct: 72  TLVVGEVLIGLYFGLVARILWLTLDTAGRVISFSTGLASATVFNPSLSEQGSAIGLVLTL 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +G++ L++ D HH V  A+V+SY     G EL  G+   +   ++  +F + ++LS+PF 
Sbjct: 132 LGIMMLFIADLHHMVIRAVVESYAVFRPGGELMIGDFSEAITELVSGSFKVAVQLSAPFF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
            F ++F +++G+L +L+PQ+ I+FI  P  I LG LF+ ++I
Sbjct: 192 VFGLLFFVTLGVLARLMPQLQIFFIGLPAQIYLG-LFVWVTI 232


>gi|84502406|ref|ZP_01000542.1| flagellar biosynthesis protein [Oceanicola batsensis HTCC2597]
 gi|84389218|gb|EAQ02015.1| flagellar biosynthesis protein [Oceanicola batsensis HTCC2597]
          Length = 250

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 115/233 (49%), Gaps = 8/233 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS--K 71
           L+  R+G+ +M LPG   S++ ++ RL  A+  S+V+ P +      Q  V  +     +
Sbjct: 16  LVFGRIGAAMMFLPGFGESFVFVRHRLAAAVLLSLVITPLV-----AQGPVPSSPTDLVR 70

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            + VE+ LG   GL  RV    +Q  G+ I    GL+   +  I      T + + + + 
Sbjct: 71  AMAVEVTLGIWIGLAARVLLTAMQVAGAQIGMVSGLSNAFAPDIGSFQGSTLIATALLLG 130

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +  ++  D HH +  AL++SY T P G  L  G++        QT   I L +++PF  
Sbjct: 131 AVAVIFAADIHHLIIEALIESYFTFPPGL-LMPGDLAEQMAMAAQTALHIGLSVAAPFYV 189

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             +V N+ +GL N+++P +P++F++ P LI  G   L L++   +  F   F+
Sbjct: 190 MGVVLNVGLGLTNRMLPSLPVFFVAAPVLIAAGLFVLVLAVPTAIRTFMTRFV 242


>gi|328543169|ref|YP_004303278.1| flagellar biosynthetic protein fliR [polymorphum gilvum
           SL003B-26A1]
 gi|326412915|gb|ADZ69978.1| Flagellar biosynthetic protein fliR [Polymorphum gilvum
           SL003B-26A1]
          Length = 257

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 113/218 (51%), Gaps = 8/218 (3%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
           PEI  +   LI  R+G+ +MLLP L  S IPM++RL  A+A ++V  P            
Sbjct: 9   PEIAAV-FMLIFARLGTMLMLLPALGESSIPMRLRLTVALALTLVFYPIGARAYPAGLVS 67

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           +      L+  EL +G   GL  R+ T  LQ  G +I+     +L +++G +D       
Sbjct: 68  DPGGLGILLAGELAIGFGIGLCARMITSVLQIAGMIIANQS--SLASALG-TDVTMSGQQ 124

Query: 125 NSLIG----IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
            +L+G    I+G+  ++V D H  +  AL  S+   P G+ L   +  +    ++   F 
Sbjct: 125 GALVGNFLAILGVTLVFVTDTHFLIIAALHDSFTLFPPGEWLPVADFATLATQIVAGMFS 184

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           I +R+S+PFL   +VF   +GLLNKL+PQ+ I+FI+ P
Sbjct: 185 IAVRMSAPFLVVGLVFYFGLGLLNKLMPQMQIFFIAMP 222


>gi|39936945|ref|NP_949221.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           CGA009]
 gi|192292773|ref|YP_001993378.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           TIE-1]
 gi|39650802|emb|CAE29325.1| putative flagellar biosynthetic protein FliR [Rhodopseudomonas
           palustris CGA009]
 gi|192286522|gb|ACF02903.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           TIE-1]
          Length = 255

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 121/228 (53%), Gaps = 5/228 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAYYSK 71
           L+  R+G+ +ML+P    S IP +V+L  A+  ++++LP       ID+ +         
Sbjct: 17  LVFARIGAMVMLMPTFGESNIPTRVKLSIALLLTLIMLPLHRSAYQIDMSSLTPLLV--- 73

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ E+ +G V G   RV    LQ  G+VI+  +GL   +++  +       + + + ++
Sbjct: 74  LMLQEIAVGIVLGATARVTLSALQVAGAVIAQQLGLGFVSAVDPTQGQQGVVVGNFLTML 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           G+  L+  D H+ V  AL  SY     G+ L+ G++ +         F + L+LS+PFL 
Sbjct: 134 GVTLLFATDMHYLVIQALSDSYKVFAPGELLHTGDVAALATKAFAAAFKLGLQLSAPFLV 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L + +  ++  F
Sbjct: 194 FGLVFNIGLGVLARLMPQMQVYFVGVPLSIVIGFIVLAVVLTTMMGAF 241


>gi|89056678|ref|YP_512129.1| flagellar biosynthetic protein FliR [Jannaschia sp. CCS1]
 gi|88866227|gb|ABD57104.1| flagellar biosynthetic protein FliR [Jannaschia sp. CCS1]
          Length = 256

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 120/241 (49%), Gaps = 11/241 (4%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EI + +   +  RVG+C ++LPGL    IP++VRL  A+AF++ L P +   + +   + 
Sbjct: 13  EIWLATGIAVFLRVGACFLVLPGLGEQMIPVRVRLGAALAFTVFLTPAMQPVLSVSAVIP 72

Query: 66  --RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
              A++S     E   G + G+ +R     LQ  G++ + +  L+        D L   P
Sbjct: 73  PLTAFFS-----EAIAGLIIGMALRYLVHALQVAGTIAAQSTSLSQILGGATPDPL---P 124

Query: 124 LNSLIGIIGLLALWVID-FHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
               I ++G L L VI   H  +    + SY  +P G      ++    V+ +  +F + 
Sbjct: 125 AMGAILMLGGLTLAVISGLHVHLVQTFLHSYDVLPFGNLPGPRDLAGWSVDQVSASFSLA 184

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + L++PFL   +++N+++G++NK +PQ+ + F+  P +   G   L ++   I+  + H+
Sbjct: 185 VSLAAPFLVASLLYNVALGVINKAMPQLMVAFVGAPAITWGGLFLLLITTPFILPVWLHA 244

Query: 243 F 243
           F
Sbjct: 245 F 245


>gi|114765218|ref|ZP_01444350.1| flagellar biosynthesis protein [Pelagibaca bermudensis HTCC2601]
 gi|114542353|gb|EAU45381.1| flagellar biosynthesis protein [Roseovarius sp. HTCC2601]
          Length = 251

 Score = 88.6 bits (218), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 116/233 (49%), Gaps = 9/233 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G  +M +P L  + IP++ RL F +  S+ L P +      Q  V+      LV
Sbjct: 16  LVFARIGGMLMFVPALGETVIPVRHRLAFGVLLSLALYPAVP-----QGPVSLDAPGPLV 70

Query: 74  ---MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
               +EL LG   G+  R+    L+F G  I    GL+   S  +      T +++ + +
Sbjct: 71  GALAIELTLGLWIGVTARILLSALEFAGYQIGLVSGLSNAFSPSLGSFQGSTLISTGLML 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            G+  ++  D HH +  A+V SY   P GQ L   ++    V  +  +F + L + +PF 
Sbjct: 131 GGVAMIFATDLHHLIIGAMVSSYDLFPPGQILP-SDLAQQIVKAVSQSFYLGLSIVAPFY 189

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              ++ N+ +GL  +++P +P++F++ P LI  G L L ++  +++ +F+  F
Sbjct: 190 VMGLLVNLGMGLAARMMPSLPVFFVAAPVLIMAGLLVLVMATPVMLREFAERF 242


>gi|254461302|ref|ZP_05074718.1| flagellar biosynthetic protein FliR [Rhodobacterales bacterium
           HTCC2083]
 gi|206677891|gb|EDZ42378.1| flagellar biosynthetic protein FliR [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 253

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 117/233 (50%), Gaps = 4/233 (1%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +S  L++ RV + + LLP L  + IP +V+L  ++  S+++ P + D    QN +  A +
Sbjct: 14  LSFILVLFRVAALVSLLPALGEASIPARVKLVMSVCMSLIVFPIVHDVS--QNSLAGANW 71

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
               + E+ +G   G ++RV+   LQ  GS+ + +   +L   +G + +     L  +I 
Sbjct: 72  LSAAIAEVGIGLWFGFMLRVFVFCLQIAGSIAAQST--SLSQILGSAGAEPLPALGHVIT 129

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
             G+     +  H      L+ SY  +P GQ  +   I  + V  +   F +   L++PF
Sbjct: 130 TAGMTLALSLGLHVSAVQYLIGSYTILPTGQLPDISTISEAGVAQIAWGFQLAFSLAAPF 189

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
               +++N+++G++N+ +PQ+ + F+  P +     + L +SI +I+  ++ +
Sbjct: 190 FILSLLYNLTLGVINRAMPQLMVAFVGAPVITAGALVLLAISIPVILKTWAGA 242


>gi|209884539|ref|YP_002288396.1| flagellar biosynthetic protein FliR [Oligotropha carboxidovorans
           OM5]
 gi|209872735|gb|ACI92531.1| flagellar biosynthetic protein FliR [Oligotropha carboxidovorans
           OM5]
          Length = 258

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 121/239 (50%), Gaps = 23/239 (9%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           ++  +  L+  RVG+ +MLLPG   + +P+++RL  A+  +++LL            ++R
Sbjct: 10  VLAATFMLVFARVGAMMMLLPGFGEANVPVRLRLGIALLLAMILL-----------PLHR 58

Query: 67  AYYS------KLVMV----ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS 116
           A Y         VM+    E+ +G V G   R     L   GS+I+  IGL   T++  +
Sbjct: 59  AAYHVDLTSINAVMILMVHEIIIGVVLGATARFTLAALSVAGSIIAQQIGLGFVTAVDPT 118

Query: 117 DSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ 176
                  L + + I+GL  ++  D H+ V  AL  SY     G+ +  G++ +       
Sbjct: 119 QDQQSVILANFLTILGLTLIFATDTHYLVIAALNDSYTLFQPGELMPSGDVAALATKAFT 178

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
             F I ++L++PF+ F ++FN+ +GLL +++PQ+ +YF+  P  I  G  FL L I ++
Sbjct: 179 MAFTIGVQLAAPFIIFGLIFNLGLGLLARMMPQMQVYFVGVPLSILAG--FLLLGIVLV 235


>gi|126738572|ref|ZP_01754277.1| flagellar biosynthetic protein FliR [Roseobacter sp. SK209-2-6]
 gi|126720371|gb|EBA17077.1| flagellar biosynthetic protein FliR [Roseobacter sp. SK209-2-6]
          Length = 259

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 122/219 (55%), Gaps = 10/219 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           ++  RV +   +LP     Y+PM+V+L  A+AF+ V+ P L   I   + V    + +LV
Sbjct: 23  IVFLRVAAMSSVLPAFGEQYVPMRVKLAIAIAFTFVVAPAL-PQIGAPDHV--VLFGRLV 79

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E  +G   G+ +R++ +GLQ  G++ + +  L+ Q   GI       P    + ++G 
Sbjct: 80  VSEAIIGLALGMGVRLFIMGLQTAGTIAAQSTSLS-QVLGGIGAE--AMPAIGAVLMVGG 136

Query: 134 LALWVI-DFHHQVFYALVKSYGTIPIGQELNFGNIFSSF-VNMLQTTFMIMLRLSSPFLF 191
           LAL V+   H ++   L+ SY   P+G E    ++FS + V+ +  +F +   L++PFL 
Sbjct: 137 LALAVMMGLHVRIAEFLIYSYQFFPVG-EFPAASMFSKWGVHRISQSFYMAFTLAAPFLV 195

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
             +++N+++G++N+ +PQ+ ++F+  P +I LG + + +
Sbjct: 196 TAVIYNLTLGVINRAMPQLMVFFVGAP-VITLGGMLILM 233


>gi|154253016|ref|YP_001413840.1| flagellar biosynthesis protein FliR [Parvibaculum lavamentivorans
           DS-1]
 gi|154156966|gb|ABS64183.1| flagellar biosynthetic protein FliR [Parvibaculum lavamentivorans
           DS-1]
          Length = 253

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 108/208 (51%), Gaps = 7/208 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ + IML+P L  + IP QVRL  A+  S V++P +  +         A    LV
Sbjct: 16  LVFSRLAAMIMLMPALGEASIPAQVRLMLALLLSFVMMPLVAGSYG----AIPATVPGLV 71

Query: 74  MV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +   E+ +G   G   R+    L   G++I+  + L+   ++  S       + + + +
Sbjct: 72  FIVCSEIAVGLFIGTAARLIMSALHVAGNIIAAQMSLSFAMNVDPSQGQQGVLIANFLSL 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +G+  ++  +  H +  A+  SY     G+ +  G+  +  V M+  +F + L+L++PFL
Sbjct: 132 LGVTLIFATNLDHVLIAAMRDSYELFKPGEPIPVGDFLAMAVKMVSGSFRLGLQLAAPFL 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F ++F + IG+L++L+PQI I+FI+ P
Sbjct: 192 VFGLIFYLGIGILSRLMPQIQIFFIAMP 219


>gi|254473504|ref|ZP_05086901.1| type III secretion system inner membrane R protein [Pseudovibrio
           sp. JE062]
 gi|211957620|gb|EEA92823.1| type III secretion system inner membrane R protein [Pseudovibrio
           sp. JE062]
          Length = 227

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 108/212 (50%), Gaps = 7/212 (3%)

Query: 24  MLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL---VMVELFLG 80
           M +PG S   + +QVRL  A++ ++ + P +   + ++  ++ A   +L   + VEL +G
Sbjct: 1   MAMPGFSSPRVMVQVRLFIAISATLAISPLI--LVLVEPIISAASLDELLRIIFVELLIG 58

Query: 81  CVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVID 140
            +     R +   LQ      + A   N Q +  + +     P+  LI +     L++  
Sbjct: 59  FLIAAFGRAFFGMLQMMAGAAANASSFN-QPAPIVEEFQQLPPMAGLITLTATAMLFITG 117

Query: 141 FHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISI 200
            H  VF  L +SY  IP+G +         F   L    ++ LR++SPFL + IV N+++
Sbjct: 118 AHADVFIGLAESYQAIPVGGDFVPSAAVDQFSTKLMQGLLLALRITSPFLIYGIVVNLTL 177

Query: 201 GLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           GL N+L+PQ+P+YF++ P ++ +G LF+   I
Sbjct: 178 GLTNRLMPQMPVYFVALPVVV-MGGLFVLWQI 208


>gi|83858791|ref|ZP_00952313.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853614|gb|EAP91466.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
          Length = 252

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 117/230 (50%), Gaps = 1/230 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           ++  R+G  +ML+PG+  + IP+++RL FA+AFS V+ P +  ++        A  +  V
Sbjct: 16  MVFARMGGILMLMPGIGETSIPVRLRLAFALAFSFVIGPIVAPSLPAPP-DTLAGVAITV 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
            +E  +G + G   R+        G +I    GL +  S   +   A       + +I +
Sbjct: 75  GLETLIGVMIGAASRILLTAGAIAGQIIGYQTGLAMAQSFDPAQGQAGVLPAQFLNLIFI 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + + V   H ++  A   SY  +P GQ   +G+     + +    F+I ++++SP + F 
Sbjct: 135 VIVLVTPLHQEMLLAAAGSYELMPAGQPPMWGDAAYWALELFIDAFVIGVQIASPLIVFG 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +VF + +G+L++L+PQ  I+FI+ P  I +G   + +S+  +V  ++  +
Sbjct: 195 LVFYLGLGVLSRLMPQAQIFFIAMPLNILIGFSIMAMSLGAMVMLWTDRY 244


>gi|255263738|ref|ZP_05343080.1| flagellar biosynthetic protein FliR [Thalassiobium sp. R2A62]
 gi|255106073|gb|EET48747.1| flagellar biosynthetic protein FliR [Thalassiobium sp. R2A62]
          Length = 260

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 115/218 (52%), Gaps = 3/218 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           +I  RVG+ + +LPGL    +P +VRL  A+A ++++ P +    DL      +    L+
Sbjct: 21  VIFLRVGAMMAVLPGLGERSVPARVRLGLAIALTVLVTPLIAP--DLPEPEEVSNLVGLL 78

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           ++E  +G + G+ +R++   L   G++ + +  L+ Q   G + + A+  +  ++   GL
Sbjct: 79  LIEASIGLLLGMSLRLFVFTLSTAGAIAAQSTSLS-QIFGGSAGAEAQPAIGHVLVTGGL 137

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
               + + H +V   +V SYG+ P G  L+   +    V+ +  +F     L++PF    
Sbjct: 138 TIAMITELHLRVVEFIVMSYGSFPTGVPLSATFVADFGVSRVAASFAFAFTLAAPFFIAS 197

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLS 231
           +++N+++G++N+ +PQ+ + F+  P +   G + L LS
Sbjct: 198 LIYNVTLGVINRAMPQLMVSFVGAPVITAGGLVLLALS 235


>gi|269836607|ref|YP_003318835.1| flagellar biosynthetic protein FliR [Sphaerobacter thermophilus DSM
           20745]
 gi|269785870|gb|ACZ38013.1| flagellar biosynthetic protein FliR [Sphaerobacter thermophilus DSM
           20745]
          Length = 260

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 120/240 (50%), Gaps = 5/240 (2%)

Query: 1   MTISPEIIMMSL---FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT 57
           MTI+  ++  S+    L+V R+G+ +M +PG +   +P  +++  A+A S+VL+PF    
Sbjct: 1   MTIASPLVPQSIAVFLLMVTRIGTMLMFMPGFAGRSVPPAIKVLAALALSLVLVPFTRP- 59

Query: 58  IDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD 117
              +   + A ++  +  E  LG + G  I V    ++   S++   IGLNL      S 
Sbjct: 60  -GTETLTDPASFTVGLAREFLLGLLMGFGIAVVFGAIEMAASLVGAQIGLNLSGVFNPSL 118

Query: 118 SLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
            L  TPLN+   +   L  +  + HH V  AL +S+ T+PIG      N  ++ + +   
Sbjct: 119 DLQGTPLNTFYLVAAALVFFSANGHHLVLMALHRSFQTVPIGSAALADNAGTAIIALASL 178

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
            F+  LR+  P     +  +  +G+LN++VPQ+ ++F+  P  I  G   L L++  ++ 
Sbjct: 179 MFVDALRIGLPVAGTLLAVDACLGVLNRMVPQMNVFFVGLPVKIFAGFAVLLLTLPFLIR 238


>gi|221640819|ref|YP_002527081.1| Type III secretion system inner membrane R protein [Rhodobacter
           sphaeroides KD131]
 gi|221161600|gb|ACM02580.1| Type III secretion system inner membrane R protein [Rhodobacter
           sphaeroides KD131]
          Length = 260

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 112/211 (53%), Gaps = 11/211 (5%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           +FL+  RVG+ + LLP    + +P++VRL  A+AF+ ++ P L D + +       Y   
Sbjct: 22  VFLVFLRVGAAMALLPPFGETSLPVRVRLAAALAFTAIVFPALSDRVPI-------YDGS 74

Query: 72  LV--MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           L   + E  +G + G  +R++ L LQ  G++ + A   +L    G +    +  + +++ 
Sbjct: 75  LAPLLAETAVGLLLGASLRLFVLALQTAGTIAAQAT--SLAQLFGSTAGEPQPVMTNILT 132

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + GL    V   H Q+   L++SY  +P  +  +  ++ +  + ++  +F +   L+ PF
Sbjct: 133 LAGLALAVVGGLHVQIALFLIQSYDILPAARLPDPADVATWGLTLVVKSFALGFMLAMPF 192

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
           +    +FN+++G++N+ +PQ+ ++F+  P L
Sbjct: 193 VAASFIFNVALGIVNRAMPQLMVFFVGAPAL 223


>gi|89068707|ref|ZP_01156093.1| flagellar biosynthesis protein [Oceanicola granulosus HTCC2516]
 gi|89045670|gb|EAR51732.1| flagellar biosynthesis protein [Oceanicola granulosus HTCC2516]
          Length = 251

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 100/208 (48%), Gaps = 3/208 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+G+  + +PG     +P + RL  A+A ++ L P     I+         +  L+ +E
Sbjct: 19  ARIGAIFVFMPGFGERPVPARFRLFMALAVALALYP--ATGIEPVTLDAPVAFLGLLALE 76

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G   GL  R+    LQF G  I    GL+   +         T +   + +     +
Sbjct: 77  VTIGLWIGLTARIVMSALQFAGYQIGYVAGLSNALAPTTGQFEGATMVAGALMMAATALI 136

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
           +  D HH +  AL+ SY   P+G+ +  G++ +  V  +  +F + L LS PF    IV 
Sbjct: 137 FATDLHHLIIRALLTSYEVFPVGRIMP-GDLAAQTVAAVGASFYVGLALSVPFYVMGIVL 195

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLG 224
           N+ +GL N+++P +P++F++ P LI  G
Sbjct: 196 NVGLGLANRMMPTLPVFFVAGPVLIASG 223


>gi|114777580|ref|ZP_01452561.1| Flagellar biosynthesis protein FliR [Mariprofundus ferrooxydans
           PV-1]
 gi|114552051|gb|EAU54568.1| Flagellar biosynthesis protein FliR [Mariprofundus ferrooxydans
           PV-1]
          Length = 260

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 118/231 (51%), Gaps = 4/231 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV + IM+LP L    +P Q++    +  +I++ P + D +        A+   + 
Sbjct: 16  LVMLRVSALIMMLPILGHQLVPAQIKRGLIVLLTILIFPLVADKVAAIPLKPVAFV-IVA 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +     L  ++    +Q  G +IS  +G+++           ++ ++ L   + +
Sbjct: 75  IHEILVAAAIALFAQLIFAAIQLAGQLISFQMGMSVANVFDPMTHSQQSVVSQLAVTLAM 134

Query: 134 LALWV-IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L LW+ +  HH    AL++S+   PI Q + F  + S+  +   T F++ L++++P +  
Sbjct: 135 L-LWISVGAHHMFITALIESFTLFPIHQAIYFPAL-STLTDAAATMFVLALKIAAPLMVL 192

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  +++GLL++ VPQI ++F+S P  +GLG L   L +   VY  S +F
Sbjct: 193 MTLVYVALGLLSRAVPQIQVFFVSFPLTVGLGLLTFALGMPAFVYLVSDAF 243


>gi|329888174|ref|ZP_08266772.1| flagellar biosynthetic protein FliR [Brevundimonas diminuta ATCC
           11568]
 gi|328846730|gb|EGF96292.1| flagellar biosynthetic protein FliR [Brevundimonas diminuta ATCC
           11568]
          Length = 256

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 115/228 (50%), Gaps = 13/228 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI  RVG+ +MLLPG   SY+P +VRL  A+  S+ L P +  ++        A     V
Sbjct: 15  LIFARVGAILMLLPGFGESYVPPRVRLSLALVLSLALWPIVGASLPALPATLGATVG-WV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL------AETPLNSL 127
           M E+  G   G ++R +   L   G ++S      LQT++G S +         T L++ 
Sbjct: 74  MREVLTGLAIGAILRSFMTALTTAGEIVS------LQTTLGFSQTANPLQAQPGTTLSAF 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++G+  ++  + HH     +V SY  I   + L   +     V  L  +FM+ ++L++
Sbjct: 128 LMLLGVTLVFATNTHHLFIGGMVGSYEAIAPAKPLIVSDFTQMAVKTLSQSFMLGVQLAA 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           P L F ++FN++ GL+ +++P   +YF + P  + LG     LS+ ++
Sbjct: 188 PVLVFALIFNLASGLVARVMPSFQVYFAAAPLSVILGLSVFTLSLGVV 235


>gi|149203119|ref|ZP_01880090.1| flagellar biosynthetic protein FliR [Roseovarius sp. TM1035]
 gi|149143665|gb|EDM31701.1| flagellar biosynthetic protein FliR [Roseovarius sp. TM1035]
          Length = 254

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 117/216 (54%), Gaps = 12/216 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV   I LLPG   S +PM+++L   +AF++++ P L  + DL +   RA    L++ E 
Sbjct: 24  RVAPIIGLLPGFGESSVPMRIKLVLVIAFTLIVTPVL--SPDLAD-QARAPTVGLILSET 80

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII--GLLA 135
            +G   G+ +R++ + LQ  GS+ + +  L       I  + ++TPL ++  ++  G +A
Sbjct: 81  IVGLALGVALRLFLMALQMAGSIAAQSTSLA-----QILGNASQTPLPAIGHLLATGAVA 135

Query: 136 LWVI-DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
           L +I   H ++   +V SYG  P+ +  + G +    V  +   F     L++PF+   +
Sbjct: 136 LMMIMGVHVRLAEMIVLSYGIFPVAEFPDVGTLSQWGVARIAQAFSFGFSLAAPFVLVSV 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           ++N+++G++N+ +PQ+ +  +  P  + L +LFL +
Sbjct: 196 LYNLTLGIINRAMPQLMVVLVGAPAAMAL-TLFLLM 230


>gi|146278645|ref|YP_001168804.1| type III secretion system inner membrane R protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556886|gb|ABP71499.1| type III secretion system inner membrane R protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 258

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 108/210 (51%), Gaps = 11/210 (5%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  RVG+ + LLP      +P +VRL  A+AF+ ++ P + D +        A+    
Sbjct: 22  FLVFIRVGAAMALLPAFGEMTLPARVRLTIALAFTAIVFPAVSDGVP-------AFDGSP 74

Query: 73  VM--VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           V   +E  +G V G+ +R++ L LQ  G+V + A+  +L    G      +  + +++ +
Sbjct: 75  VALGIEAAIGLVLGISLRLFVLALQTAGTVAAQAV--SLSQMFGSPSGEPQPVIGNVLTL 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            GL        H ++   L+ SY  +P  +    G++    ++++  TF +   LS PF+
Sbjct: 133 AGLAIAVAGGLHVRLAEFLILSYDLLPAARLPVAGDVADWGLHLIVHTFALAFMLSMPFV 192

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
               VFN+++G++N+ +PQ+ ++F+  P L
Sbjct: 193 AASFVFNVALGIINRAMPQLMVFFVGAPAL 222


>gi|83944180|ref|ZP_00956636.1| flagellar biosynthesis protein [Sulfitobacter sp. EE-36]
 gi|83955119|ref|ZP_00963775.1| flagellar biosynthesis protein [Sulfitobacter sp. NAS-14.1]
 gi|83840448|gb|EAP79621.1| flagellar biosynthesis protein [Sulfitobacter sp. NAS-14.1]
 gi|83845047|gb|EAP82928.1| flagellar biosynthesis protein [Sulfitobacter sp. EE-36]
          Length = 251

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 105/219 (47%), Gaps = 5/219 (2%)

Query: 1   MTISPEI--IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI 58
           M I P I  +  S F++  R+G+ +M +PG     IP++ RL  A+  S+ LLP      
Sbjct: 1   MAIEPFISTLFFSFFVVFARIGTALMFMPGFGEVQIPVRPRLSLAVLISLSLLPLTPIAS 60

Query: 59  DLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDS 118
            L +    A +  L+  E+ +G   GL  R+    LQF G  +    GL           
Sbjct: 61  ALPDSAVTAVF--LLGAEVLIGLWIGLCARILLSALQFAGFQVGQVSGLANAFGPSFGSF 118

Query: 119 LAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT 178
              T + +L+ +  +  ++V D HH +  AL+ SY   P GQ     ++    + +   +
Sbjct: 119 EGATMVATLLLMSAVTMIFVTDTHHLIIRALLASYQVFPPGQ-FVLADLADQILRVASAS 177

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFIST 217
             I   +++PF    ++ N+ +GL N+++PQ+P++F++ 
Sbjct: 178 LYIGTAIAAPFFVMGVILNLGMGLANRMMPQLPVFFVAA 216


>gi|302384125|ref|YP_003819948.1| flagellar biosynthetic protein FliR [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194753|gb|ADL02325.1| flagellar biosynthetic protein FliR [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 257

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 119/238 (50%), Gaps = 33/238 (13%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL-------LPFLWDTID-LQNFVN 65
           LI  R+G+ ++ LPG+  SY+P ++RL  A+  S+ L       LP L +TI  +  ++ 
Sbjct: 15  LIFARIGAILLSLPGIGESYVPPRIRLSLALVVSLALWPIVSPSLPALPETIGGMVGWII 74

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           R         E+  G + G ++R +T  L   G ++S      LQT++  + +    PL 
Sbjct: 75  R---------EVVTGLMIGAILRAFTGALATAGEIVS------LQTTLSFAQT--ANPLQ 117

Query: 126 SLIG--------IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
           +  G        I+G + ++  + HH     LV SY  I   + L   +     +  +  
Sbjct: 118 AQPGATISAFLMILGTVLVFATNTHHLFIAGLVGSYELIAPARPLIMADFTELAIRTIAD 177

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           +FM+ ++L++P + F ++FN++ GL+ +++PQ  ++F + P  + LG     LS+ ++
Sbjct: 178 SFMLGVQLAAPVIVFALIFNLASGLVARVMPQFQVFFAAAPLSVILGLSIFALSLGVM 235


>gi|126463740|ref|YP_001044854.1| type III secretion system inner membrane R protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332559797|ref|ZP_08414119.1| FliR2 [Rhodobacter sphaeroides WS8N]
 gi|126105404|gb|ABN78082.1| type III secretion system inner membrane R protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332277509|gb|EGJ22824.1| FliR2 [Rhodobacter sphaeroides WS8N]
          Length = 260

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 110/210 (52%), Gaps = 11/210 (5%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  RVG+ + LLP    + +P++VRL  A+AF+ ++ P + D +         Y S +
Sbjct: 23  FLVFLRVGAAMALLPAFGETSLPVRVRLAAALAFTAIVFPAVSDRVP-------TYDSTV 75

Query: 73  V--MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
              + E  +G + G  +R++ L LQ  G++ + A   +L    G +    +  + +++ +
Sbjct: 76  APLLTETAVGLLLGASLRLFVLALQTAGTIAAQAT--SLAQLFGSTAGEPQPVMTNILTL 133

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            GL        H Q+   L++SY  +P  +  +  ++ +  + ++  +F +   L+ PF+
Sbjct: 134 AGLALAVAGGLHVQIALFLIQSYDILPAARLPDPADVATWGLALVVKSFALGFMLAMPFV 193

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
               +FN+++G++N+ +PQ+ ++F+  P L
Sbjct: 194 AASFIFNVALGIVNRAMPQLMVFFVGAPAL 223


>gi|254418936|ref|ZP_05032660.1| flagellar biosynthetic protein FliR [Brevundimonas sp. BAL3]
 gi|196185113|gb|EDX80089.1| flagellar biosynthetic protein FliR [Brevundimonas sp. BAL3]
          Length = 261

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 115/221 (52%), Gaps = 5/221 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID--LQNFVNRAYYSK 71
           LI  R+G+ +ML+PG   +Y+P ++RL  A+  S+ L P + D++    +     A +  
Sbjct: 15  LIFARIGAILMLIPGFGETYVPPRIRLSLALLISLALWPVVRDSLPGLPETLGGMAGW-- 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            V+ E+ +G + G+L+R++   L   G ++S    L+   +     +   + + S + + 
Sbjct: 73  -VIREVVVGLMIGMLLRMFLTSLMTAGEIVSLQTTLSFAQTANPLQAQPGSTVGSFLLLF 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           G+  ++  D HH     +V SY  I   + L  G+     V  L  +F++ ++L++P L 
Sbjct: 132 GVTLIFATDTHHLFIAGMVGSYSLIAPAKPLIMGDFTEMAVRTLGDSFLLGVQLAAPVLV 191

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           F ++FN++ GL+ +++P   +YF + P  + LG     LS+
Sbjct: 192 FALIFNLASGLIARVMPSFQVYFAAAPLSVILGLSIFALSL 232


>gi|77464898|ref|YP_354402.1| flagellar biosynthesis pathway, component FliR [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389316|gb|ABA80501.1| Flagellar biosynthesis pathway, component FliR [Rhodobacter
           sphaeroides 2.4.1]
          Length = 260

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 109/210 (51%), Gaps = 11/210 (5%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  RVG+ + LLP    + +P++VRL  A+AF+ ++ P + D +         Y S +
Sbjct: 23  FLVFLRVGAAMALLPAFGETSLPVRVRLAAALAFTAIVFPAVSDRVP-------TYDSTV 75

Query: 73  V--MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
              + E  +G + G  +R++ L LQ  G++ + A   +L    G +    +  + +++ +
Sbjct: 76  APLLTETAVGLLLGASLRLFVLALQTAGTIAAQAT--SLAQLFGSTAGEPQPVMTNILTL 133

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            GL        H Q+   L++SY  +P  +     ++ +  + ++  +F +   L+ PF+
Sbjct: 134 AGLALAVAGGLHVQIALFLIQSYDILPAARLPEPADVATWGLALVVKSFALGFLLAMPFV 193

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
               +FN+++G++N+ +PQ+ ++F+  P L
Sbjct: 194 AASFIFNVALGIVNRAMPQLMVFFVGAPAL 223


>gi|218530778|ref|YP_002421594.1| flagellar biosynthetic protein FliR [Methylobacterium
           chloromethanicum CM4]
 gi|218523081|gb|ACK83666.1| flagellar biosynthetic protein FliR [Methylobacterium
           chloromethanicum CM4]
          Length = 258

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 123/231 (53%), Gaps = 2/231 (0%)

Query: 11  SLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA-Y 68
           + FLI   RVG+ +ML+PGL    I  ++RL  A+  ++VL P +   +   N    A  
Sbjct: 14  AAFLITFARVGTLMMLMPGLGEQLIASRLRLALALLVTLVLFPTVRPMLPTGNAALAAPA 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G + GL +R+    LQ  G VIS  +GL+   ++  +    +  + + +
Sbjct: 74  LIGLLIGEILIGLMLGLCVRMIVAALQTAGVVISQQLGLSYAMTVDPTMGGQQAAIGNFL 133

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  +   D HH    A+ +SY  +P        +     ++    +F + +R+S P
Sbjct: 134 AMLGVTLILATDLHHVALEAIGRSYLLLPPSGVPAMADAAKLALHAFSRSFALAVRISGP 193

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           F+ F I+FN+ +G+L++L+PQ+ ++F++ P  + +G + L  ++ +I+  F
Sbjct: 194 FIVFGILFNLGLGVLSRLMPQLQVFFLAVPASVIIGMMLLVGALGLIMGLF 244


>gi|254467056|ref|ZP_05080467.1| flagellar biosynthetic protein FliR [Rhodobacterales bacterium Y4I]
 gi|206687964|gb|EDZ48446.1| flagellar biosynthetic protein FliR [Rhodobacterales bacterium Y4I]
          Length = 259

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 122/248 (49%), Gaps = 11/248 (4%)

Query: 3   ISPEIIMM------SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD 56
           + PE+++M         ++  RV + + +LP +   Y+P +V+L  A AF+ V+ P L  
Sbjct: 6   LPPELVLMLGAGFWHAAIVFLRVAAMVSVLPAMGELYVPARVKLAVAAAFTFVVAPALPA 65

Query: 57  TIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS 116
             +  N      Y++  + E  +G   G+ +R++ L LQ  G++ + A  L+ Q   GI 
Sbjct: 66  FPEPDNVFA---YARFAVTEAIIGLALGIGVRIFVLALQTAGAMAAQATSLS-QVLGGIG 121

Query: 117 DSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ 176
                  L +++ I G+    ++  H +V   L+ SY   P G+      +    V  + 
Sbjct: 122 AEPMPA-LGAVLMISGVTLATMMGLHVRVAELLIGSYRMFPAGEFPVAAGLTEWGVFRVS 180

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
            +F +   L++PF+   +++N+++G++N+ +PQ+ +  +  P +  +G   L +   +I+
Sbjct: 181 QSFSLAFTLAAPFVITAVIYNLALGVINRAMPQLMVAMVGAPVITLMGLFILMVGSPVIL 240

Query: 237 YQFSHSFL 244
             +S + +
Sbjct: 241 DVWSRALM 248


>gi|226225722|ref|YP_002759828.1| flagellar biosynthetic protein FliR [Gemmatimonas aurantiaca T-27]
 gi|226088913|dbj|BAH37358.1| flagellar biosynthetic protein FliR [Gemmatimonas aurantiaca T-27]
          Length = 295

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 108/237 (45%), Gaps = 9/237 (3%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +L L   R+G  +++ P  S   +PM++R    + F+++LLP    T D       A
Sbjct: 17  VATALVLTALRIGGLLLIAPAWSAKSVPMKLRTAMLVLFAVLLLPTALATTDRATL---A 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP---L 124
                 + E  +G   G    +   G +F G +++T IGL+      I D +  T     
Sbjct: 74  ITPATFLAETAIGFAFGFAAALVIAGAEFAGELMTTTIGLS---GAAIFDPVNNTQGAIF 130

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            S + ++ L  L +   H  +  A+ KS+  +P+G  ++    F +      T F   L+
Sbjct: 131 GSFMQLMALTLLLITGGHIVMIEAIAKSFSVLPLGAPIDMQAGFLALTKAGGTIFATGLQ 190

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            ++P +   +V NI++ +L +  PQ+ I  ++ P  IG+G L    S+ +IV+    
Sbjct: 191 FAAPVIAAILVTNIALAILGRAAPQLQIMSLAFPLQIGIGLLTFAGSVGLIVHALGE 247


>gi|85706161|ref|ZP_01037256.1| flagellar biosynthetic protein FliR [Roseovarius sp. 217]
 gi|85669325|gb|EAQ24191.1| flagellar biosynthetic protein FliR [Roseovarius sp. 217]
          Length = 254

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 118/233 (50%), Gaps = 11/233 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  RV   I LLPG     +PM++++    AF+++  P +    DL + V+ A  +  +
Sbjct: 20  LVFLRVAPIIGLLPGFGEQSVPMRIKVVLVFAFTLIAAPAI--APDLPDHVH-APSALTI 76

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS---LIGI 130
           + E  +G + G+ +R++ + LQ  GS+ + +  L+      I  + + TP+ S   L+  
Sbjct: 77  LSETLVGLIIGIGLRLFLMALQMAGSIAAQSTSLS-----QILGNASLTPMPSIGHLLAT 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            G+  + ++D H +V   ++ SY   P+        I    V+ +   F +   L++PF+
Sbjct: 132 GGVALMMIMDLHVRVAELMILSYRVFPVQGVFKVSAITQWGVSQIAHAFSLGFMLAAPFV 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +++N+++G++N+ +PQ+ + F+  P +  L    L L    ++  ++ +F
Sbjct: 192 LVSVLYNLTLGVINRAMPQMMVAFVGAPAITALALFVLMLVAPALLMAWAQAF 244


>gi|296531765|ref|ZP_06894587.1| flagellar biosynthesis protein [Roseomonas cervicalis ATCC 49957]
 gi|296267904|gb|EFH13709.1| flagellar biosynthesis protein [Roseomonas cervicalis ATCC 49957]
          Length = 253

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 102/212 (48%), Gaps = 8/212 (3%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY-- 69
           L L+  R+ + ++LLPG   + +P ++R+  A+     L+ F    +          +  
Sbjct: 18  LLLVFGRISAALLLLPGFGETTLPARIRILAAL-----LIAFCLAPLAGPAPAPPGAFGM 72

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           +  +++E+  G   G L R+    +Q  G +I   IG++   + GI    A   L S++ 
Sbjct: 73  AAALVLEIAAGAFLGTLSRMMLSAVQVAGQIIGQCIGISNAFAFGIGADNAAI-LGSMLY 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
              L+AL+ +D HH    AL  SY  +P+G  L       +   +    F + ++LS PF
Sbjct: 132 AAVLVALFAMDGHHVGLRALADSYRLLPLGDPLPAAASARAVTELAAGAFRLAMQLSMPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
           L   ++FN ++  +N+ +P +P++ I  P ++
Sbjct: 192 LVLSVLFNAALAGINRALPAMPVFLIGAPAIL 223


>gi|163852024|ref|YP_001640067.1| flagellar biosynthetic protein FliR [Methylobacterium extorquens
           PA1]
 gi|240139291|ref|YP_002963766.1| flagellar biosynthetic protein FliR [Methylobacterium extorquens
           AM1]
 gi|163663629|gb|ABY30996.1| flagellar biosynthetic protein FliR [Methylobacterium extorquens
           PA1]
 gi|240009263|gb|ACS40489.1| flagellar biosynthetic protein FliR [Methylobacterium extorquens
           AM1]
          Length = 258

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 123/231 (53%), Gaps = 2/231 (0%)

Query: 11  SLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA-Y 68
           + FLI   RVG+ +ML+PGL    I  ++RL  A+  ++VL P +   +   N    A  
Sbjct: 14  AAFLITFARVGTLMMLMPGLGEQLIASRLRLALALLVTLVLFPTVRPMLPTGNAALAAPS 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G + GL +R+    LQ  G VIS  +GL+   ++  +    +  + + +
Sbjct: 74  LIGLLIGEILIGLMLGLCVRMIVAALQTAGVVISQQLGLSYAMTVDPTMGGQQAAIGNFL 133

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  +   D HH    A+ +SY  +P        +     ++    +F + +R+S P
Sbjct: 134 AMLGVTLILATDLHHVALEAIGRSYVLLPPSGVPAMADAAKLALDAFSRSFALAVRISGP 193

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           F+ F I+FN+ +G+L++L+PQ+ ++F++ P  + +G + L  ++ +I+  F
Sbjct: 194 FIVFGILFNLGLGVLSRLMPQLQVFFLAVPASVIIGMMLLVGALGLIMGLF 244


>gi|162147443|ref|YP_001601904.1| flagellar biosynthetic protein fliR [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786020|emb|CAP55602.1| putative flagellar biosynthetic protein fliR [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 270

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 119/245 (48%), Gaps = 22/245 (8%)

Query: 8   IMMSLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVN 65
           ++ ++FL+V CRV + +M  PGL  +  PM+VR   A++ ++ +LP + D  +++     
Sbjct: 14  VLATMFLVVLCRVSALVMAAPGLGETTSPMRVRAGIAVSATVAILPVVQDRLVEVSGTAL 73

Query: 66  RAYYSKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGL----NLQTSMGISDSL 119
           R     + +V  EL  G   G L R+ T+ +     V++   GL       + +G S + 
Sbjct: 74  RMPSVAIAVVVGELLCGVFIGWLARLVTMAISIAMQVVAVFTGLASVLQPDSELGASSTA 133

Query: 120 AETPLNSLIGII----GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNML 175
                + LI +I    GL AL           A+  SY   P G     G++  S     
Sbjct: 134 ISHMASMLIPVIFLSTGLYAL--------PLAAITGSYSLFPPGHMPMVGDMARSVTEAT 185

Query: 176 QTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
             TF + L+L++PF+    ++   +G+LN+L+P I +Y I+ P  +  G + L + I+++
Sbjct: 186 SQTFALALQLAAPFVLIGTLWPAMLGVLNRLLPSIQVYSIAMPAQLLGGVILLAMLIQVM 245

Query: 236 --VYQ 238
             V+Q
Sbjct: 246 TGVWQ 250


>gi|114570481|ref|YP_757161.1| flagellar biosynthetic protein FliR [Maricaulis maris MCS10]
 gi|114340943|gb|ABI66223.1| flagellar biosynthetic protein FliR [Maricaulis maris MCS10]
          Length = 250

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 110/219 (50%), Gaps = 1/219 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G+ +MLLPG     IP++ RL FA+ F ++L P +  ++ +      A  + +V
Sbjct: 14  LVFARLGAILMLLPGFGEPSIPVRFRLAFALLFCLILGPIIAPSLPVMPEQPLAM-AGIV 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           M EL +G + G + R++       G VI    GL +  S   S       +++ + +  L
Sbjct: 73  MSELIIGLMIGAVARIFMSTAAVAGQVIGMQSGLAMAQSFDPSQGAQGALISTFLNLTFL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + L   + HH +      SY     G   +  +     ++     F I ++L+SP + + 
Sbjct: 133 MLLLATNTHHMLLQMAANSYQVFDPGSMPSLTDAADWALSAFIDAFRIGVQLASPLIMYG 192

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           ++F +++G+L++L+PQ  I+FI+ P  I +G   L +++
Sbjct: 193 LLFYLALGVLSRLMPQAQIFFIAMPSNIMIGLFILAIAL 231


>gi|209964222|ref|YP_002297137.1| flagellar biosynthesis protein FliR [Rhodospirillum centenum SW]
 gi|209957688|gb|ACI98324.1| flagellar biosynthesis protein FliR [Rhodospirillum centenum SW]
          Length = 254

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 106/214 (49%), Gaps = 1/214 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L+  R+ +  M++P +    I  ++RL FA+  + V+ P +   +  +     A  +
Sbjct: 13  AFLLVFVRLAAAFMIIPAIGEQAISARIRLLFALVVAAVVTPVVRQYLPPEPSAP-AELA 71

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            LV+ E+ +G   G L RV    L+  G +I+  +GL    +   + +    P+ +L+GI
Sbjct: 72  ALVVSEILVGLFIGTLARVLLTALETGGFLIANQLGLAAAQAFNPALAAPGNPIGALLGI 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             ++ ++  D HH +  A+V SY        L  G+        + T+F I ++L+ PF 
Sbjct: 132 GAVVVIFATDLHHMLILAVVDSYTLFSPADGLPLGDATEHLAQTVNTSFAIGVQLAVPFF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
               +F + +GL+ +LVPQ+ ++F+  P  I +G
Sbjct: 192 VIGFLFYLGLGLVARLVPQVQVFFVGLPIQIAIG 225


>gi|254561747|ref|YP_003068842.1| flagellar biosynthetic protein FliR [Methylobacterium extorquens
           DM4]
 gi|254269025|emb|CAX24986.1| flagellar biosynthetic protein FliR [Methylobacterium extorquens
           DM4]
          Length = 258

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 122/231 (52%), Gaps = 2/231 (0%)

Query: 11  SLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA-Y 68
           + FLI   RVG+ +ML+PGL    I  ++RL  A+  ++VL P +   +   N    A  
Sbjct: 14  AAFLITFARVGTLMMLMPGLGEQLIASRLRLALALLVTLVLFPTVRPMLPTGNAALAAPS 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G + GL +R+    LQ  G VIS  +GL+   ++  +    +  + + +
Sbjct: 74  LIGLLIGEILIGLMLGLCVRMIVAALQTAGVVISQQLGLSYAMTVDPTMGGQQAAIGNFL 133

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  +   D HH    A+ +SY  +P        +     +     +F + +R+S P
Sbjct: 134 AMLGVTLILATDLHHVALEAIGRSYLLLPPSGVPAMADAAKLALAAFSRSFALAVRISGP 193

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           F+ F I+FN+ +G+L++L+PQ+ ++F++ P  + +G + L  ++ +I+  F
Sbjct: 194 FIVFGILFNLGLGVLSRLMPQLQVFFLAVPASVIIGMMLLVGALGLIMGLF 244


>gi|295690542|ref|YP_003594235.1| flagellar biosynthetic protein FliR [Caulobacter segnis ATCC 21756]
 gi|295432445|gb|ADG11617.1| flagellar biosynthetic protein FliR [Caulobacter segnis ATCC 21756]
          Length = 251

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 110/210 (52%), Gaps = 11/210 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-----DLQNFVNRAY 68
           L+  RVG+ +M +PG+    +P ++RL FA+  +++L P + DT+      L   V    
Sbjct: 15  LVFSRVGAMVMTMPGVGDQSVPPRIRLSFALLMALLLGPLVQDTVPPIPTTLGGLVGAVI 74

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +      E+ +G + G ++R++ + L   G +IS    L+   +   S   + T + + +
Sbjct: 75  H------EILIGLMIGSVLRLFMISLTTAGEIISLQTTLSFAQTTNPSMQGSSTAVATFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++GL  +     HH    A+VKSY   P  + +   +  +  V  +  +F + ++L++P
Sbjct: 129 SMLGLTLIMATGLHHLFIGAIVKSYTLFPFTRAVPVNDAVTLAVRTVAESFSLGVQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            + F +VFN++ GL+ +++P   I+F+++P
Sbjct: 189 VIVFSLVFNLATGLVGRVMPSFQIFFVTSP 218


>gi|209545553|ref|YP_002277782.1| putative flagellar biosynthetic protein FliR [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533230|gb|ACI53167.1| putative flagellar biosynthetic protein FliR [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 253

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 116/241 (48%), Gaps = 22/241 (9%)

Query: 12  LFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYY 69
           +FL+V CRV + +M  PGL  +  PM+VR   A++ ++ +LP + D  +++     R   
Sbjct: 1   MFLVVLCRVSALVMAAPGLGETTSPMRVRAGIAVSATVAILPVVQDRLVEVSGTALRMPS 60

Query: 70  SKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGL----NLQTSMGISDSLAETP 123
             + +V  EL  G   G L R+ T+ +     V++   GL       + +G S +     
Sbjct: 61  VAIAVVVGELLCGVFIGWLARLVTMAISIAMQVVAVFTGLASVLQPDSELGASSTAISHM 120

Query: 124 LNSLIGII----GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
            + LI +I    GL AL           A+  SY   P G     G++  S       TF
Sbjct: 121 ASMLIPVIFLSTGLYAL--------PLAAITGSYSLFPPGHMPMVGDMARSVTEATSQTF 172

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII--VY 237
            + L+L++PF+    ++   +G+LN+L+P I +Y I+ P  +  G + L + I+++  V+
Sbjct: 173 ALALQLAAPFVLIGTLWPAMLGVLNRLLPSIQVYSIAMPAQLLGGVILLAMLIQVMTGVW 232

Query: 238 Q 238
           Q
Sbjct: 233 Q 233


>gi|99082794|ref|YP_614948.1| flagellar biosynthetic protein FliR [Ruegeria sp. TM1040]
 gi|99039074|gb|ABF65686.1| Flagellar biosynthetic protein fliR [Ruegeria sp. TM1040]
          Length = 259

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 121/250 (48%), Gaps = 15/250 (6%)

Query: 3   ISPEIIMMSLF--------LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL 54
           I+PE+  M+LF        ++  R+G+   ++ G     IP Q+RL   + F+ ++ P L
Sbjct: 6   ITPEL--MALFGAGFWHAAIVFLRIGAMTSIMLGFGEQLIPTQIRLVAGLVFTAIVAPAL 63

Query: 55  WDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMG 114
                 Q  +    Y+ L+  E+ +G   GL +R++   LQ  GS+ +     +L   +G
Sbjct: 64  PQMPMPQTVMQ---YAGLMATEVVVGLALGLGLRMFMHMLQTAGSIAAQCT--SLSQVLG 118

Query: 115 ISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM 174
            + +     L +++ I G+    ++DFH      +++SY   P+G   +   +    V+ 
Sbjct: 119 GAGADPMPALGAVLWISGIAVAVMLDFHIHAAQLMIRSYDLFPVGIFPSASGLSEWGVHR 178

Query: 175 LQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEI 234
           +  TF     L++PFL   +V+N+++G++N+ + Q+ + F+  P +   G   L +   +
Sbjct: 179 VSATFAQAFTLAAPFLITAVVYNLTLGVINRAMTQLMVVFVGAPVITFGGLAILMIGAPM 238

Query: 235 IVYQFSHSFL 244
           ++  + H  L
Sbjct: 239 MLEVWGHGLL 248


>gi|163733156|ref|ZP_02140600.1| flagellar biosynthetic protein FliR [Roseobacter litoralis Och 149]
 gi|161393691|gb|EDQ18016.1| flagellar biosynthetic protein FliR [Roseobacter litoralis Och 149]
          Length = 256

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 114/219 (52%), Gaps = 8/219 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F++ CRV +   +LP      +P +V+L  A+AF++++ P L  TI   N +     S +
Sbjct: 19  FVVFCRVAALAAVLPAFGEQTLPARVKLAAALAFTLIVAPAL-PTISPPNAIGS--ISLV 75

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ E+  G   G+ +R++ L LQ  GS+ + +  L+        D L   P    I +I 
Sbjct: 76  ILTEVVAGLAIGIGLRLFVLALQTAGSIAAQSTSLSQVLGGAAVDPL---PAMGYILVIA 132

Query: 133 LLALWVI-DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            LAL V+   H +V + ++ SY  +P+G+ +   ++       +   F +   L++PF+ 
Sbjct: 133 GLALAVMAGLHVKVAHLIILSYDFMPVGRFVAAADVSEWGTKQVAQAFSLAFTLAAPFVI 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
             +++N ++G +N+ +PQ+ + F+  P +I LG L L L
Sbjct: 193 LSVLYNFALGAINRAMPQLMVAFVGAP-VITLGGLALLL 230


>gi|163744324|ref|ZP_02151684.1| flagellar biosynthesis protein R [Oceanibulbus indolifex HEL-45]
 gi|161381142|gb|EDQ05551.1| flagellar biosynthesis protein R [Oceanibulbus indolifex HEL-45]
          Length = 251

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +M  F++  R+GS ++ +PG + + +P + RL F +  S  L P     +     V    
Sbjct: 11  LMGYFVVFARIGSALLFMPGFAETSVPTRHRLFFGLILSATLYP-----VTGLGPVAEDR 65

Query: 69  YSKLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              L+++   E+ +G   GL+ R     LQF G  ++   GL    +  I      T + 
Sbjct: 66  PGALLLIFGSEITVGLWIGLVARTLLSALQFAGYQMALMSGLANALAPNIGAFEGATSMA 125

Query: 126 SLIGIIGLLAL-WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
           +++ +IG  AL +V D HH +  +L+ SY  + I       ++   F    Q +  + L 
Sbjct: 126 AML-LIGATALIFVTDLHHLIIESLLMSY-QVFIPGTFMLADLTDQFARATQVSLYLGLS 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +++PF    +V N+ +GL N+++  + ++FI+ P LI  G   + L++  ++  F   F
Sbjct: 184 IAAPFYVAGLVLNVGMGLANRMMASLQVFFIAQPLLIAAGLALMVLAVPTMMRGFLEPF 242


>gi|259417172|ref|ZP_05741091.1| flagellar biosynthetic protein FliR [Silicibacter sp. TrichCH4B]
 gi|259346078|gb|EEW57892.1| flagellar biosynthetic protein FliR [Silicibacter sp. TrichCH4B]
          Length = 259

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 114/224 (50%), Gaps = 15/224 (6%)

Query: 3   ISPEIIMMSLF--------LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL 54
           I+PE  +M+LF        ++  R+G+   ++ G     IP Q+RL   + F+ ++ P L
Sbjct: 6   ITPE--LMALFGAGFWHGAIVFLRIGAMTSIMLGFGEQLIPTQIRLVAGLVFTAIVAPAL 63

Query: 55  WDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMG 114
              + +   V +  Y+ L+  E+ +G   GL +R++   LQ  GS+ +     +L   +G
Sbjct: 64  -PQMPIPETVMQ--YAGLIATEVVVGLSLGLGLRMFMHMLQTAGSIAAQCT--SLSQVLG 118

Query: 115 ISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM 174
            + +     L +++ I G+    ++DFH      +++SY   P+G+  +   +    V+ 
Sbjct: 119 GAGADPMPALGAVLWISGIAVAVMLDFHIHAAQLMIRSYDLFPVGRFPDAAGLSEWGVHR 178

Query: 175 LQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +  TF     L++PFL   +++N+++G++N+ + Q+ + F+  P
Sbjct: 179 VSATFAQAFTLAAPFLITAVIYNLTLGVINRAMTQLMVVFVGAP 222


>gi|302343744|ref|YP_003808273.1| flagellar biosynthetic protein FliR [Desulfarculus baarsii DSM
           2075]
 gi|301640357|gb|ADK85679.1| flagellar biosynthetic protein FliR [Desulfarculus baarsii DSM
           2075]
          Length = 258

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 106/236 (44%), Gaps = 5/236 (2%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF-VNRAY 68
           M   LI+ R  + + LLP    + IP  V+   +MA ++ L P +   ID   F      
Sbjct: 12  MHFLLILTRCSALVALLPFFGSANIPDTVKAGLSMALAVFLHPIV--KIDPALFPTGLDS 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +  L   EL +G + G  +R+    +Q  G +    +G ++   +        + +    
Sbjct: 70  FLILAFGELMIGAILGFAVRLLFSAVQIMGHLAGFQMGFSVANVLDPMGGEQVSVIGQFC 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNI-FSSFVNMLQTTFMIMLRLSS 187
            +I +L  + +  HH  F A  +S+  +P GQ   F  I F     M    F + L+L +
Sbjct: 130 YVIAILVFFAVGGHHWFFSAAAESFAIVPPGQ-FAFSRILFDQLTTMTADMFELALKLGA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   +  ++++G+L K VPQ+ I  +  P  IG+G  FL L++  ++     SF
Sbjct: 189 PVIGVLLAADVAMGVLAKTVPQMNILIVGMPLKIGVGLFFLALTMGFMIVTMGASF 244


>gi|288958051|ref|YP_003448392.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288910359|dbj|BAI71848.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 256

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 116/216 (53%), Gaps = 11/216 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  RVG+   ++P +  +++P + RL FA+A S ++ P +   +      N      LV
Sbjct: 17  LVFLRVGTAFSVMPTIGDAFVPTRARLLFALAVSTLVAPTIRPMLPPMPG-NPFQLMVLV 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGL-NLQ---TSMGISDSLAETPLNSLIG 129
             E+ +G   G + R+    L+  G++IS   GL N Q    ++  S SL  +    L+G
Sbjct: 76  AGEMTVGIFLGTIARLLMGALEVAGTIISLQSGLANAQIFNPALASSGSLPGS----LMG 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            +GLL L+  D HH +  A+V SY T   G  +   ++ +    ++  +FM+ +++S+PF
Sbjct: 132 WLGLLLLFATDLHHLLIMAVVDSYATFVPGAAIPVDDMANMVGQLVSKSFMMGVQMSAPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIY--FISTPYLIGL 223
           L   ++F +++GLLNKL PQ+ ++  F S   L+GL
Sbjct: 192 LITGMLFALALGLLNKLAPQVQVFQLFTSVQVLLGL 227


>gi|258404719|ref|YP_003197461.1| flagellar biosynthetic protein FliR [Desulfohalobium retbaense DSM
           5692]
 gi|257796946|gb|ACV67883.1| flagellar biosynthetic protein FliR [Desulfohalobium retbaense DSM
           5692]
          Length = 260

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 105/226 (46%), Gaps = 1/226 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L   RV + I  +P LS    P ++R   A+  ++++ P +  TI   NF     + 
Sbjct: 13  SFLLCFIRVAAIIGSMPVLSGGQTPARLRAGLALVLAVIIFPAVDGTIPDINFAPLRLFV 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L   E+ LG + G + R+  L  QF G+++   +G      +          ++    +
Sbjct: 73  -LGSQEVLLGLMLGFIGRLLFLAAQFGGTILGFQMGFAAANILDPQSQQQIQLMSQFQNV 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    +D HH    +L +S+  +P G  L+  +   S V M    F++ L+L++P  
Sbjct: 132 LASLVFLAVDGHHVFLRSLARSFEVVPPGGGLHLQDAVPSMVAMTGEMFVLGLQLTAPIY 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
              I+ +  +G+++++ PQ+  + +  P  IG+   FL LS E IV
Sbjct: 192 VILILSDFILGIMSRIFPQLNAFMLKFPINIGVAFFFLGLSAEFIV 237


>gi|126734113|ref|ZP_01749860.1| flagellar biosynthetic protein FliR [Roseobacter sp. CCS2]
 gi|126716979|gb|EBA13843.1| flagellar biosynthetic protein FliR [Roseobacter sp. CCS2]
          Length = 259

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 107/223 (47%), Gaps = 3/223 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  + +LF +  R+G+ + +LP      +P +VRL  A+ F++++ P +  + +      
Sbjct: 12  QAALWTLFAVFTRIGAVMAVLPAFGDQPVPTRVRLVLAVMFTLIVAPAVAPSFETVPTAL 71

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A +  L M E   G   G+ +R + L LQ  GS+ + +  L+ Q   G +    +  + 
Sbjct: 72  LAGFGILAM-EALTGLFFGIFLRFFILVLQIAGSIAAQSTSLS-QIFGGTAAVDPQPAIG 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            ++ + G     +   H Q    ++ +Y  +P G  L    +    V  +  TF     L
Sbjct: 130 HMLVVSGTALAALSGLHIQAASYMIHTYTLVPFGAGLERSLVAEVGVAEVGRTFGFGFML 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
           ++PFL   +++N+ +G++N+ +PQ+ + F+  P L   G LFL
Sbjct: 190 AAPFLIASLIYNVVLGVINRAMPQLMVSFVGAPALTA-GGLFL 231


>gi|107021597|ref|YP_619924.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia AU
           1054]
 gi|116688059|ref|YP_833682.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           HI2424]
 gi|170731409|ref|YP_001763356.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           MC0-3]
 gi|254246636|ref|ZP_04939957.1| Flagellar biosynthesis protein FliR [Burkholderia cenocepacia
           PC184]
 gi|105891786|gb|ABF74951.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia AU
           1054]
 gi|116646148|gb|ABK06789.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           HI2424]
 gi|124871412|gb|EAY63128.1| Flagellar biosynthesis protein FliR [Burkholderia cenocepacia
           PC184]
 gi|169814651|gb|ACA89234.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           MC0-3]
          Length = 260

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 110/231 (47%), Gaps = 4/231 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +  +   ++V 
Sbjct: 21  VRMLALVATAPMVGHAAVPVRVKIGVAAFMALVVAPTLGAMPDVTVFSAQGIW---ILVN 77

Query: 77  LFL-GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            FL G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA
Sbjct: 78  QFLIGVAMGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPAMGRFLNAVAMLA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H QVF AL  S+ ++P+  +L     + +      T F + L LS P +   ++
Sbjct: 138 FLAVDGHLQVFAALAASFQSLPVSADLLHAPGWRTLAAFGATVFEMGLLLSLPVVVALLI 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            N+++G+LN+  PQI +Y I  P  + +G L + L I  +V   SH F  G
Sbjct: 198 ANLALGILNRAAPQIGMYQIGFPVTLIVGLLLVQLMIPNLVPFVSHLFDMG 248


>gi|325288791|ref|YP_004264972.1| flagellar biosynthetic protein FliR [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964192|gb|ADY54971.1| flagellar biosynthetic protein FliR [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 259

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 115/225 (51%), Gaps = 5/225 (2%)

Query: 10  MSLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++LFL++ CR    +M+ P      +P  V+L  AMA S+VL P +  ++ +Q  V+   
Sbjct: 11  LTLFLLIFCRWAGMVMIAPVFGARGVPNLVKLGLAMALSVVLYPTVL-SMTVQVPVDTLL 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L++ E+ +G V GL+I + T  +Q  G +I   IG  L  ++   + +      + +
Sbjct: 70  YIGLIIKEVTVGLVIGLVINLLTSVMQTAGELIDYQIGFTLGNTIDPINGMQSPMTGNFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSS 187
            ++  + L  I+ HH +  A+VKSY  IP+    L  G  F  ++ ++     +  +++ 
Sbjct: 130 MVLTTMLLLAINAHHLIIAAMVKSYSYIPVNTGILPKGMTF--YIQIVGQVIALGAQIAM 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           P      + ++ +GLL+K VPQ+ I+ +  P  I  G   L LSI
Sbjct: 188 PIFGALFLADVGVGLLSKTVPQLNIFSVIFPVKIIFGLTLLFLSI 232


>gi|188586037|ref|YP_001917582.1| flagellar biosynthetic protein FliR [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350724|gb|ACB84994.1| flagellar biosynthetic protein FliR [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 257

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 114/222 (51%), Gaps = 12/222 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-DTIDLQNFVNRAYYSKL 72
           L++ R+   IM  P    +Y+P Q+++ F++  ++V LP L  + +   + +N   ++  
Sbjct: 16  LLLTRISGMIMTAPIFGSNYMPNQIKIAFSLILTLVFLPVLSPEGLSDYHIMNVILFA-- 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG--- 129
             +EL +G   G++  +    +Q  G +I   +G  +   M   D   ET +  LIG   
Sbjct: 74  -FMELMVGIAIGMIANLVFSSIQIAGQLIDVQMGFAMARVM---DPQYETQV-PLIGQFK 128

Query: 130 -IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+ ++   VI+ HH +  ++ +SY  +PIG   + G    +   +  T F++ +++S+P
Sbjct: 129 YILAIMIFLVINGHHLLIRSVYESYQLLPIGNIFDLGAGGVALNELFSTVFVLAIQVSAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            L    + NI++G+L + VPQ+ ++ I  P  I +G L L L
Sbjct: 189 ALGTLFLTNIALGVLARTVPQMNVFIIGFPVKIFVGFLSLVL 230


>gi|94264044|ref|ZP_01287844.1| Type III secretion system inner membrane R protein [delta
           proteobacterium MLMS-1]
 gi|94266370|ref|ZP_01290069.1| Type III secretion system inner membrane R protein [delta
           proteobacterium MLMS-1]
 gi|93453022|gb|EAT03510.1| Type III secretion system inner membrane R protein [delta
           proteobacterium MLMS-1]
 gi|93455555|gb|EAT05742.1| Type III secretion system inner membrane R protein [delta
           proteobacterium MLMS-1]
          Length = 263

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 106/230 (46%), Gaps = 12/230 (5%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +M + +I+ RVG  + L+P +    +P QV++   +  S+VL P +   +   +  + A 
Sbjct: 14  LMRVVMIMVRVGPLLFLMPVIGAPNVPTQVKILLVLMTSLVLAPMV--PVSAADLPDTAL 71

Query: 69  -YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            ++  V++E+    +  L +R     ++  G V+   +G+ +   M        +P+  L
Sbjct: 72  GFAHFVILEIVFVAILALFVRFVFAAVETAGQVVGVQMGMGMAGVMDPVFGNQISPVGML 131

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-----ELNFGNIFSSFVNMLQTTFMIM 182
             I  +L    ID HH  F A+V+ Y  +  GQ     +L +  +      M     MIM
Sbjct: 132 WNIAAILLFLAIDGHHLFFAAMVQGYQWVGPGQLAAVSQLTYEGMMEGASQMFVLAIMIM 191

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
             +S    F ++     +G++ K VPQIPI  +  P  I +G +F  L++
Sbjct: 192 APVSVALFFSHV----GMGVIAKTVPQIPILIVGMPMNIAIGIVFAGLAM 237


>gi|209963537|ref|YP_002296452.1| flagellar biosynthesis protein FliR [Rhodospirillum centenum SW]
 gi|209957003|gb|ACI97639.1| flagellar biosynthesis protein FliR [Rhodospirillum centenum SW]
          Length = 251

 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 121/245 (49%), Gaps = 9/245 (3%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           T+S EI    + L++ RVG+ + +LPG     +PM+ R+  A+A ++ L   +     + 
Sbjct: 6   TLSGEI--YGVLLVLVRVGAALSMLPGFGEMAVPMRTRMAAALALALALAAAVPGLPAVP 63

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                    + ++ E   G V G+  R+    LQ  G +I+ +  L+   ++  +     
Sbjct: 64  P-AGPGELLRHIVGEAMAGAVIGIGARILFAALQIAGQIIAQSASLSNIFALPGTGFEGG 122

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIP---IGQELNFGNIFSSFVNMLQTT 178
           + L + + + GL+ ++V D HH +  AL+ SY  +P   I    + G + +  VN+   +
Sbjct: 123 SVLGAYLMMGGLVLVFVTDLHHAMIRALLDSYQLMPAATIPDPRSLGKLTAETVNL---S 179

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
           F + ++ S+PFL   + +N+ +GL+N+ +P   ++F+  P  I  G + L L    I+  
Sbjct: 180 FRLAVQFSAPFLLLGLAYNVGLGLVNRAMPHFAVFFVGLPVSILGGFIVLALVAAAILGG 239

Query: 239 FSHSF 243
           F  +F
Sbjct: 240 FLDAF 244


>gi|189426337|ref|YP_001953514.1| flagellar biosynthetic protein FliR [Geobacter lovleyi SZ]
 gi|189422596|gb|ACD96994.1| flagellar biosynthetic protein FliR [Geobacter lovleyi SZ]
          Length = 265

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 114/235 (48%), Gaps = 11/235 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY-SKL 72
           LI+CR+G     LP      +P ++++   +A ++V LP L   I        A+    L
Sbjct: 19  LILCRIGGLFAALPVFGGKRLPTRIKIAAVLAITLVCLPVL--KITPPPLPGDAFTLGLL 76

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN----LQTSMGISDSLAETPLNSLI 128
           VM E+ +G     + ++    ++F+G +I   +G +    L  SMG    +    + SL+
Sbjct: 77  VMREMLIGLTLAFITQIIFAAVEFSGQIIGLQMGFSISSVLDPSMGTQTQIMSV-VQSLL 135

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             +  L+L   + HH    A+V S+  IP+G       +    VN     F++ +RL++P
Sbjct: 136 ATLFFLSL---NIHHVFISAIVDSFTVIPLGGWKMSEALIHFLVNATSEVFILGIRLAAP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   ++ ++ +G++ +  PQ+ ++ +S P  IGLG + L +++ +  +    SF
Sbjct: 193 VMVALLLTSVVLGIMARAFPQMNVFMVSFPLNIGLGFMVLGMTLLLFFHVLELSF 247


>gi|297569687|ref|YP_003691031.1| flagellar biosynthetic protein FliR [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925602|gb|ADH86412.1| flagellar biosynthetic protein FliR [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 263

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 101/230 (43%), Gaps = 12/230 (5%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRA 67
           +M + +++ RVG  + L+P LS   +P QV++   +  S+VL P +   + DL +     
Sbjct: 14  LMRVLIVMTRVGPLLFLMPVLSARGVPAQVKILLVVMTSLVLAPVVPVSSADLPD--TAV 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +     +E+    +  L  R     ++  G V+   +G+ +   M        +P+  L
Sbjct: 72  GFGVFAALEITFAAILALFARFVFSAVETAGQVVGVQMGMGMAGVMDPQFGNQVSPVGML 131

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-----ELNFGNIFSSFVNMLQTTFMIM 182
             +  +L    ID HH  F A+V+SY  +  GQ      L +  +      M      IM
Sbjct: 132 WSVAAILLFLAIDGHHLFFAAMVRSYQWVGPGQLAAVSHLTYQGMMDGAAQMFVLAIKIM 191

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
              S+   F +    + +G++ K VPQIPI  +  P  I LG +   LS+
Sbjct: 192 APASATLFFSH----VGMGIIAKTVPQIPILIVGMPMNIALGMMMAGLSM 237


>gi|148266207|ref|YP_001232913.1| flagellar biosynthetic protein FliR [Geobacter uraniireducens Rf4]
 gi|146399707|gb|ABQ28340.1| flagellar biosynthetic protein FliR [Geobacter uraniireducens Rf4]
          Length = 261

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 116/232 (50%), Gaps = 5/232 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRAYYSKL 72
           L+V R+      +P      +P++V+    M  +++L P +   I  L +  +    S L
Sbjct: 18  LVVGRMAGLFAAIPLFGSKSVPVRVKAAVIMVMALLLYPVIRTQIPPLPS--DSISLSLL 75

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI-GII 131
           V+ E  +G   G++ +     ++F G ++   +G+++  S+   ++ A  P  +L+ GI+
Sbjct: 76  VVRETLIGLTIGIISQAIFAAVEFCGQIVGMQMGISM-ASLFDPNTQANVPTVALLQGIL 134

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L    +  HH    A+V+SY  IP+G     G +    +      F++ ++LS+P + 
Sbjct: 135 AMLLFLSLGVHHIFIRAIVESYRVIPVGAWHMSGGLMQFIITTTGAIFILAIKLSAPIMV 194

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  ++++G++ +  PQ+ I+ +S P  IG+G L L LS+   +    ++F
Sbjct: 195 ALLATSVALGIMARSFPQMNIFMVSMPLNIGIGFLALGLSLLTFLRTLENAF 246


>gi|260431742|ref|ZP_05785713.1| flagellar biosynthetic protein FliR [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415570|gb|EEX08829.1| flagellar biosynthetic protein FliR [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 257

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 115/233 (49%), Gaps = 7/233 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV-NRAYYSK 71
           F++  RV + + LLP      +P +V+L  A+AFS+V+ P     + ++      A   +
Sbjct: 20  FVVFLRVSAVVSLLPAFGERSVPTRVKLGVAVAFSLVVAP----AVQIEPLAPGMAAMVR 75

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           ++  E  +G + G+ +R++ L LQ  GSV + +  L+       +D L    +  L+ + 
Sbjct: 76  VITAETLIGLILGVGLRLFVLALQTAGSVAAQSTSLSQILGGAAADPLPA--MGYLLTLA 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           GL    +++ H +    LV SY   P G      ++    V  +  +F +   L++PF+ 
Sbjct: 134 GLALAVLLNLHVRAAQFLVHSYMLFPAGIVPAASDVSQWGVAQIAHSFSLAFGLAAPFVI 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             +++N+++G++N+ +PQ+ + FI  P +   G   L     II+  +S + L
Sbjct: 194 ASLIYNLALGVINRAMPQLMVAFIGAPAITFAGLFLLFAGTPIILSVWSDALL 246


>gi|163738054|ref|ZP_02145470.1| flagellar biosynthetic protein FliR [Phaeobacter gallaeciensis
           BS107]
 gi|161388670|gb|EDQ13023.1| flagellar biosynthetic protein FliR [Phaeobacter gallaeciensis
           BS107]
          Length = 259

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 115/232 (49%), Gaps = 8/232 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+ + +LP     Y+P +++L  ++AF++++         L    +  +Y  L + E 
Sbjct: 27  RIGAMVSVLPAFGEKYVPARIKLAISLAFTLIVA---PALPILPPPASPLHYGSLALSEA 83

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G+ IR++   +Q  G++ + +  L  Q   GI       P    + +I  LAL 
Sbjct: 84  VVGLALGMAIRMFVHAIQIAGTIAAQSTSLA-QVLGGIGAE--PMPAIGAVLLISGLALA 140

Query: 138 V-IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
           V +  H +V   ++ SY   P+G+  +   +    V+ +  +F +   L++PFL   +V+
Sbjct: 141 VMLGLHIRVAEFMIYSYMMFPVGEFPSASGLSDWGVHRVSRSFAMGFSLAAPFLIGSMVY 200

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
           N+++G++N+ +P + + F+  P ++  G L + +    ++     + L GFF
Sbjct: 201 NLTLGVINRAMPALMVAFVGAP-VVTFGGLAILMVASPMILDIWSTALMGFF 251


>gi|222053618|ref|YP_002535980.1| flagellar biosynthetic protein FliR [Geobacter sp. FRC-32]
 gi|221562907|gb|ACM18879.1| flagellar biosynthetic protein FliR [Geobacter sp. FRC-32]
          Length = 260

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 116/239 (48%), Gaps = 19/239 (7%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--------WDTIDLQNFVN 65
           L+V R+      +P      +PM++++   M+ +++L P +         D+I +   V 
Sbjct: 17  LVVGRMAGLFSAIPLFGGKSVPMRIKMAVIMSMALLLFPIIKMQVPPLPGDSISIGLLVI 76

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           R         E  +G   G++ +     ++  G ++   +G+++  ++   ++ +  P  
Sbjct: 77  R---------ETLIGLTLGIISQAIFAAVEMCGQIVGMQMGISI-AALFDPNTQSNVPTM 126

Query: 126 SLI-GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
           SL  GI+ +L    +  HH    A+V+SY  IP+G     G +   F+  +   F++ ++
Sbjct: 127 SLFQGILAMLLFVALGVHHIFIRAIVESYQVIPVGAWHMSGELMQFFITSIGAVFILGVK 186

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           L++P +   +  ++++G++ +  PQ+ I+ +S P  IG+G L L LS+   +    +SF
Sbjct: 187 LAAPVMVALLATSVALGIMARAFPQMNIFMVSMPLNIGIGFLALGLSLLAFLRTLQNSF 245


>gi|188581881|ref|YP_001925326.1| flagellar biosynthetic protein FliR [Methylobacterium populi BJ001]
 gi|179345379|gb|ACB80791.1| flagellar biosynthetic protein FliR [Methylobacterium populi BJ001]
          Length = 258

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 110/209 (52%), Gaps = 1/209 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L   RVG+ +ML+PGL    I  ++RL  A+  ++VLLP +   +   +    A   
Sbjct: 15  AFLLTFARVGTLMMLMPGLGEQLIAARLRLALALLMTLVLLPTVRPLLPTGSGALAAPSV 74

Query: 71  -KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             L+  E+ +G + GL +R+    LQ  G+VIS  +GL+   ++  +    +  + + + 
Sbjct: 75  IGLLFGEILIGLMLGLCVRMILAALQTAGTVISQQLGLSYAMTVDPTMGGQQAAIGNFLA 134

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++G+  +   D HH    A+ +SY  +P        +     ++     F + +R+S PF
Sbjct: 135 LLGVTLILATDLHHVALEAIGRSYVLLPPSGVPAMADAAKLALDAFSRGFALAVRISGPF 194

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           + F I+FN+ +G+L++L+PQ+ ++F++ P
Sbjct: 195 IVFGILFNLGLGVLSRLMPQLQVFFLAVP 223


>gi|163742550|ref|ZP_02149936.1| flagellar biosynthetic protein FliR [Phaeobacter gallaeciensis
           2.10]
 gi|161384135|gb|EDQ08518.1| flagellar biosynthetic protein FliR [Phaeobacter gallaeciensis
           2.10]
          Length = 259

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 116/236 (49%), Gaps = 8/236 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           ++  R+G+ + +LP     Y+P +++L  ++AF+ ++         L    +  +Y  L 
Sbjct: 23  IVFLRIGAMVSVLPAFGEKYVPARIKLAISLAFTFIVA---PALPILPPPASPLHYGSLA 79

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E  +G   G+ IR++   +Q  G++ + +  L  Q   GI       P    + +I  
Sbjct: 80  LSEAVVGLALGMAIRMFVHAIQIAGTIAAQSTSLA-QVLGGIGAE--PMPAIGAVLLISG 136

Query: 134 LALWV-IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LAL V +  H +V   ++ SY   P+G+  +   +    V+ +  +F +   L++PFL  
Sbjct: 137 LALAVMLGLHIRVAEFMIYSYMMFPVGEFPSASGLSDWGVHRVSRSFAMGFSLAAPFLIG 196

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
            +V+N+++G++N+ +P + + F+  P ++  G L + +    ++     + L GFF
Sbjct: 197 SMVYNLTLGVINRAMPALMVAFVGAP-VVTFGGLAILMVASPMILDIWSTALMGFF 251


>gi|83814762|ref|YP_446684.1| flagellar biosynthetic protein FliR [Salinibacter ruber DSM 13855]
 gi|294508620|ref|YP_003572679.1| flagellar biosynthetic protein FliR [Salinibacter ruber M8]
 gi|83756156|gb|ABC44269.1| flagellar biosynthetic protein FliR [Salinibacter ruber DSM 13855]
 gi|294344949|emb|CBH25727.1| flagellar biosynthetic protein FliR [Salinibacter ruber M8]
          Length = 258

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 107/219 (48%), Gaps = 6/219 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++ + L+  RV   ++  P      IP++VR+  ++  +  L  F    +  ++  +   
Sbjct: 9   ILRVLLVFVRVSGLMLAAPFFQQKTIPVRVRVLASVVLAYSLAGFATGPLP-EHVTHDVG 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +  +V+VE   G V G   R+    + F G+++   + L+L  +       +  PL  ++
Sbjct: 68  FMLVVLVEAGTGLVMGFTARIIFWAVSFAGTIMGYQMALSLAQTYNPISGTSSNPLGQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
               LLA  + D HH +  AL +S+  +P+ G EL+        +  +   F + +RL++
Sbjct: 128 SYTFLLAFLLADGHHFLLRALAQSFEVVPLGGAELSGAG--PPMLGWMGDFFRLAVRLAA 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLG 224
           PFL    + +I++G+  +LVPQ  ++ +S P   L+G+G
Sbjct: 186 PFLVILFLTDIALGIFARLVPQANLFTLSLPAKLLVGIG 224


>gi|39995533|ref|NP_951484.1| flagellar biosynthesis protein FliR [Geobacter sulfurreducens PCA]
 gi|39982296|gb|AAR33757.1| flagellar biosynthesis protein FliR [Geobacter sulfurreducens PCA]
 gi|298504534|gb|ADI83257.1| flagellar biogenesis protein FliR [Geobacter sulfurreducens KN400]
          Length = 264

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 110/230 (47%), Gaps = 1/230 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+      +P      +P  ++     A ++V  P + + +  Q   +      L+
Sbjct: 19  LVMGRMAGIFAAIPIFGGRRVPTPIKALLVFAMTMVCFPIIKEKMP-QLPTDVLSLGFLM 77

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G   GLL  +    ++F G ++S  IGL + T    S     + ++ ++ ++  
Sbjct: 78  VQEVLVGVSLGLLSLIIFAAVEFAGQIVSVQIGLTIVTEFDPSQGGQLSIMSIILEMLAT 137

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L    +  HH    ALV+SY  +P+G     G +    V  +   F++ +RL++P +   
Sbjct: 138 LLFLSLGMHHIFIGALVQSYDVLPLGAWHMSGALLQFIVTTIGEVFVLAVRLAAPVMVTL 197

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +  ++ +G++ +  PQ+ ++F+S P  IG+G + L LS+ + ++     F
Sbjct: 198 LATSVMLGIMARSFPQMNVFFVSMPLNIGIGFIVLGLSLPLFLHTVQGHF 247


>gi|83589640|ref|YP_429649.1| flagellar biosynthesis protein FliR [Moorella thermoacetica ATCC
           39073]
 gi|83572554|gb|ABC19106.1| flagellar biosynthetic protein FliR [Moorella thermoacetica ATCC
           39073]
          Length = 255

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 90/175 (51%)

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y+  V+ E   G   G L  +    +Q  G ++   +GL + T     ++ + T +    
Sbjct: 65  YALAVLNESLAGLALGYLASLIFSAIQMAGQLLDIHMGLAMATLFDPQNAASTTIMGQFF 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+GLL  + +D HH +  AL +S+  +P+G     GN+  + V +   TF + L++++P
Sbjct: 125 AILGLLLFFQLDGHHTLLLALQESFRLLPLGGVHFDGNLLWAVVKLFAGTFALALQIAAP 184

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   ++ ++++ L+ + VPQ+ ++ +  P  +GLG L +   + ++   FS+ F
Sbjct: 185 LIAVLLIADLALSLVARTVPQLNVFILGFPLKVGLGLLVMIALLPLLATVFSNIF 239


>gi|260886651|ref|ZP_05897914.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
 gi|330839518|ref|YP_004414098.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
 gi|260863794|gb|EEX78294.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
 gi|329747282|gb|AEC00639.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
          Length = 260

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 102/217 (47%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV    ++ P      IP  +R+  A+AFS VL P +     +    N   Y+   
Sbjct: 16  LVLTRVTGIFVIAPFFGSLNIPAHIRVGTAVAFSFVLFPIVDSYGPVSAPDNVFLYAAAA 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             ELF+G + G +  V    + F G V+   +G  +   M  +       + S +  + +
Sbjct: 76  AGELFVGWLIGFVAYVTFSAIHFAGKVMDMQVGFAMVNVMDPTSGQQIPLIGSFLYNLAI 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           +   V++ HH +  AL +S+ ++P+       N+    VN++   F+  ++L+ P  F  
Sbjct: 136 IVFLVVNGHHMLIAALFESFQSVPMMGLSPSPNLAGFVVNLVNGVFVTGMKLAMPVTFSI 195

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           ++ N+ +G+L + +PQ+ I+ +  P  I +G   L +
Sbjct: 196 LLTNVGLGILARTMPQLNIFVVGLPLQIVIGMFVLSI 232


>gi|171316885|ref|ZP_02906094.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MEX-5]
 gi|171097966|gb|EDT42784.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MEX-5]
          Length = 260

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 111/230 (48%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +  +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAQGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   GL +++    ++  G  I  ++GL   T      + A   +   +  I +LA 
Sbjct: 79  FLIGVALGLTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGRFLNAIAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ T+P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248


>gi|110677563|ref|YP_680570.1| flagellar biosynthetic protein FliR [Roseobacter denitrificans OCh
           114]
 gi|109453679|gb|ABG29884.1| flagellar biosynthetic protein FliR [Roseobacter denitrificans OCh
           114]
          Length = 256

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 111/219 (50%), Gaps = 8/219 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F++ CRV +   +LP      +  +V+L  A+AF++++ P L   I     +    +  +
Sbjct: 19  FVVFCRVAALAAVLPAFGEQTLSARVKLAAALAFTVIVAPAL-PIIPAPGSIGAVSF--V 75

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ E+  G   G+ +R++ L LQ  GS+ + +  L+        D L   P    I +I 
Sbjct: 76  ILTEVVAGLAIGIGLRLFVLALQTAGSIAAQSTSLSQVLGGAAVDPL---PAMGYILVIA 132

Query: 133 LLALWVI-DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            LAL V+   H +V   ++ SY  +P+G+  N  ++     + +   F +   L++PF+ 
Sbjct: 133 GLALAVMAGLHVKVAQLIILSYDFMPVGRFANAADLSEWGTSQVAHAFSLAFTLAAPFVI 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
             +++N ++G +N+ +PQ+ + F+  P +I LG L L L
Sbjct: 193 LSVLYNFALGAINRAMPQLMVAFVGAP-VITLGGLALLL 230


>gi|78224287|ref|YP_386034.1| flagellar biosynthesis protein FliR [Geobacter metallireducens
           GS-15]
 gi|78195542|gb|ABB33309.1| Flagellar biosynthesis protein FliR [Geobacter metallireducens
           GS-15]
          Length = 264

 Score = 68.6 bits (166), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 110/230 (47%), Gaps = 1/230 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+      +P      +PM +++    A ++V  P +   I  Q   +      L+
Sbjct: 19  LVLGRMAGIFAAIPLFGGRRVPMNIKVLAIFALTVVCFPLIKAKIP-QLPADMLSLGMLM 77

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E  +G   GLL  +    ++F G +    +GL++ + +  S     + ++    +   
Sbjct: 78  IREALVGTCLGLLSLIIFAAVEFCGQICGIQMGLSIVSEIDPSRGSQLSIISIFQEMFAT 137

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L    ++ HH    ALV+SY  +P+G       + +  V  +   F++ ++LS+P +   
Sbjct: 138 LLFLSLNVHHVFINALVESYAVLPVGAWTMSEGLLNFLVVTIGQVFILAIKLSAPIMVTL 197

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++ ++ +G++ +  PQ+ ++F+S P  IG+G + L LS+ + ++    SF
Sbjct: 198 LLTSVMLGIMARAFPQMNVFFVSMPLNIGIGFIILGLSLTVFLHTLRGSF 247


>gi|56695094|ref|YP_165441.1| flagellar biosynthetic protein FliR [Ruegeria pomeroyi DSS-3]
 gi|56676831|gb|AAV93497.1| flagellar biosynthetic protein FliR [Ruegeria pomeroyi DSS-3]
          Length = 257

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 116/225 (51%), Gaps = 15/225 (6%)

Query: 2   TISPEIIMM------SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW 55
            + PE++ +       LF +  RV + + +LP      IPM+VRL  A AF++++ P   
Sbjct: 3   ALPPELLALISGELWQLFAVFLRVSALVSVLPAFGEQSIPMRVRLGVAAAFAVIVAPATP 62

Query: 56  DTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGI 115
              ++ N +    ++ L   E   G V GL IR++ + LQ  G + + A  L    S  +
Sbjct: 63  QAPEITNVLQ---FAMLAGTEALAGLVMGLGIRLFAMALQVAGMIAAQATSL----SQLL 115

Query: 116 SDSLAE-TPLNSLIGIIGLLALWVID-FHHQVFYALVKSYGTIPIGQELNFGNIFSSFVN 173
            +++AE TP    + ++  LAL V+   H +V   L+ SY   PIG+  + G++    V 
Sbjct: 116 GNAVAEPTPAMGHLLMMDGLALAVMSGLHVRVAEFLIHSYTIFPIGKLPHPGDLSQWGVA 175

Query: 174 MLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            +   F +   L++PF+   +++N+++G +N+ +PQ+ + F+  P
Sbjct: 176 QIGRMFALAFALAAPFVIASLIYNLALGAINRAMPQLMVAFVGAP 220


>gi|91791411|ref|YP_561062.1| type III secretion system inner membrane R protein [Shewanella
           denitrificans OS217]
 gi|91713413|gb|ABE53339.1| type III secretion system inner membrane R protein [Shewanella
           denitrificans OS217]
          Length = 261

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 103/228 (45%), Gaps = 10/228 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
           CRVG    L     MS IP  +R        I L         ++  +N   Y  L+ +E
Sbjct: 27  CRVGIVFWLPLVGPMSRIPTSIRFIIVNVIVIALFSLQGAPAVIEVDLNTRSYLTLLAIE 86

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII----G 132
              G    L++ V  + L F G  I   IGL    + GI +  ++T  +SL+G++     
Sbjct: 87  FITGITFSLILAVPAVVLLFFGRAIDMQIGLG---ASGIFNPTSQTQ-DSLLGVLFSFAA 142

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L   W +  H  V   L++S   +P+GQ  N   +   F+    T F++ L L +P +  
Sbjct: 143 LTLFWSLGLHLDVLKILIESIKVLPLGQTRNVEAMV--FIEYFSTAFVLGLILFAPVIIM 200

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             + +I  G+++K +PQ+ IYF+  P  I +G + L +++  +   F 
Sbjct: 201 LFIVDICSGIISKSMPQMSIYFVIMPLKIMIGFIVLTITLTNLASHFE 248


>gi|254477385|ref|ZP_05090771.1| flagellar biosynthetic protein FliR [Ruegeria sp. R11]
 gi|214031628|gb|EEB72463.1| flagellar biosynthetic protein FliR [Ruegeria sp. R11]
          Length = 259

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 101/210 (48%), Gaps = 15/210 (7%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLP----FLWDTIDLQNFVNRAYY 69
           ++  RV + + +LP     Y+P++V+L  A+AF+ V+ P    F      LQ       Y
Sbjct: 23  IVFLRVSAMVAMLPAFGEQYVPVRVKLAIALAFTFVVAPALPLFPAPDTPLQ-------Y 75

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           +     E  +G   G+ IR++   +Q  G++ + +  L  Q   GI       P    + 
Sbjct: 76  AGYAASEAIIGLALGVGIRLFIHAIQTAGTIAAQSTSLA-QVLGGIGAE--AMPAIGAVL 132

Query: 130 IIGLLALWV-IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           +I  LAL V +  H +    ++ SY   P+G+      +    V+ +   F +   L++P
Sbjct: 133 LISALALAVMLGIHVRAAEFMIYSYMMFPMGEFPAAMGLSDWGVHRISRAFSLGFSLAAP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           FL   +++N+++G++N+ +PQ+ + F+  P
Sbjct: 193 FLIGALIYNLTLGVINRAMPQLMVAFVGAP 222


>gi|89895722|ref|YP_519209.1| hypothetical protein DSY2976 [Desulfitobacterium hafniense Y51]
 gi|219670146|ref|YP_002460581.1| flagellar biosynthetic protein FliR [Desulfitobacterium hafniense
           DCB-2]
 gi|89335170|dbj|BAE84765.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219540406|gb|ACL22145.1| flagellar biosynthetic protein FliR [Desulfitobacterium hafniense
           DCB-2]
          Length = 260

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 108/224 (48%), Gaps = 12/224 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ R    IML P      +P  V+L  A++ SI+L P +      Q       Y+ L+
Sbjct: 16  LILSRWAGMIMLAPVFGARGVPAMVKLGLAVSISIILYPLIMAA-GPQIPSETLPYAALL 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G V G +I   T  L+  G +I   +G N+  ++     +    + +   I+ +
Sbjct: 75  IKEIVVGLVIGFVIYAITAVLEGAGQLIDMQMGFNMSGAIDPIFGVQSAMMGNFQMILAI 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIG-----QELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           + L   + HH +  A+VKSY  +PI      Q LN+      ++ +++  F + ++L+ P
Sbjct: 135 MLLLATNSHHYLIAAMVKSYTYVPINPGALPQGLNY------YIFLIREIFTLSVQLALP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
            +   ++ +I +GLL + VPQ+ I+ +  P  I  G   L L I
Sbjct: 189 VIGALVLTDIGVGLLMRTVPQMNIFTVIFPVKIIFGFTILFLGI 232


>gi|325981179|ref|YP_004293581.1| flagellar biosynthetic protein FliR [Nitrosomonas sp. AL212]
 gi|325530698|gb|ADZ25419.1| flagellar biosynthetic protein FliR [Nitrosomonas sp. AL212]
          Length = 265

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 107/218 (49%), Gaps = 5/218 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV- 75
            R+ + I   P L     P++V+L  A+  +I++LP +  ++     ++ A    LV++ 
Sbjct: 21  SRILALIASAPILGNPSTPVRVKLGLAIMITILILPLVEKSLPQ---IDPASGIGLVILL 77

Query: 76  -ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            ++ +G   G ++RV  + ++  G +I   +GL         +S     +   +G+I  L
Sbjct: 78  QQILIGAAIGFVMRVVFVAVEMAGELIGLQMGLGFAIFFDPQNSGQIDIIGRFLGVIASL 137

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
           A   +D H  +   + +S+ T+PIG        F++  N     F   L+LS P L   +
Sbjct: 138 AFLAMDGHLLMIALISQSFSTLPIGSAALTDVTFTTLANWGGEIFKSGLQLSLPVLTALL 197

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           + NI++G+L ++ PQ+ I+ +  P  + +G L L LS+
Sbjct: 198 ITNIALGILTRVAPQLNIFAVGFPLTLAIGFLVLGLSM 235


>gi|170698075|ref|ZP_02889156.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria
           IOP40-10]
 gi|170137036|gb|EDT05283.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria
           IOP40-10]
          Length = 260

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 110/230 (47%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +  +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAQGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      + A   +   +  I +LA 
Sbjct: 79  FLIGVALGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGRFLNAIAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ T+P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248


>gi|118581842|ref|YP_903092.1| flagellar biosynthetic protein FliR [Pelobacter propionicus DSM
           2379]
 gi|118504552|gb|ABL01035.1| flagellar biosynthetic protein FliR [Pelobacter propionicus DSM
           2379]
          Length = 264

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 115/240 (47%), Gaps = 7/240 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EII+ +L  ++ R+      LP      +P+Q+R+   MA S++  P L   ++  N  +
Sbjct: 12  EIILFAL--VLGRMAGMFSALPVFGGKRLPLQIRVVAVMAMSLICFPLL--NVNAPNIPD 67

Query: 66  RA-YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                + L + E+ +G     + ++    ++F+G +I   +G  +   M  +       +
Sbjct: 68  DTISLALLALREVMIGITLSFVTQIIFSAVEFSGQIIGMQMGFTMAAIMDPTHGTQSQVM 127

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIML 183
           + +  ++  L    +  HH    A+V S+  IP+G   LN G I +         F++ +
Sbjct: 128 SVMQSLLATLMFLCMSIHHLFIRAIVDSFHIIPLGVWHLN-GEIITFLTRATADVFVLGV 186

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           RL++P +   ++ ++++G++ +  PQ+ ++ IS P  IG+G + L  ++ +  +    SF
Sbjct: 187 RLAAPVMVALLLTSVTLGIMARSFPQMNVFMISFPLNIGIGFIILGATLPMFFHVLEVSF 246


>gi|254512033|ref|ZP_05124100.1| flagellar biosynthetic protein FliR [Rhodobacteraceae bacterium
           KLH11]
 gi|221535744|gb|EEE38732.1| flagellar biosynthetic protein FliR [Rhodobacteraceae bacterium
           KLH11]
          Length = 256

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 123/257 (47%), Gaps = 29/257 (11%)

Query: 1   MTISPEII------MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL 54
           +T+ PE++      +  LF +  RV + + LLP      IP++V+   A AF++++ P +
Sbjct: 2   ITLPPELLPYLGQNLWHLFAVFLRVSALVSLLPAFGERSIPVRVKFGLAAAFTLIIAPAV 61

Query: 55  WDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMG 114
                L  F        L+  E+ +G   G+ +R++ L LQ  GS+ + A  L+      
Sbjct: 62  PAAGPLPGFPGMV---GLIGSEILVGLAFGIALRLFVLALQTAGSIAAQATSLSQ----- 113

Query: 115 ISDSLAETPLNSL---IGIIGLLALWVIDFHHQVFYALVKSY-----GTIPIGQELN-FG 165
           I    A  P+ ++   + + GL    ++  H      +V SY     GT+P   +L+ +G
Sbjct: 114 ILGGAAVEPVPAMGYFLTLSGLALAALLGLHIHAAQFMVHSYMLFPPGTVPAAPDLSQWG 173

Query: 166 NIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGS 225
                 V  +  +F +   L++PF+   +++N+++G++N+ +PQ+ + F+  P +   G 
Sbjct: 174 ------VTQITRSFGMAFALATPFVIASLIYNLALGVINRAMPQLMVAFVGAPAITFAGL 227

Query: 226 LFLCLSIEIIVYQFSHS 242
             L     +I+  +S +
Sbjct: 228 FLLFAGTPLILSVWSDA 244


>gi|187925752|ref|YP_001897394.1| flagellar biosynthetic protein FliR [Burkholderia phytofirmans
           PsJN]
 gi|187716946|gb|ACD18170.1| flagellar biosynthetic protein FliR [Burkholderia phytofirmans
           PsJN]
          Length = 260

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 108/230 (46%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L    +P++V++  A   +I++ P L     +  F     +  +++ +
Sbjct: 21  VRILALVATAPVLGNRSLPIRVKIGLAAFVTIIVAPTLGALPQVTVFSAEGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  +   +GL   T      + +   L+S +  I +L  
Sbjct: 79  FLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDAQAASSSQVLSSYMNTIAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            VID H Q+  AL+ ++ ++P+   +     + +  N   T F   L LS P +   ++ 
Sbjct: 139 LVIDGHLQMISALLATFQSVPVSANILGAPGWRTLANFGSTVFSAGLLLSLPVVAALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+S+G+LN+  PQI ++ I  P  + +G L L L +  ++  F+  F  G
Sbjct: 199 NLSLGILNRAAPQIGVFQIGFPLTMLIGMLLLQLMVPNMIPFFTRLFEVG 248


>gi|78064696|ref|YP_367465.1| flagellar biosynthesis protein FliR [Burkholderia sp. 383]
 gi|77965441|gb|ABB06821.1| Flagellar biosynthesis protein FliR [Burkholderia sp. 383]
          Length = 260

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 110/230 (47%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +  +  +++ +
Sbjct: 21  VRMLALVATAPVVGHAAVPVRVKIGLAAFMALVVAPTLGAMPDVTVFSAQGIW--ILVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAAMGFTMQIVFAAVEAAGDFIGLSMGLGFATFFDPHTSGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ ++P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALTASFQSLPVSADLLHAPGWRTLAGFGTTVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI ++ I  P  + +G L + L I  +V   +H F  G
Sbjct: 199 NLALGILNRAAPQIGVFQIGFPVTMLVGLLLVQLMIPNLVPFVAHLFDMG 248


>gi|172059102|ref|YP_001806754.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MC40-6]
 gi|171991619|gb|ACB62538.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MC40-6]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 109/230 (47%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F     +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAPGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      + A   +   +  I +LA 
Sbjct: 79  FLIGVALGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGRFLNAIAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ T+P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248


>gi|114799957|ref|YP_759005.1| flagellar biosynthetic protein FliR [Hyphomonas neptunium ATCC
           15444]
 gi|114740131|gb|ABI78256.1| flagellar biosynthetic protein FliR [Hyphomonas neptunium ATCC
           15444]
          Length = 237

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 90/161 (55%), Gaps = 9/161 (5%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS-DSLAETPLNSLIGIIGLL 134
           E+ +G   G L+R+    L   G+VI+ +IGL     +G++ +  A+T  ++++ + G  
Sbjct: 66  EVVIGFGLGALLRLSVWMLTIAGTVIAQSIGL--AQFLGVALEHEAQTVTSNMLSLAGTT 123

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQ--ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            L   ++H  V   L++ Y  IP+G+  ++++  IF SF + +    M    L+ PF+  
Sbjct: 124 ILLTANYHVAVVDGLMRLYTEIPLGEVGQVSWPMIFDSFYSAMGFALM----LAWPFVAA 179

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
            +++NI +G +NK +P + + F+  P+++G G + L +S+ 
Sbjct: 180 NLLYNICLGFINKALPSLMVAFVGAPFMVGAGVMLLAISVS 220


>gi|294675614|ref|YP_003576229.1| flagellar biosynthetic protein FliR [Rhodobacter capsulatus SB
           1003]
 gi|294474434|gb|ADE83822.1| flagellar biosynthetic protein FliR [Rhodobacter capsulatus SB
           1003]
          Length = 258

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 113/233 (48%), Gaps = 16/233 (6%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F++  RVG  + ++P      +P +V+L    AF+++++P          FVN    S  
Sbjct: 20  FIVFLRVGGTMAVMPAFGEMMVPTRVKLGLTFAFTLIVMP------GALPFVNAPDTSLP 73

Query: 73  VMV----ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           V V    E+ +G   GL++R++ L LQ  G++ + +   +L    G +    +  +  L+
Sbjct: 74  VAVWMFAEIVIGLFIGLMLRLFVLCLQIAGTIAAQST--SLSQLFGGTTGEPQPAVGELL 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSF-VNMLQTTFMIMLRLSS 187
            + GL     +  H +V    + SY  +P G   +  ++F  + +  +   F +   +++
Sbjct: 132 VLAGLAIAVHLGLHVKVTEIFLGSYQALPPGAFPD-ADLFRQWGLGGISRAFALGFSIAA 190

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLSIEIIVYQ 238
           PF+   +++N+++G +N+ +PQ+ +  I  P   L GL  L + L   ++V+ 
Sbjct: 191 PFVIAGLIYNVALGAINRAMPQLMVSMIGAPAQTLGGLALLMIALPTGLLVWN 243


>gi|304321149|ref|YP_003854792.1| Flagellar biosynthesis pathway, component FliR [Parvularcula
           bermudensis HTCC2503]
 gi|303300051|gb|ADM09650.1| Flagellar biosynthesis pathway, component FliR [Parvularcula
           bermudensis HTCC2503]
          Length = 256

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 103/211 (48%), Gaps = 17/211 (8%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           I  R+ + ++LLPGL    IP++VRL   +  +  +LP + D    +     A    LV+
Sbjct: 23  IFARLTAMLVLLPGLGQLAIPVRVRLMAGLVMTSTILPVILD----RPLPALAISDPLVL 78

Query: 75  V--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII- 131
           +  E+ +G   G   R++   L   G++++ +  L+     G++     T  N  +G++ 
Sbjct: 79  IVFEVVIGAALGYGFRIFIWALSIAGTIVAQSASLSQLFGAGLN-----TEPNPSVGLLL 133

Query: 132 ---GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRLSS 187
              G      ++FH +    + +SY   P+G EL   ++ + +  +     F + + LS 
Sbjct: 134 TMAGATLFMTMEFHVRAVGLIAESYELFPLG-ELPRTDVLAEWATHRAMAAFALGVSLSL 192

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           PFL    ++NI +G++N+ +PQ+ + FI  P
Sbjct: 193 PFLLVNFLYNIVLGMMNQAMPQMMVTFIGVP 223


>gi|32266203|ref|NP_860235.1| flagellar biosynthesis protein FliR [Helicobacter hepaticus ATCC
           51449]
 gi|32262253|gb|AAP77301.1| flagellar biosynthetic protein FliR [Helicobacter hepaticus ATCC
           51449]
          Length = 258

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 96/235 (40%), Gaps = 3/235 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R G      P      I + +R       S+   P    T+     V    +    
Sbjct: 18  LLIARFGGVFAFFPFFDNQLISIHIRAAMVFFMSVAFFPLATYTLPDMTMVE---FLIAA 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ LG +  + +++    L F G +IS  +G  + ++        +  +  LI IIGL
Sbjct: 75  LFEIMLGFIASVCLQIVFAMLSFGGEIISFTMGFTMASAYDPVSGTQKPIIAQLIAIIGL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L    +DFHH +F  +  S    P+G  +      + FV      F +   ++ P L   
Sbjct: 135 LVALSLDFHHTIFLIISHSIEATPLGGFVFEPKSAAYFVKAFSNIFAVGFSMAFPILAII 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
           ++ +I  G++ K  PQ  +  I  P  I +  + L L+I  I+Y F +     FF
Sbjct: 195 LLSDIIFGMIMKTHPQFNLLVIGFPVKIAIAFVVLVLTISTIMYTFKNELKNAFF 249


>gi|115350083|ref|YP_771922.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria AMMD]
 gi|115280071|gb|ABI85588.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria AMMD]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 109/230 (47%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F     +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAPGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      + A   +   +  I +LA 
Sbjct: 79  FLIGIALGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGRFLNAIAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ T+P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248


>gi|229827382|ref|ZP_04453451.1| hypothetical protein GCWU000182_02770 [Abiotrophia defectiva ATCC
           49176]
 gi|229788320|gb|EEP24434.1| hypothetical protein GCWU000182_02770 [Abiotrophia defectiva ATCC
           49176]
          Length = 260

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 100/221 (45%), Gaps = 6/221 (2%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL-LPFLWDTIDLQNFVNRAYYSKLV 73
           IV RV + +   P  +   IP Q+++ F + FS +L L   +  +     +    ++ +V
Sbjct: 18  IVTRVSAFVFTSPFFNFGSIPRQLKVAFTLIFSALLYLTLPYTEVRYPGIIG---FTFMV 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           M E   G + G    +    L FTG +I   IG  + T       +  +   +L     +
Sbjct: 75  MSEALAGGMLGYFTNIVMTILNFTGRLIDMEIGFAMVTMFDPVFKVDTSVSGNLYNYFTI 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L L + +FHH    A V +Y  IPIG+ +   N  +   + L   F+I +RL  P     
Sbjct: 135 LLLLIGNFHHYFLAAFVDAYKVIPIGRAMVNANTVNVIADFLGNYFLIAMRLMLPIYATM 194

Query: 194 IVFNISIGLLNKLVPQIPIYF--ISTPYLIGLGSLFLCLSI 232
           ++ N  +G++ K+ PQ+ ++   I    L+GL  + L  S+
Sbjct: 195 LLVNAVLGVMAKVAPQMNMFVVGIQLKLLVGLAVMVLMTSM 235


>gi|146312187|ref|YP_001177261.1| flagellar biosynthesis protein FliR [Enterobacter sp. 638]
 gi|145319063|gb|ABP61210.1| flagellar biosynthetic protein FliR [Enterobacter sp. 638]
          Length = 264

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 108/231 (46%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + IM  P LS   IP +V++   M  + V+ P L   +++  F  +A +  L
Sbjct: 17  FWPLLRVMALIMTAPILSEKSIPKRVKIGLGMLITFVIAPTL-PPVNVPIFSPQAIW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  +++    ++  G +I   +GL+  T       L    L  +I ++ 
Sbjct: 74  ALQQVLIGVAIGFTMQLAFAAIRTAGELIGLQMGLSFATFFDPGSHLNMPVLARVIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISMLVDTFHTLPIGGNPVNSNAFLALTRAAGLIFINGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+S+GLLN++ PQ+ ++ I  P  + +G + + L + +I     H F
Sbjct: 194 LLTVNLSLGLLNRMAPQLSVFVIGFPITLTVGLILMGLLMPLIAPFCEHLF 244


>gi|157363488|ref|YP_001470255.1| flagellar biosynthetic protein FliR [Thermotoga lettingae TMO]
 gi|157314092|gb|ABV33191.1| flagellar biosynthetic protein FliR [Thermotoga lettingae TMO]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 107/237 (45%), Gaps = 5/237 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E   ++  L+V R      + P  +  ++P+QV++   +  S  +LP + + I L   V 
Sbjct: 8   ETKFLAWVLVVTRNAGMFTIAPFFADWFVPLQVKVLLVVFLSWTVLPSINEVIPLHTPVA 67

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           +   S L      +G   G L  +  + L   G V  T +G  L +         E P++
Sbjct: 68  QIVLSMLS--NYVIGLTIGFLALLPVIALSIAGEVFGTQMGFALSSVF--DPQREEVPIH 123

Query: 126 -SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
             L+ + GL     +  H  ++ A+V S  +IP+ + L   N  S     +   F I ++
Sbjct: 124 GELLYVFGLYIFVALKGHLLIYQAVVDSLNSIPVSKTLIDFNFVSVLTEKISEMFSIAMK 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +  P + F  V +IS+G++++LVPQ+ ++ +  P  I +G + +   I +    FS 
Sbjct: 184 IGMPMIGFMFVTSISLGIISRLVPQMNVFMVGMPLKILVGFILMVGMIPVWADVFSQ 240


>gi|320354334|ref|YP_004195673.1| flagellar biosynthetic protein FliR [Desulfobulbus propionicus DSM
           2032]
 gi|320122836|gb|ADW18382.1| flagellar biosynthetic protein FliR [Desulfobulbus propionicus DSM
           2032]
          Length = 259

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L + RV + +  +P  + S I  ++++  A+A S++L P +   I    F     +  L+
Sbjct: 16  LCLARVLALVAAIPAFAGSAISGRIKIGLAVATSLLLFPAMAPHIPKVAF-TLTEFGLLI 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ LG + GL+ ++    + F G+VI   +G           +   + ++    I+ L
Sbjct: 75  VNEVLLGVMIGLVTQMVFAAVSFGGTVIGYQMGFAAANIFDPQTTQQLSLMSQFANILAL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGN-IFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L    +D HH  F ALV+SY  +P G  L+F +      + +    F++ ++ S+P L  
Sbjct: 135 LVFLALDMHHFFFRALVESYHLLPPG-PLDFSHGAVEELMRLASRMFVLGVKFSAPVLTL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
            ++ N+ +G+L ++ PQ+ ++ +S P  IG+  L + L++
Sbjct: 194 LLLTNLVLGILARVFPQLNVFMLSFPLNIGIAFLVIGLTL 233


>gi|134294168|ref|YP_001117903.1| flagellar biosynthetic protein FliR [Burkholderia vietnamiensis G4]
 gi|134137325|gb|ABO53068.1| flagellar biosynthetic protein FliR [Burkholderia vietnamiensis G4]
          Length = 260

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 107/230 (46%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +    +PM+V++  A   ++V+ P L     +  F  +  +  +V+ +
Sbjct: 21  VRMLALVATAPLVGHGAVPMRVKIGLAAFMALVVAPTLGAMPGVTVFSAQGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  + +    ++  G  I  ++GL   T      + A   +   +  + +LA 
Sbjct: 79  FLIGVSMGFTMHLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ T+P+  EL     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQTLPVSAELLHAPGWHTLAAFGVTVFQMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248


>gi|330961235|gb|EGH61495.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 258

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 110/223 (49%), Gaps = 3/223 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ S +M +P +  + +P +VRL  A+A ++V+ P L +   +Q     A    L+  ++
Sbjct: 22  RIISLLMTMPIIGTTLVPRRVRLYLAVAITVVVAPALPNMPPVQALDLSALL--LIGEQI 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   GL ++++       G +IST +G+   + +  ++ ++   +     ++  L   
Sbjct: 80  IIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTMLVTLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P +   ++ N
Sbjct: 140 SMNGHLVVLEILVESFTTMPVGSGLLVNN-FWELANGLGWVLSSGLRLVLPAITALLIIN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I+ G++ +  PQ+ I+ I  P  + +G + L L+I  I+ Q+ 
Sbjct: 199 IAFGVMTRAAPQLNIFSIGFPLTLVMGMVILWLTIGDILNQYQ 241


>gi|260574395|ref|ZP_05842399.1| type III secretion system inner membrane R protein [Rhodobacter sp.
           SW2]
 gi|259023291|gb|EEW26583.1| type III secretion system inner membrane R protein [Rhodobacter sp.
           SW2]
          Length = 259

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 101/212 (47%), Gaps = 18/212 (8%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-DTIDLQNFVNRAYYSK 71
           FL++ RVG+ + LLP      +P++VRL  A+AF+ ++ P +  + + L   +     ++
Sbjct: 23  FLVLLRVGAAMALLPAFGEQSVPVRVRLVLALAFTAIVAPAVATEVVPLAGSIALPLATE 82

Query: 72  LVMVELFLGC-----VHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            VM  L +G      +H L I         + S +    G   Q ++G           +
Sbjct: 83  -VMAGLIIGIGLRLFIHALQIAGAIAAQAASLSQLFAGAGAEPQPAIG-----------N 130

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ + GL    +   H ++    ++SY   P G+  N  ++    +  +   F +   L+
Sbjct: 131 LLTMAGLALAVMAGLHVRMAELFIQSYQVFPAGRLPNSADLADWGLFQIGRVFSLGFVLA 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           SPF+   +++N+++G++N+ +PQ+ + F+  P
Sbjct: 191 SPFVIASLIYNVALGIINRAMPQLMVAFVGAP 222


>gi|170694402|ref|ZP_02885556.1| flagellar biosynthetic protein FliR [Burkholderia graminis C4D1M]
 gi|170140825|gb|EDT08999.1| flagellar biosynthetic protein FliR [Burkholderia graminis C4D1M]
          Length = 260

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 107/230 (46%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L    +P++V++  A   +I++ P L     +  F     +  +++ +
Sbjct: 21  VRILALVATAPVLGNRSLPLRVKIGLAAFVTIIVAPTLGALPQVTVFSAEGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  +   +GL   T      S +   L++ +  I +L  
Sbjct: 79  FLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDAQASSSSQVLSTYMYTIAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            VID H Q+  AL+ ++ T+P+   +     + +  N   T F   L LS P +   ++ 
Sbjct: 139 LVIDGHLQMISALLATFNTLPVSANILGSPGWRTLANFGSTIFSAGLLLSLPVVAALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI ++ I  P  + +G L L L    ++  F+  F  G
Sbjct: 199 NLALGILNRAAPQIGVFQIGFPLTMLIGMLLLQLMTPNMIPFFARLFTVG 248


>gi|240145486|ref|ZP_04744087.1| flagellar biosynthetic protein FliR [Roseburia intestinalis L1-82]
 gi|257202301|gb|EEV00586.1| flagellar biosynthetic protein FliR [Roseburia intestinalis L1-82]
          Length = 259

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 106/225 (47%), Gaps = 7/225 (3%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYYS 70
           L LI+ R+   + + P       P Q ++ F+   ++++  F+  T I+    +    Y+
Sbjct: 14  LILILVRISCFVYIAPFFGTKNAPSQAKIGFSFFVALLVYGFVDKTAIEYTGLIG---YA 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +V+ E   G + G    +    + F G++I   IGL++ T    + +   T   +L   
Sbjct: 71  IIVLKEGITGLLIGFAANICNSIILFAGNIIDMDIGLSMVTEFDPTMNTQVTITGNLYNY 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
             LL L   D HH +  A+V S+  IPI GQ  N+ ++  S    +   F+I  R+  P 
Sbjct: 131 FILLLLIATDMHHVILQAVVDSFTVIPINGQFFNWDSLAGSITQYMTDLFVIGFRIFLPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFI--STPYLIGLGSLFLCLSI 232
               ++ N  +G+L K+ PQ+ ++ +      L+G G LFL +S+
Sbjct: 191 FACMMILNCILGILAKVAPQMNMFAVGMQMKILVGFGVLFLTISL 235


>gi|291536021|emb|CBL09133.1| flagellar biosynthetic protein FliR [Roseburia intestinalis M50/1]
          Length = 259

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 106/225 (47%), Gaps = 7/225 (3%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYYS 70
           L LI+ R+   + + P       P Q ++ F+   ++++  F+  T I+    +    Y+
Sbjct: 14  LILILVRISCFVYIAPFFGTKNAPSQAKIGFSFFVALLVYGFVDKTAIEYTGLIG---YA 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +V+ E   G + G    +    + F G++I   IGL++ T    + +   T   +L   
Sbjct: 71  IIVLKEGITGLLIGFAANICNSIILFAGNIIDMDIGLSMVTEFDPTMNTQVTITGNLYNY 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
             LL L   D HH +  A+V S+  +PI GQ  N+ ++  S    +   F+I  R+  P 
Sbjct: 131 FILLLLIATDMHHVILQAVVDSFTVVPINGQIFNWDSLAGSITQYMTDLFVIGFRIFLPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFI--STPYLIGLGSLFLCLSI 232
               ++ N  +G+L K+ PQ+ ++ +      L+G G LFL +S+
Sbjct: 191 FACMMILNCILGILAKVAPQMNMFAVGMQMKILVGFGVLFLTISL 235


>gi|42524692|ref|NP_970072.1| flagellar biosynthetic protein FliR [Bdellovibrio bacteriovorus
           HD100]
 gi|39576902|emb|CAE78131.1| flagellar biosynthetic protein FliR [Bdellovibrio bacteriovorus
           HD100]
          Length = 259

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 83/162 (51%), Gaps = 12/162 (7%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT----SMGISDSLAETPLNSLIGII 131
           EL +G   G L R++   +  TG ++S ++GL+        MG    + E   +++    
Sbjct: 78  ELIVGLALGFLTRLFFFVVSMTGDLVSMSVGLSAAQLYNPMMGSQGGVIEQFYSAM---- 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L    I+ HH +  A+ +SY  +P+    LNFG  F+      Q  F++ +++ +P L
Sbjct: 134 ATLVFLAINGHHMLISAIAQSYELVPVSSLALNFGP-FAEIAVFGQVAFVMAIKMCAPVL 192

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCL 230
              ++ N+++G+L + VPQI +   S P   ++G+  +F+CL
Sbjct: 193 VAILIVNLAMGILGRAVPQINVLVTSMPVTIMLGMAVVFICL 234


>gi|296103570|ref|YP_003613716.1| flagellar biosynthesis protein FliR [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058029|gb|ADF62767.1| flagellar biosynthesis protein FliR [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 261

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 108/231 (46%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P LS   IP +V++   +  +I++ P L   +++  F   A +  L
Sbjct: 17  FWPMLRILALITTAPILSEKAIPKRVKVGLGIIITIIVAPSL-PAVNIPIFSANAVWVAL 75

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G   G  +++    ++  G +I   +GL+  T +     L    L  +I ++ 
Sbjct: 76  Q--QILIGVAVGFTMQLAFAAVRTAGELIGLQMGLSFATFVDPGSHLNMPVLARIIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG+     N F +        F+  L L+ P +  
Sbjct: 134 MLLFLSFNGHLWLISMLVDTFHTLPIGENPVNSNAFLALTRAAGLVFLNGLMLALPIITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ ++ I  P  + +G L + L + +I     H F
Sbjct: 194 LLTVNLALGLLNRMAPQLSVFVIGFPLTLTVGILLMSLLMPLIAPFCEHLF 244


>gi|253573536|ref|ZP_04850879.1| flagellar biosynthetic protein FliR [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251847064|gb|EES75069.1| flagellar biosynthetic protein FliR [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 262

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 100/215 (46%), Gaps = 7/215 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI CR+ +  ++ P  S   +P   ++ FA   ++V+L  +      Q+  N   Y  ++
Sbjct: 13  LIFCRMTAFFVVSPIFSSRSVPNTFKVGFAGIIAVVILLTIGPN---QSIPNDLGYILVI 69

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G +  +    +Q  GS I   IG  +   +      +   L +L  II  
Sbjct: 70  IREVLVGLLMGYVANLIFSVIQMAGSFIDIQIGFGIANVIDPMTGASAPVLGNLKYIIAT 129

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIG----QELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           L    ++ HH +  A+++SY  +P+     Q++  GN+    V      FM+  ++S+P 
Sbjct: 130 LVFLSMNGHHYLLDAVIRSYNWVPLSNQVFQQIYNGNLSEFLVQTFSQAFMLAFQMSAPL 189

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +    V ++++G L +  PQ  I+ I  P  I +G
Sbjct: 190 VVALFVTDVALGFLARTAPQFNIFVIGIPVKIIVG 224


>gi|225375341|ref|ZP_03752562.1| hypothetical protein ROSEINA2194_00966 [Roseburia inulinivorans DSM
           16841]
 gi|225212830|gb|EEG95184.1| hypothetical protein ROSEINA2194_00966 [Roseburia inulinivorans DSM
           16841]
          Length = 259

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 106/223 (47%), Gaps = 3/223 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ RV   + + P   MS +P QV++   ++  I LL   +  +    +     Y+ +V
Sbjct: 16  LILVRVSCFVYIAPFYGMSNVPNQVKI--GLSAMIALLVSGFADVSQVEYTGLIGYAVIV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E   G + GL   V    + F G++I   IGL++ T     ++   T   +L     L
Sbjct: 74  LKEGITGLLIGLAANVCNSIILFAGNIIDMDIGLSMATEFDPINNAQVTLTGNLYNYFIL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           + L V D HH +  A V ++  IP+ GQ  ++ ++  S    +   F+I  R+  P    
Sbjct: 134 MLLVVTDMHHYILRAFVDAFTVIPVNGQVFDWEHLMRSMTTYMGDMFVIAFRIILPVFAC 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            ++ N  +G++ K+ PQ+ ++ +     I +G + L L++ ++
Sbjct: 194 IMILNCILGIMAKVSPQMNMFAVGMQMKIMVGFVVLFLTVSLL 236


>gi|304404262|ref|ZP_07385924.1| flagellar biosynthetic protein FliR [Paenibacillus curdlanolyticus
           YK9]
 gi|304347240|gb|EFM13072.1| flagellar biosynthetic protein FliR [Paenibacillus curdlanolyticus
           YK9]
          Length = 263

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 113/235 (48%), Gaps = 9/235 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI CR+ +  ++ P  SM  +P   ++   + F + L+ FL   +  ++ V  A Y   V
Sbjct: 13  LIFCRMTAFFVVAPLFSMRGVPTTFKI--GLGFFLTLIVFLTYGVK-ESIVPDATYILFV 69

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G ++ ++   +Q  G+++  ++G  +   +      +   L +L  +I +
Sbjct: 70  IREVLVGLLLGFVVYLFFTVVQTAGALMDISMGFAMSNVVDPMTGASSPMLGNLKYMILV 129

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVN-----MLQTTFMIMLRLSSP 188
           L    ++ HH +  AL+ SY  +P+  +L F  I+S  V+         TFM+  +++SP
Sbjct: 130 LVFLSMNGHHYMLTALMDSYKWMPLDNDL-FARIYSGKVSEFIVLAFSETFMLAFQIASP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +    + ++ +G L K  PQ  ++ I  P  I +G   L L +  +   F H F
Sbjct: 189 IIVAMFLTDVGLGFLAKTAPQYNVFVIGMPLKILIGVFMLTLILPSMSGVFEHLF 243


>gi|148261121|ref|YP_001235248.1| type III secretion system inner membrane R protein [Acidiphilium
           cryptum JF-5]
 gi|326404522|ref|YP_004284604.1| flagellar biosynthetic protein FliR [Acidiphilium multivorum
           AIU301]
 gi|146402802|gb|ABQ31329.1| type III secretion system inner membrane R protein [Acidiphilium
           cryptum JF-5]
 gi|325051384|dbj|BAJ81722.1| flagellar biosynthetic protein FliR [Acidiphilium multivorum
           AIU301]
          Length = 259

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 112/231 (48%), Gaps = 26/231 (11%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVNRAYYSK 71
            LI  R+ S +M LP +     P Q+R+  ++A + ++ P +   TI + + +    +  
Sbjct: 14  LLIFIRISSLVMALPFMGAGNAPPQIRIGLSIALTAIVAPLIVSGTIGVPSSIP--VFVF 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN----LQTSMGISDSLAETPLNSL 127
           LV+ E+ +G   G L     L L   G +IS  +GL+        +G + +L    L+ +
Sbjct: 72  LVLREIVVGLSLGWLTAAIMLSLPVAGQIISYQMGLSSVLLPNVEIGPNSTLVANALSVM 131

Query: 128 IGII----GLLALWVIDFHHQVFYALVKSYGTIP-----IGQELNFGNIFSSF-VNMLQT 177
           +  +    GL  L V+        A+++S+  IP     IG  L    +   F V  +  
Sbjct: 132 LPAVVFTTGLFMLPVL--------AIIRSFRVIPLTSTIIGAHLPPAGLLLGFAVRAVSA 183

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
            F+  L L++PFLF  +++   +GL++K+ P + +YF++ P  + LG +FL
Sbjct: 184 EFVTALHLAAPFLFIGLLWQAGLGLMSKVAPSMQVYFVAAPLQL-LGGMFL 233


>gi|317406212|gb|EFV86460.1| flagellar biosynthetic protein FliR [Achromobacter xylosoxidans
           C54]
          Length = 262

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 95/203 (46%), Gaps = 6/203 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           R+ + +   P  S S +P++V++  A   ++ + P L    D    +    ++ L  VM 
Sbjct: 22  RILALVGTAPLFSESTVPVKVKIGLAFVLAVAVSPAL----DPAPPIAPGSFAGLWMVMQ 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+ L  I+ +L 
Sbjct: 78  QVLIGIAMGFTMRLVFAAVQTAGEFVGLQMGLSFASFFDPSTGANTAVLSRLFNIVAMLT 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H  V  ALV+S+ T+P+       N +   V   +T F+  L L+ P +   + 
Sbjct: 138 FLALDGHLLVLAALVRSFDTLPVAAIQLHQNGWGVVVEWGKTVFVSGLLLALPLICALLT 197

Query: 196 FNISIGLLNKLVPQIPIYFISTP 218
            N+++G+LN+  PQ+ ++ +  P
Sbjct: 198 INLAMGILNRAAPQLSVFSVGFP 220


>gi|30248475|ref|NP_840545.1| hypothetical protein NE0459 [Nitrosomonas europaea ATCC 19718]
 gi|30138361|emb|CAD84370.1| Bacterial export protein, family 1 [Nitrosomonas europaea ATCC
           19718]
          Length = 265

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           ++M ++ +G   G  +R+    ++  G +    +GL   T      S     +    G++
Sbjct: 74  VLMQQIIIGLAMGFSMRIVFTAVEMAGEITGLQMGLGFATFFDPQQSGQVQLVGRFYGLL 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L    ID H QV   L  S+ T+PIG E      F++ VN     FM+ L LS P L 
Sbjct: 134 ATLTFLAIDGHLQVIAILAHSFTTLPIGAEGMSTTSFTALVNWGIKIFMLGLHLSLPVLT 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
             ++ N+++G+L +  PQ+ I+ +  P  +G+G L +  ++
Sbjct: 194 ALLITNLALGILTRAAPQLNIFAVGFPLTLGIGLLVMSWAL 234


>gi|94986974|ref|YP_594907.1| flagellar biosynthesis pathway, component FliR [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731223|emb|CAJ54586.1| Flagellar biosynthesis pathway, component FliR [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 262

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 113/243 (46%), Gaps = 14/243 (5%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +S  L   R+   + +LP  S+   P  ++   A+  +IVL    W  + L      A+ 
Sbjct: 12  LSFLLTFLRISVVLFMLPFFSIDGFPNMLKASIALILTIVL----WGRLSLSGTQMPAHP 67

Query: 70  SKLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP--- 123
             LV++   E+FLG V GL +  +  G+Q  G +++T +G  + T   ++D L       
Sbjct: 68  FDLVLLIISEVFLGIVLGLAVNFFFAGIQAGGEILATQMGFTMIT---LADPLTGNTTGF 124

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           +   + ++  L    ++ H  +  A   ++  +P G  +    + S  +NM    F+  L
Sbjct: 125 IAHFLYMVATLVFLALNGHLFLIKAFTYTFKMVPAGGLVVREILLSELLNMAGMIFVFAL 184

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +++P +    +  IS+GL+ +  PQI I  +  P  IG+G  F+ L   I+  + ++ F
Sbjct: 185 HVAAPVMSALFLVEISLGLMARAAPQIHIMEVGFPVKIGVGFFFIGLLFTILSKE-TYRF 243

Query: 244 LYG 246
           + G
Sbjct: 244 IAG 246


>gi|325295423|ref|YP_004281937.1| flagellar biosynthetic protein FliR [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065871|gb|ADY73878.1| flagellar biosynthetic protein FliR [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 260

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 117/243 (48%), Gaps = 9/243 (3%)

Query: 1   MTISPEIIMMSLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-- 57
           MT   +I   SLFL+   RV S  +  P +S + IP+ +R+   +AFS  L   +  +  
Sbjct: 1   MTEILDIHTFSLFLLTFVRVASFFLAFPFISTTLIPLNIRILLILAFSFYLSQIIEPSQM 60

Query: 58  IDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD 117
           ID+   ++   +  LV+ E+ LG    +L  +Y+        +IS ++GL   T + I D
Sbjct: 61  IDITK-IDLLSFFLLVIKEVLLGISFSILTTIYSSIFIHAAELISYSMGL---TIVNIFD 116

Query: 118 SL--AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNML 175
           S   + + L+     I  +  +  D +     A V+S+  IPIG      ++   F+   
Sbjct: 117 STFGSISVLSRFFVYIFYVVFFFTDAYKIFIAAFVESFKIIPIGNFHLSDSLLYFFLKES 176

Query: 176 QTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           +  F +  +++ PF+    + N+ + L+N+L+PQI ++ +  P  I +G  FL     I+
Sbjct: 177 KLIFFLSFKIAFPFIITLFITNLILALVNRLIPQINVFIVGLPLQIFIGLFFLSTGFSIL 236

Query: 236 VYQ 238
           +Y 
Sbjct: 237 IYS 239


>gi|261340415|ref|ZP_05968273.1| flagellar biosynthetic protein FliR [Enterobacter cancerogenus ATCC
           35316]
 gi|288317507|gb|EFC56445.1| flagellar biosynthetic protein FliR [Enterobacter cancerogenus ATCC
           35316]
          Length = 261

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 108/231 (46%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V++   +  +I++ P L   +D+  F  +A +  L
Sbjct: 17  FWPMLRVLALISTAPILSERTIPKRVKVGLGIIITIIIAPSL-PPVDIPIFSAKAVWVAL 75

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G   G  +++    ++  G +I   +GL+  T +     L    L  +I ++ 
Sbjct: 76  Q--QIMIGVAVGFTMQLAFAAVRTAGELIGLQMGLSFATFIDPGSHLNMPVLARIIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISMLVDTFHTLPIGDNPVNSNAFLALTRAAGLIFLNGLMLALPIITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+S+GLLN++ PQ+ ++ I  P  + +G L + L + +I     H F
Sbjct: 194 LLTVNLSLGLLNRMAPQLSVFVIGFPVTLTVGILLMSLLMPLIAPFCEHLF 244


>gi|260429506|ref|ZP_05783483.1| flagellar biosynthetic protein FliR [Citreicella sp. SE45]
 gi|260420129|gb|EEX13382.1| flagellar biosynthetic protein FliR [Citreicella sp. SE45]
          Length = 248

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 105/213 (49%), Gaps = 4/213 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+ +  LPGL    IP++VR+  A+  +  +L  +   + L         ++ V+ E 
Sbjct: 17  RIGAMMASLPGLGEQIIPVRVRMVLALVLTAAVLSAVLPGMALPP-PGLGALARAVLTET 75

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G   GL +R++   LQ  GS+ + +   +L   +G S +     +  L+ +  L  L 
Sbjct: 76  VNGLAIGLWLRLFIHALQTAGSIAAQST--SLAQLLGNSAADPMPAIGHLLTVAALALLM 133

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
              FH +    +V SY  +P  +  +   I  +    +  +F++   L++PF+    ++N
Sbjct: 134 TTGFHVKAAAFVVLSYDLLPAMRFPDPSMIAQAGRGQIARSFLLAFTLAAPFVILSALYN 193

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           +++G +NK +PQ+ + F+  P +I LGS+ L L
Sbjct: 194 LTLGFINKAMPQLMVAFVGAP-VITLGSIALLL 225


>gi|330976010|gb|EGH76076.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 258

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 113/230 (49%), Gaps = 3/230 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q     A   
Sbjct: 15  SFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDLSALL- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +     +
Sbjct: 74  -LIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTM 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P +
Sbjct: 133 LVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNN-FWELANGLGWALASGLRLVLPAI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
              ++ NI+ G++ +  PQ+ I+ I  P  + LG++ L +++  ++ Q+ 
Sbjct: 192 TALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGTVILWMTMGDMLNQYQ 241


>gi|169827138|ref|YP_001697296.1| flagellar biosynthesis protein FliR [Lysinibacillus sphaericus
           C3-41]
 gi|168991626|gb|ACA39166.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 257

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 114/232 (49%), Gaps = 14/232 (6%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV +  + +P  S   IP QV++  A+    VL   ++ TID++ F     Y  LV
Sbjct: 13  LVLVRVSAFFVTVPFFSYRTIPPQVKITLAL----VLAWMMYYTIDVEPFAFNDDYILLV 68

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIG 132
           M E  +G + GL+  +    +Q  GS I   +G  +   +    + A++PL      ++ 
Sbjct: 69  MKEALVGLLLGLVGYIIMSAIQIAGSFIDFQMGFAIANIID-PQTGAQSPLIGQFFNMLA 127

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT----FMIMLRLSSP 188
            L L  I+ HH +   +  SY  +P+ Q  +F N   SF   + TT    F I  ++++P
Sbjct: 128 FLLLLAINGHHMILDGIYYSYQFLPMDQFPSFTN--DSFPQFIITTFTAVFAIAFQMAAP 185

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
            +    + ++++G+  K VPQ+ I+ +  P  IG+    LF  +++ I V Q
Sbjct: 186 VVATLFLVDLALGITAKTVPQLNIFVVGFPIKIGVSFLVLFTMMAVMIQVIQ 237


>gi|218670290|ref|ZP_03519961.1| flagellar biosynthesis protein FliR [Rhizobium etli GR56]
          Length = 62

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 40/58 (68%)

Query: 1  MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI 58
          M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI +LP LWDT+
Sbjct: 1  MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIAVLPLLWDTV 58


>gi|254251036|ref|ZP_04944354.1| Flagellar biosynthesis pathway component FliR [Burkholderia dolosa
           AUO158]
 gi|124893645|gb|EAY67525.1| Flagellar biosynthesis pathway component FliR [Burkholderia dolosa
           AUO158]
          Length = 260

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 106/230 (46%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P + ++  A   ++++ P L     +  F     +  +V+++
Sbjct: 21  VRMLALVATAPVVGHASVPARAKIGVAAFMALIVAPTLGAMPGVTVFSAEGIW--IVVMQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAAMGFTMQIVFAAVEAAGDYIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ T+P+   L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQTLPVSAALLHAPGWRTLAAFGATVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI I+ I  P  + +G L + L +  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMVPNLVPFVSHLFDMG 248


>gi|307546960|ref|YP_003899439.1| flagellar biosynthetic protein FliR [Halomonas elongata DSM 2581]
 gi|307218984|emb|CBV44254.1| K02421 flagellar biosynthetic protein FliR [Halomonas elongata DSM
           2581]
          Length = 266

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 96/212 (45%), Gaps = 2/212 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+   ++  P    S +P Q ++  A A ++V+ P L    D+     +     ++  +
Sbjct: 21  ARITGLMLSSPLWGHSSVPRQAKIALAGALTVVIAPMLPPMPDVAIVSWQGL--GILTEQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           L +G   GL++RV    +Q TG  I   +GL   T    S       L+ L+ +I LL  
Sbjct: 79  LLIGAAMGLVMRVTLAVVQATGEFIGLQMGLAFATFFDPSSGTNMMVLSRLLYMITLLMF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H  V   L  S+ ++PIG        F   V    T F   + L+ P +   ++ 
Sbjct: 139 LALDVHLVVLEVLANSFRSLPIGIGRFDPAAFMMLVRYGATIFTSGMLLALPLVASLLII 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
           N+S+G+LN+  PQ+ ++ I  P  + +G + L
Sbjct: 199 NLSLGILNRAAPQLTVFNIGFPTSLTVGIILL 230


>gi|33592490|ref|NP_880134.1| flagellar biosynthetic protein FliR [Bordetella pertussis Tohama I]
 gi|33572136|emb|CAE41679.1| flagellar biosynthetic protein FliR [Bordetella pertussis Tohama I]
 gi|332381908|gb|AEE66755.1| flagellar biosynthetic protein FliR [Bordetella pertussis CS]
          Length = 262

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 105/234 (44%), Gaps = 11/234 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV- 75
            R+ + +   P  S S IP +V++  A   +I + P     I     V  + Y+ L ++ 
Sbjct: 21  VRILALVGAAPLFSESTIPTRVKIGLAFMLTIAVAP----AIGPMPAVPPSSYAGLFLLS 76

Query: 76  -ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            ++ +G   GL +RV    +Q  G  +   +GL+  +    +       L+ L  I+ +L
Sbjct: 77  QQVLIGIALGLSMRVVFAAVQTAGEFVGLQMGLSFASFFDPATGANTAVLSRLFNIVAML 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               +D H  V  ALV+S+ T+P+   +   N +        T F+  L L+ P +   +
Sbjct: 137 VFLALDGHLLVLGALVRSFDTLPVAVGVLDRNGWGILAEWGTTIFVSGLLLALPLICALL 196

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
             N+++G+LN+  PQ+ ++ I  P      SL + L +  IV   S  FL   F
Sbjct: 197 TINLAMGILNRAAPQLSVFAIGFPV-----SLIVGLVLLAIVLPHSGPFLERLF 245


>gi|255021384|ref|ZP_05293432.1| Flagellar biosynthesis protein FliR [Acidithiobacillus caldus ATCC
           51756]
 gi|254969247|gb|EET26761.1| Flagellar biosynthesis protein FliR [Acidithiobacillus caldus ATCC
           51756]
          Length = 262

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 110/226 (48%), Gaps = 6/226 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P  S S +P+QVR+  A   S+ + P L  T+   +F++ A    LV  +
Sbjct: 21  VRILALLSTAPVFSASAVPIQVRVGLAAIISVAIAPAL-PTLPAVHFLSGAGLVLLVE-Q 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G   G  + +    +QF GSVIS  +GL   +    +  +    L++ + +  LL  
Sbjct: 79  IVIGTALGFAVTLIFSAVQFAGSVISLQMGLGFSSFFDPTTGVQVPTLSNFLNLAVLLFF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNF-GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
             ++    V   L++S+  +P+   L      +          F + + +++P L    +
Sbjct: 139 MALNGQLLVLVVLMRSFTVLPVDPNLVVHATAWHVLAAAGAAVFSLGMAIAAPVLGALFL 198

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSL---FLCLSIEIIVYQ 238
            NI++G+L+KL PQ+ ++ +  P LIG+G +    L  ++E++V Q
Sbjct: 199 VNIALGVLSKLAPQLNLFVVGFPLLIGVGLIGLYLLAPALELVVRQ 244


>gi|33601553|ref|NP_889113.1| flagellar biosynthetic protein [Bordetella bronchiseptica RB50]
 gi|33575989|emb|CAE33069.1| flagellar biosynthetic protein [Bordetella bronchiseptica RB50]
          Length = 262

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 105/234 (44%), Gaps = 11/234 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV- 75
            R+ + +   P  S S IP +V++  A   +I + P     I     V  + Y+ L ++ 
Sbjct: 21  VRILALVGAAPLFSESTIPTRVKIGLAFMLTIAVAP----AIGPMPAVPPSSYAGLFLLG 76

Query: 76  -ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            ++ +G   GL +RV    +Q  G  +   +GL+  +    +       L+ L  I+ +L
Sbjct: 77  QQVLIGIALGLSMRVVFAAVQTAGEFVGLQMGLSFASFFDPATGANTAVLSRLFNIVAML 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               +D H  V  ALV+S+ T+P+   +   N +        T F+  L L+ P +   +
Sbjct: 137 VFLALDGHLLVLGALVRSFDTLPVAVGVLDRNGWGILAEWGTTIFVSGLLLALPLICALL 196

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
             N+++G+LN+  PQ+ ++ I  P      SL + L +  IV   S  FL   F
Sbjct: 197 TINLAMGILNRAAPQLSVFAIGFPV-----SLIVGLVLLAIVLPHSGPFLERLF 245


>gi|32471371|ref|NP_864364.1| flagellar biosynthetic protein fliR [Rhodopirellula baltica SH 1]
 gi|32443212|emb|CAD72043.1| probable flagellar biosynthetic protein fliR [Rhodopirellula
           baltica SH 1]
          Length = 264

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 98/205 (47%), Gaps = 4/205 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID---LQNFVNRAYYS 70
           L++ R+G  +M +P + +  +P ++R   A+  + +L+P L    D   +    N    +
Sbjct: 17  LVLTRLGMLLMAMPAIGVG-VPKRIRALLALVLTAILMPTLAAQCDHPSMPTIDNLPELA 75

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             +  E  +G + G   ++   GLQ  G  I++  G+ L  S+  + S +   L  ++G+
Sbjct: 76  VAIGREALIGMLIGATTQMVITGLQLAGEAITSTGGMQLGDSIDPTTSSSMPALARMVGM 135

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +    + +   H  V   LV+S+  IP G      ++  + + ++  +    +R++ P +
Sbjct: 136 LVTTVMLITGAHRVVLRLLVESFQHIPPGNVQFTDSMMDAVIVVMGNSMASGVRVAGPVI 195

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFI 215
              ++ N+  GL+++ +PQI +  I
Sbjct: 196 AALLLANLVTGLISRTLPQINVLAI 220


>gi|302185377|ref|ZP_07262050.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae 642]
          Length = 258

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 112/230 (48%), Gaps = 3/230 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q     A   
Sbjct: 15  SFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDLSALL- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +     +
Sbjct: 74  -LIGEQIIIGAGMGLSLQLFFHIFVVAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTM 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P +
Sbjct: 133 LVTLLFLAMNGHLVVLEILVESFTTMPVGSGLLVNN-FWELANGLGWVLSSGLRLVLPAI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
              ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+ 
Sbjct: 192 TALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQ 241


>gi|327537627|gb|EGF24339.1| flagellar biosynthetic protein fliR [Rhodopirellula baltica WH47]
          Length = 264

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 98/205 (47%), Gaps = 4/205 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID---LQNFVNRAYYS 70
           L++ R+G  +M +P + +  +P ++R   A+  + +L+P L    D   +    N    +
Sbjct: 17  LVLTRLGMLLMAMPAIGVG-VPKRIRALLALVLTAILMPTLAAQCDHPSMPTIDNLPELA 75

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             +  E  +G + G   ++   GLQ  G  I++  G+ L  S+  + S +   L  ++G+
Sbjct: 76  VAIGREALIGMLIGATTQMVITGLQLAGEAITSTGGMQLGDSIDPTTSSSMPALARMVGM 135

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +    + +   H  V   LV+S+  IP G      ++  + + ++  +    +R++ P +
Sbjct: 136 LVTTVMLITGAHRVVLRLLVESFQHIPPGNVQFTDSMMDAVIVVMGNSMASGVRVAGPVI 195

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFI 215
              ++ N+  GL+++ +PQI +  I
Sbjct: 196 AALLLANLVTGLISRTLPQINVLAI 220


>gi|257484901|ref|ZP_05638942.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289651608|ref|ZP_06482951.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|320325129|gb|EFW81198.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329388|gb|EFW85381.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866460|gb|EGH01169.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330889045|gb|EGH21706.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986504|gb|EGH84607.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011079|gb|EGH91135.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 261

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 113/232 (48%), Gaps = 7/232 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q        S
Sbjct: 18  SFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQAL----DLS 73

Query: 71  KLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            L+++  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +    
Sbjct: 74  GLLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIGQFF 133

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P
Sbjct: 134 TMLVTLLFLSMNGHLVVLEVLVESFTTMPVGGGLLVNN-FWELANGLGWALSSGLRLVLP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +S+  I+ Q+ 
Sbjct: 193 AITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMSMGDILNQYQ 244


>gi|330953764|gb|EGH54024.1| flagellar biosynthesis protein FliR [Pseudomonas syringae Cit 7]
 gi|330972451|gb|EGH72517.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 258

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 112/230 (48%), Gaps = 3/230 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q     A   
Sbjct: 15  SFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDLSALL- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +     +
Sbjct: 74  -LIGEQIIIGAGMGLSLQLFFHIFVVAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTM 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P +
Sbjct: 133 LVTLLFLAMNGHLVVLEILVESFTTMPVGSGLLVNN-FWELANGLGWVLASGLRLVLPAI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
              ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+ 
Sbjct: 192 TALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQ 241


>gi|71735042|ref|YP_275526.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555595|gb|AAZ34806.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 258

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 113/232 (48%), Gaps = 7/232 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q        S
Sbjct: 15  SFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQAL----DLS 70

Query: 71  KLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            L+++  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +    
Sbjct: 71  GLLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIGQFF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P
Sbjct: 131 TMLVTLLFLFMNGHLVVLEVLVESFTTMPVGGGLLVNN-FWELANGLGWALSSGLRLVLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +S+  I+ Q+ 
Sbjct: 190 AITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMSMGDILNQYQ 241


>gi|289629018|ref|ZP_06461972.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298487819|ref|ZP_07005859.1| Flagellar biosynthesis protein fliR [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157544|gb|EFH98624.1| Flagellar biosynthesis protein fliR [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330880587|gb|EGH14736.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 258

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 113/232 (48%), Gaps = 7/232 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q        S
Sbjct: 15  SFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQAL----DLS 70

Query: 71  KLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            L+++  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +    
Sbjct: 71  GLLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIGQFF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P
Sbjct: 131 TMLVTLLFLSMNGHLVVLEVLVESFTTMPVGGGLLVNN-FWELANGLGWALSSGLRLVLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +S+  I+ Q+ 
Sbjct: 190 AITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMSMGDILNQYQ 241


>gi|311279108|ref|YP_003941339.1| flagellar biosynthetic protein FliR [Enterobacter cloacae SCF1]
 gi|308748303|gb|ADO48055.1| flagellar biosynthetic protein FliR [Enterobacter cloacae SCF1]
          Length = 264

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 110/231 (47%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + +   P LS   +P +V+L      + ++ P L  T D+  F   A +  L
Sbjct: 17  FWPLLRVLALVSTAPILSEKTVPKRVKLGLGFIITAIVAPTLPPT-DVTLFSPNALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  +++    ++  G +I   +GL+  T +  S +L+   L  ++ ++ 
Sbjct: 74  AIQQILIGIALGFTMQLAFAAIRTAGEIIGLQMGLSFATFVDPSSNLSMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L   V + H  +   LV ++ T+PIG     GN F +        F+  L L+ P +  
Sbjct: 134 MLLFLVFNGHLWLISLLVDTFHTLPIGGLPLNGNAFLALSRAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++G+LN++ PQ+ ++ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTINLALGMLNRMAPQLSVFVIGFPITLTVGLILMSALMPLIAPFCEHLF 244


>gi|330899443|gb|EGH30862.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 258

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 112/230 (48%), Gaps = 3/230 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q     A   
Sbjct: 15  SFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDLSALL- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +     +
Sbjct: 74  -LIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTM 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P +
Sbjct: 133 LVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNN-FWELANGLGWALASGLRLVLPAI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
              ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  ++ Q+ 
Sbjct: 192 TALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDMLNQYQ 241


>gi|268316330|ref|YP_003290049.1| flagellar biosynthetic protein FliR [Rhodothermus marinus DSM 4252]
 gi|262333864|gb|ACY47661.1| flagellar biosynthetic protein FliR [Rhodothermus marinus DSM 4252]
          Length = 258

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 109/227 (48%), Gaps = 11/227 (4%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFA--MAFSIVLLPFLWDTIDL 60
           ++PE  ++ + L+  R+   ++  P      IP++VR+  A  +A+S+  L        L
Sbjct: 4   LNPEY-LLRVLLVFVRISGVLLAAPFFGQLSIPVRVRVLLAVLLAYSLSGL----VAGPL 58

Query: 61  QNFVNRAY-YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
               ++A  +   V +E   G + G    +    ++  G +I   IGL++       +  
Sbjct: 59  PPHADQALGFIVAVALEALTGLLLGFAAHMIFWAVEMAGDLIGFQIGLHMAQVFNPLEGH 118

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
           A  PL  L+ +  L+   ++D HH V  ALV+S+  +P+    N        V  +    
Sbjct: 119 AANPLGRLLSLAALMIFVLLDGHHVVLRALVESFRVVPLAGA-NLAASQPLLVQWVWDFL 177

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLG 224
           ++ LRL++PF+   ++ ++++G+  ++VPQ  ++ I+ P   L+GL 
Sbjct: 178 VLALRLAAPFMVTILLIDVALGIFARVVPQADLFSIALPLKLLVGLA 224


>gi|311105948|ref|YP_003978801.1| flagellar biosynthetic protein FliR [Achromobacter xylosoxidans A8]
 gi|310760637|gb|ADP16086.1| flagellar biosynthetic protein FliR [Achromobacter xylosoxidans A8]
          Length = 262

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 106/234 (45%), Gaps = 11/234 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VM 74
            R+ + +   P  S S IP++V++  +   ++ + P L    D    +    ++ L  VM
Sbjct: 21  VRILALVGTAPLFSESLIPIKVKIGLSFVLAVAISPAL----DPVPPIAPGSFTGLWMVM 76

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+ L  II +L
Sbjct: 77  QQVLIGIALGFTMRLVFAAVQTAGEFVGLQMGLSFASFFDPSSGANTAVLSRLFNIIAML 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               +D H  V  ALV+S+ T+P+       N F   V   +T F+  L L+ P +   +
Sbjct: 137 TFLALDGHLLVLAALVRSFDTLPVAMIQLHQNGFGVVVEWGKTIFISGLLLALPLICALL 196

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
             N+++G+LN+   Q+ ++ I  P      +L + ++I  +V   +  FL   F
Sbjct: 197 TINLAMGILNRAAQQLSVFSIGFPV-----TLIIGVTILTVVLPHAGPFLESLF 245


>gi|163856446|ref|YP_001630744.1| flagellar biosynthesis protein FliR [Bordetella petrii DSM 12804]
 gi|163260174|emb|CAP42476.1| flagellar biosynthesis protein FliR [Bordetella petrii]
          Length = 262

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 95/202 (47%), Gaps = 10/202 (4%)

Query: 19  VGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV--E 76
           VGS     P  S S IP+++++  A   ++ + P L    +    +    Y+ L ++  +
Sbjct: 27  VGSA----PLFSESTIPIRIKVALAFMLTVAVAPGL----EPPPAIPPGSYAGLWLLGQQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G   G  +R+    +Q  G  +   +GL+  +    S       L+ L+ I+ +L  
Sbjct: 79  VLIGIAMGFTMRIVFAAVQTAGEFVGLQMGLSFASFFDPSTGANTAVLSRLLNIVAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H  V  ALV+S+  +P+ Q     N +   V   QT F+  L L+ P +   +  
Sbjct: 139 LALDGHLLVLAALVRSFDVLPLTQLTLDPNGWGILVQWGQTIFVSGLLLALPLICALLTI 198

Query: 197 NISIGLLNKLVPQIPIYFISTP 218
           N+++G+LN+  PQ+ ++ +  P
Sbjct: 199 NLAMGILNRAAPQLSVFAVGFP 220


>gi|66046671|ref|YP_236512.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257378|gb|AAY38474.1| Flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae B728a]
          Length = 261

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 112/230 (48%), Gaps = 3/230 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q     A   
Sbjct: 18  SFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDLSALL- 76

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +     +
Sbjct: 77  -LIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTM 135

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P +
Sbjct: 136 LVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNN-FWELANGLGWVLASGLRLVLPAI 194

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
              ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  ++ Q+ 
Sbjct: 195 TALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDMLNQYQ 244


>gi|330808230|ref|YP_004352692.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376338|gb|AEA67688.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 260

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 105/223 (47%), Gaps = 3/223 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + +M +P    + +P +VRL FA+A ++V+ P L     +      A    LV  ++
Sbjct: 24  RVTAVLMSMPVFGTTLVPRRVRLYFALAITVVIAPGLPPMPSVHALDLSALM--LVAEQI 81

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + G  ++++       G +IS  +G+   + +  ++ +    +   + ++  L   
Sbjct: 82  LIGTLMGFSLQLFFQAFVVAGQIISIQMGMAFASMVDPTNGVTTAVIGQFLTMLVTLLFL 141

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  VF  L +S+ T+P+G  L   N F      L       + L  P +   +V N
Sbjct: 142 AMNGHLVVFEVLTESFTTMPVGSAL-LVNHFWEIAGKLGWVLGAAMVLVLPAITALLVVN 200

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I+ G++ +  PQ+ I+ I  P ++ LG +   +S+  I+ Q+ 
Sbjct: 201 IAFGVMTRAAPQLNIFSIGFPLILTLGMVIFWISLGDILNQYQ 243


>gi|254519406|ref|ZP_05131462.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
 gi|226913155|gb|EEH98356.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
          Length = 614

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 112/214 (52%), Gaps = 7/214 (3%)

Query: 35  PMQVRLCFAMAFSIVLLPFLWDTIDLQNF--VNRAYYSKLVMV-ELFLGCVHGLLIRVYT 91
           P  ++  F++ FS  LL      ID  N   +   YY  + M+ E+  G V GL+  +  
Sbjct: 33  PKTLKAMFSLIFSFALL----GGIDYSNINSITSNYYLIIYMISEVTTGLVLGLISNIAF 88

Query: 92  LGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVK 151
             +   GS+I   IGL++  ++  +   + T   +L+  + L+  +V+D HH +  +L++
Sbjct: 89  EVVLMAGSLIDVHIGLSMVNTIDPNSKTSTTISGNLLHYVALMIFFVVDGHHMLIKSLIE 148

Query: 152 SYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIP 211
           S+  +P+G+ L + +     + ++   F+I L+++ P +   I+ ++ +GL+++ VPQI 
Sbjct: 149 SFIILPMGKSLMYTDTMMVLIEVIAKYFVIGLKIAIPIVLIIILTDLCMGLISRAVPQIN 208

Query: 212 IYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           +  +  P  + +G L + +S+ II+  F  S  Y
Sbjct: 209 VMILGMPVKMLVGILAISVSLPIIIKLFVISISY 242


>gi|255523689|ref|ZP_05390655.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
 gi|296186693|ref|ZP_06855095.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
 gi|255512558|gb|EET88832.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
 gi|296048730|gb|EFG88162.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
          Length = 320

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 115/238 (48%), Gaps = 6/238 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +L LI  R+    +++P    S  P  V++   +  + +L+P + D   + N  N   + 
Sbjct: 9   ALILISIRMFCFFVVVPIFFPSGTPATVKVGITLIMAYILIPGV-DYTGINNINNNLPFI 67

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
              M E   G   G +  +    ++F GS++   +G ++ T    + S   T +  ++  
Sbjct: 68  INCMNEAVAGFTLGFITNLCFNSVRFAGSIMDMQVGFSMMTMFDPTSSSNTTLIEHILYW 127

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             ++  +++D HH +  AL++S+  I +G      N  +  + +    F I ++++ P +
Sbjct: 128 FSMVVFFIVDGHHMLIKALIESFKVIKLGNFFLNQNSINLIIRVFIEYFEIAVKIAIPIV 187

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              ++ +I++GL+++ VPQ+ +  +  P   L+GLG+   C ++ I +    +SF YG
Sbjct: 188 LIILITDITMGLVSRTVPQLNVMILGMPVKILVGLGA--FCFALPIFLKMIENSF-YG 242


>gi|303240270|ref|ZP_07326789.1| flagellar biosynthetic protein FliR [Acetivibrio cellulolyticus
           CD2]
 gi|302592180|gb|EFL61909.1| flagellar biosynthetic protein FliR [Acetivibrio cellulolyticus
           CD2]
          Length = 261

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 109/220 (49%), Gaps = 6/220 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV-NRAY-YSK 71
           LI  R+    ++ P  S + IP  +++ F+   +++L+    +TI  QN V N  Y ++ 
Sbjct: 17  LIFIRMAGLFVIAPIFSRANIPTYLKIGFSFMLALILV----NTISNQNIVINNIYEFAA 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E  +G   G +       +   G +I   IG  +   +    ++  +  ++   I+
Sbjct: 73  LVIREFVVGITLGYVSYTIFNAIYIAGELIDMQIGFGVVNVIDPISNIQVSITSTFYFIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L   + + HH +  AL  SY  +P+GQ +    + S  + +    F+I  ++++P L 
Sbjct: 133 CMLVFILCNGHHILIRALFSSYEYVPLGQAVFGSGLQSRILEIFGGIFLIAFKIAAPMLT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLS 231
             ++ ++++G+++K VPQ+ ++ +  P  I LG   + L+
Sbjct: 193 AILITDVALGVISKTVPQLNVFVVGMPLKIILGLAVMVLT 232


>gi|291288732|ref|YP_003505548.1| flagellar biosynthetic protein FliR [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885892|gb|ADD69592.1| flagellar biosynthetic protein FliR [Denitrovibrio acetiphilus DSM
           12809]
          Length = 257

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 104/212 (49%), Gaps = 8/212 (3%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +S  + V R+G+ +  +P    + I  Q+R   A+  ++V+ P    +++   + N    
Sbjct: 12  VSFLMAVARIGAILFTVPVFGSNVIKPQIRFVLAILIAMVIFP----SLEAMPYGNLPTG 67

Query: 70  SKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             +VMV  E+ +G   G+L     +G Q  G ++   +G ++   M    +   + ++S 
Sbjct: 68  IIIVMVFKEILVGVCIGILSNFLFIGAQLGGQIVGLQMGFSVVNVMDPQSNTQLSIISSF 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLS 186
           + I  LL    +  H+ V  A+ +S+ +IPIG  E+N    F+    +    F+I +++ 
Sbjct: 128 LNIGMLLFFIAVGGHYLVLGAIAESFRSIPIGGAEIN-PIAFNYIAKLFSYIFLIAIKIM 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +P +   ++F+  IG++ KL PQI +  +  P
Sbjct: 187 APAIITLLIFSTVIGVIGKLAPQINLMIVGFP 218


>gi|119385354|ref|YP_916410.1| flagellar biosynthetic protein FliR [Paracoccus denitrificans
           PD1222]
 gi|119375121|gb|ABL70714.1| flagellar biosynthetic protein FliR [Paracoccus denitrificans
           PD1222]
          Length = 252

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 97/200 (48%), Gaps = 7/200 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV- 75
           CRV +C ++LP  S   +P++VR    MA +    P L +       ++   +   +   
Sbjct: 22  CRVQACFLMLPVFSERAMPVRVRAALVMAVT----PLLAEHAQSVGGIDGLLHLAALAGA 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G V G L+R++ + L       + A   +L   +G ++  +  P+ +L+ + GL  
Sbjct: 78  EILSGLVLGGLVRLFAVALNIA--ATAIAATASLSQLIGAANEYSPHPIGNLMHLAGLAV 135

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
           L  + F       L +S    P+G          S V++++ +F++ + L++PF+    +
Sbjct: 136 LMALGFPVLACDLLRESLVLRPLGDWPQVSEALPSAVSLVRQSFVLAMLLAAPFILGGFL 195

Query: 196 FNISIGLLNKLVPQIPIYFI 215
           F +  G+++K++P +P+ FI
Sbjct: 196 FQVLSGMISKVMPTLPVIFI 215


>gi|313672723|ref|YP_004050834.1| flagellar biosynthetic protein flir [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939479|gb|ADR18671.1| flagellar biosynthetic protein FliR [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 259

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 108/233 (46%), Gaps = 3/233 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL V R+   +   P      I  +++L  ++   I++ PF+   IDL    N      +
Sbjct: 15  FLTVVRISGILFTAPVFGSEIISARIKLFLSILIGILIFPFI-TAIDLSK-ANNLLMILI 72

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ EL +G   GL+ R   +G+QF G VI T +G  +   +   ++   + +     II 
Sbjct: 73  IIKELLIGIATGLIGRFLFVGVQFGGQVIGTQMGFGIVNVLDPQNNAQISLVAQFQNIIM 132

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L   VI  H  +  A+VKS+  IP+G  +     +   V +    F+  L++++P    
Sbjct: 133 ILFFLVIGGHLYIIQAIVKSFEMIPLGVFVFNKESYIFIVTIFSKIFLTALKITAPIFVT 192

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +V  + +G++ +LVPQ+ I  I  P  I  G L + ++     Y    S +Y
Sbjct: 193 LLVTQVVLGIMGRLVPQLNILIIGFPIQIA-GGLIVIITSLTFFYSMFESLMY 244


>gi|327441038|dbj|BAK17403.1| flagellar biosynthesis pathway, component FliR [Solibacillus
           silvestris StLB046]
          Length = 258

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 111/224 (49%), Gaps = 9/224 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            RV +  + +P  S   IP QVR+  A+A + ++    + T +++ F   A+Y  LV+ E
Sbjct: 16  VRVSAFFVSVPLFSYRTIPPQVRIILAVALAWMM----YYTFNIEPFEINAFYLLLVLKE 71

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLLA 135
             +G + GL   +    +Q  G  I   +G  +   +    + A++PL    +  + LL 
Sbjct: 72  AIIGLMLGLAAMIIVSAVQIAGGFIDFQMGFAMANIID-PQTGAQSPLMGQFLNFLMLLL 130

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNIFSSF--VNMLQTTFMIMLRLSSPFLFF 192
           L  I+ HH +   +  SY  +P+ Q   NFG   ++   + +  + F I  ++S+P +  
Sbjct: 131 LLSINGHHLILDGIYYSYQFMPMDQFFPNFGEEGTALFIIKIFVSVFAIAFQMSAPIVAT 190

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
             +  +++G+  K VPQ+ I+ I  P  I +G L L +++ ++V
Sbjct: 191 LFLVTLALGITGKTVPQMNIFVIGFPIKIAVGFLVLIVTMGVLV 234


>gi|293605016|ref|ZP_06687411.1| flagellar biosynthetic protein FliR [Achromobacter piechaudii ATCC
           43553]
 gi|292816585|gb|EFF75671.1| flagellar biosynthetic protein FliR [Achromobacter piechaudii ATCC
           43553]
          Length = 262

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 106/234 (45%), Gaps = 11/234 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VM 74
            R+ + +   P  S S IP++V++  +   ++ + P L    D    +    Y+ L  VM
Sbjct: 21  VRILALVGTAPLFSESAIPVKVKVGLSFVLAVAVSPAL----DPMPPIAPGSYAGLWMVM 76

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+ L  ++ +L
Sbjct: 77  QQVLIGIAMGFTMRIVFAAVQTAGEFVGLQMGLSFASFFDPSSGANTAVLSRLFNMVAML 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               +D H  V  ALV+S+ T+P+       N +   V   +T F+  L L+ P +   +
Sbjct: 137 TFLALDGHLLVLAALVRSFDTLPVAAIQLHQNGWGVVVEWGKTVFVSGLLLALPLICALL 196

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
             N+++G+LN+   Q+ ++ +  P      +L + +++  +V   +  FL   F
Sbjct: 197 TINLAMGILNRAAQQLSVFSVGFPV-----TLIIGVTVLTVVLPHAGPFLETLF 245


>gi|303326360|ref|ZP_07356803.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. 3_1_syn3]
 gi|302864276|gb|EFL87207.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. 3_1_syn3]
          Length = 263

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 109/238 (45%), Gaps = 13/238 (5%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +SL L + RV   + +LP  S + IP+ V+    + FS+ +    W  + L   +  A+ 
Sbjct: 12  LSLLLTMMRVSIVMFMLPVFSTNNIPIPVKAAVTIVFSLGV----WPHLALSGAIMPAHP 67

Query: 70  SKLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +V++   E+ LG V G+ +    +G+Q  G ++   +G    T +  +D L      +
Sbjct: 68  FDMVLMLLGEVVLGLVLGMAVNFLFMGIQAGGELLGFQMGF---TMINFADPLTGNQTGA 124

Query: 127 ---LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
               + ++ LLA   +D H  +      S+  +P G      N+    +++    F++ L
Sbjct: 125 TAFFLWMVSLLAFLALDGHLYMIKGFAASFALVPPGGLFIGENLLWQVLDLAAQVFVLAL 184

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           ++++P +    +  +++ L+ +  PQI I     P  IG+G  F+ L + ++     H
Sbjct: 185 KIAAPVMVALFMVEVALALVARTSPQIHIMEFGFPIKIGVGFFFVGLLLVVMADHVEH 242


>gi|253702492|ref|YP_003023681.1| flagellar biosynthetic protein FliR [Geobacter sp. M21]
 gi|251777342|gb|ACT19923.1| flagellar biosynthetic protein FliR [Geobacter sp. M21]
          Length = 261

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 104/235 (44%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++ L L++ RV      +P      +P +V++    A ++++ P +     + N  +   
Sbjct: 13  LIPLALVLARVAGLFSAIPMFGARLVPARVKMGLIFAMTLLIFPVIKPH-AVPNVSDSLG 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV+ E  +G   G + +     ++F G ++ T +G+++      +       +    
Sbjct: 72  LMLLVLQEALVGLTLGAVSQFIFAAVEFCGQLVGTQMGISMAAQFDPATQNNVPTMAIFQ 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           G +  L     + H      +V SY  IP+G     G +   F+      F+I ++L++P
Sbjct: 132 GALATLLFLAFNVHEHFIRGIVDSYRVIPLGAWHVSGGLMKFFIETSTGIFIIGIKLAAP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
                +  ++++G++ +  P + ++ +S P  IG+G + L +S+ + V     SF
Sbjct: 192 VSVALLATSVALGIVARSFPAMNVFMVSMPLSIGIGFVILGISLPVFVRVLQGSF 246


>gi|221635442|ref|YP_002523318.1| flagellar biosynthetic protein FliR [Thermomicrobium roseum DSM
           5159]
 gi|221157870|gb|ACM06988.1| flagellar biosynthetic protein FliR [Thermomicrobium roseum DSM
           5159]
          Length = 260

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 98/208 (47%), Gaps = 2/208 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+V RVG  + LLPG     +P+  R+  A+  ++ L+PF+    D     +   ++  +
Sbjct: 17  LVVTRVGLVLSLLPGFGSQAVPLPARVALAVVLALALVPFV--PTDASGLSDPTVFAVAL 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             EL  G   GL +      ++   S+I   +G  L  +   +  +  T LN+L   +  
Sbjct: 75  ARELVTGLALGLAVAAVFAAVEMAASLIGYQLGFGLAATFNPAFGMQGTALNTLYLALAA 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L L+  + HHQ+  AL +S   +P G      +   + + +    F   LR+  P     
Sbjct: 135 LVLFGTNGHHQLVGALARSLILLPPGAAAPDVDTPRAVIALTGAMFSDALRIGLPIAGSL 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLI 221
           +V +I +GLLN++VPQ+ ++F+  P  I
Sbjct: 195 LVADIGLGLLNRMVPQMSVFFVGLPAKI 222


>gi|251772430|gb|EES52997.1| Flagellar biosynthesis protein FliR [Leptospirillum
           ferrodiazotrophum]
          Length = 269

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 106/239 (44%), Gaps = 30/239 (12%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF 63
            PE+ +    LI+ R    ++ +P  +   +P +V+   A+A S +L P +   +   NF
Sbjct: 15  DPELFV----LILARTSGVLIAMPAFNSRAVPTKVKALVAVALSALLFPVVGGRV---NF 67

Query: 64  VNRAYYSKL--VMVELFLGCVHG----LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD 117
               Y + L  ++ E  +G   G    L+     L  Q  G          +Q   GI D
Sbjct: 68  HETGYDALLFSILTEFVVGVSMGFAAYLVFAAVALAGQLAG----------VQAGFGIVD 117

Query: 118 -----SLAETPL-NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSF 171
                 +AE PL  +    I  L     +  + + +AL +SY  + +G     G+ F+  
Sbjct: 118 VINPLGVAEVPLLGNFQTQIAFLIFLATNAQYAMLWALARSYDVVGVGGASFSGSYFAGI 177

Query: 172 VNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            ++      + L L+SPF+   ++ N+ +G L+K++PQ+ +  +  P ++ LG L L +
Sbjct: 178 AHLFGRMMSLGLVLASPFIVGGVILNLVLGFLSKMMPQMNLISLGLPVMV-LGGLVLTI 235


>gi|206561838|ref|YP_002232603.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           J2315]
 gi|198037880|emb|CAR53824.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           J2315]
          Length = 260

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 108/230 (46%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F     +  +++ +
Sbjct: 21  VRMLALVATAPVVGHAAVPVRVKIGLAAFMALVVAPTLGAMPDVTVFSAPGIW--ILVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGVAMGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHTSGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H Q+F AL  S+ ++P+  +L     + +        F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQMFAALAASFQSLPVSGDLLHAPGWRTLATFGAVVFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI ++ +  P  + +G L + L +  +V   SH F  G
Sbjct: 199 NLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMVPNLVPFVSHLFDMG 248


>gi|302037620|ref|YP_003797942.1| flagellar biosynthetic protein FliR [Candidatus Nitrospira
           defluvii]
 gi|300605684|emb|CBK42017.1| Flagellar biosynthetic protein FliR, export component [Candidatus
           Nitrospira defluvii]
          Length = 263

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 106/236 (44%), Gaps = 15/236 (6%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           +++ R+   + + P L+   IPM V+        +VL P     I L N  N      LV
Sbjct: 20  ILLVRIAGIVSVFPILNTRTIPMPVKTGLVATLGLVLAPI----IHLPNLPNDPV---LV 72

Query: 74  MV----ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           +     E  +G   GL +R+   G Q  G +I T +G +    M    S   TP+ +   
Sbjct: 73  IAGIGSEFLIGLTIGLAVRLLFSGFQVAGDMIGTQMGFS-AIQMFDPMSHQNTPIIAQFQ 131

Query: 130 I-IGLLALWVIDFHHQVFYALVKSYGTIP-IGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +G L    ++ H  V +A+  SY  +P  G  L+ G I    +++ Q    + L+L++
Sbjct: 132 LTLGSLVFLSLNAHLLVVHAIGMSYEYVPPFGASLSDG-IAQDIIHLAQNMLGVALKLAA 190

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P     ++ N  + +L + VPQ+ ++  S P  IG G L + L++   +  F   F
Sbjct: 191 PVFATLLIVNTVLAILGRAVPQMNVFVTSFPITIGAGFLAMSLAMPFTLLLFEKEF 246


>gi|23099028|ref|NP_692494.1| flagellar biosynthesis protein FliR [Oceanobacillus iheyensis
           HTE831]
 gi|22777256|dbj|BAC13529.1| flagellar protein required for flagellar formation [Oceanobacillus
           iheyensis HTE831]
          Length = 259

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 102/211 (48%), Gaps = 8/211 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  LI  RV +  +++P  S   +P+Q ++  +   +I+++     T+D         Y 
Sbjct: 12  AFLLIFVRVLAFFVIMPLFSYRSVPVQFKIGISFFLAIIMI----STVDTAGIAVNNLYI 67

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN-SLIG 129
            L++ E+ +G   GL+  +    +Q  G  I   +G  +   +    + A++PL    + 
Sbjct: 68  FLIVKEILVGICIGLIAYIIVSAIQVAGGFIDFQMGFAIANVVD-PQTGAQSPLTGQYLY 126

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFG--NIFSSFVNMLQTTFMIMLRLSS 187
           II LL L  ++ HH +   +  SY  IP+ Q L FG  +I    +    T F++  +++ 
Sbjct: 127 IISLLFLLSVNGHHIIIDGIFNSYSYIPLNQFLPFGEESIVQFVLTTFNTMFLVAFQIAI 186

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           P +    + ++++G++ + VPQ+ ++ +  P
Sbjct: 187 PIVGCLFLVDVALGIIARTVPQMNVFVVGLP 217


>gi|330876031|gb|EGH10180.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964681|gb|EGH64941.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 258

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 113/232 (48%), Gaps = 7/232 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q        S
Sbjct: 15  SFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQAL----DLS 70

Query: 71  KLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            L+++  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +    
Sbjct: 71  GLLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIGQFF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P
Sbjct: 131 TMLVTLLFLSMNGHLVVLEILVESFTTMPVGGGLLVNN-FWELANGLGWALSSGLRLVLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+ 
Sbjct: 190 AVTALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQ 241


>gi|126653731|ref|ZP_01725649.1| flagellar biosynthesis protein R [Bacillus sp. B14905]
 gi|126589695|gb|EAZ83831.1| flagellar biosynthesis protein R [Bacillus sp. B14905]
          Length = 257

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 111/230 (48%), Gaps = 10/230 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV +  + +P  S   IP QV++  A+    VL   ++ TID++ F     Y  LV
Sbjct: 13  LVLVRVSAFFVTVPFFSYRTIPPQVKITLAL----VLAWMMYYTIDVEPFAFNDEYILLV 68

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIG 132
           M E  +G + GL+  +    +Q  GS I   +G  +   +    + A++PL      ++ 
Sbjct: 69  MKEALVGLLLGLVGYIIMSAIQIAGSFIDFQMGFAIANIID-PQTGAQSPLIGQFFNMLA 127

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNI-FSSF-VNMLQTTFMIMLRLSSPFL 190
            L L  I+ HH +   +  SY  +P+ Q  +F N  F  F +      F I  ++++P +
Sbjct: 128 FLLLLAINGHHMILDGIYYSYQFLPMDQFPSFTNEGFPQFIITTFTAVFAIAFQMAAPVV 187

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
               + ++++G+  K VPQ+ I+ +  P  I +    LF  +++ I V Q
Sbjct: 188 ATLFLVDLALGITAKTVPQLNIFVVGFPIKIAVSFLVLFTMMAVMIQVIQ 237


>gi|317129191|ref|YP_004095473.1| flagellar biosynthetic protein FliR [Bacillus cellulosilyticus DSM
           2522]
 gi|315474139|gb|ADU30742.1| flagellar biosynthetic protein FliR [Bacillus cellulosilyticus DSM
           2522]
          Length = 259

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 111/224 (49%), Gaps = 9/224 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ RV + ++ LP  S   IP  +++  A+  S ++  F  D   L+  +N  +Y 
Sbjct: 10  AFMLVLVRVSAFLITLPFFSYQNIPAPLKIGLALFISWIMF-FAGDWPALE--INYHFY- 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN-SLIG 129
            L++ E  +G   GL+  +    +Q  G +I   +GL +   +    + A++PL  S + 
Sbjct: 66  LLIIKEALVGLTVGLIAMILLYAIQVAGGIIDYKMGLMIANVID-PQTGAQSPLTGSYLY 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGN--IFSSFVNMLQTTFMIMLRLS 186
              +L L   D HH +   +  SY  IP+ Q  + FGN  I    V    T F+I  +++
Sbjct: 125 TFSILFLLATDAHHLLLDGVFYSYQFIPMDQLFIPFGNEAILDHVVVTFSTMFLIAFQMA 184

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            P +    + ++++G++++ VPQI ++ +  P  + +G + L L
Sbjct: 185 MPIVGSIFLVDLALGMVSRAVPQINVFVVGMPLKVLVGFILLLL 228


>gi|188997533|ref|YP_001931784.1| flagellar biosynthetic protein FliR [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932600|gb|ACD67230.1| flagellar biosynthetic protein FliR [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 257

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 112/225 (49%), Gaps = 6/225 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI  R+ +  M  P +S   IP  V++   ++F+   +      ++++ + +   +  L+
Sbjct: 14  LIFSRIIAFFMAFPLISSPIIPHNVKVLLVVSFAYFTMLNFNIKLEIKEY-DLLVFLTLI 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+F+G   G+++ ++     +   +IS  +GL +      + +  +T + S   +   
Sbjct: 73  LKEVFIGFSLGIIVNIFIGAFSYAAEIISYLMGLTVLNMF--NPAFGQTSVLSGYFLFLF 130

Query: 134 LALWVIDFHHQVFY-ALVKSYGTIPIGQELNFGN-IFSSFVNMLQTTFMIMLRLSSPFLF 191
             L+ I   +Q+F  AL KS+  IP+    N  N +F   +      F++  +++ PF+ 
Sbjct: 131 YFLFFISGAYQIFIGALFKSFEVIPL-SSFNINNGVFEFIIKKSSDIFLLSFQMAFPFIL 189

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
             +VFNI + L+N+L+PQI ++ +  P  I +G + L  +  +I+
Sbjct: 190 VLLVFNIVLALINRLIPQINVFMVGLPAQIFIGFVILIFASSLII 234


>gi|313896132|ref|ZP_07829686.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320529416|ref|ZP_08030504.1| flagellar biosynthetic protein FliR [Selenomonas artemidis F0399]
 gi|312975557|gb|EFR41018.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320138382|gb|EFW30276.1| flagellar biosynthetic protein FliR [Selenomonas artemidis F0399]
          Length = 260

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 100/209 (47%), Gaps = 2/209 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ R+    ++ P      IPM  R+  A+A S+VL P +      +   +   + 
Sbjct: 13  AFLLMLTRISGIFLISPFFGSMNIPMFFRVGIALAMSVVLFPVVDGLGTPETPPSIIMFG 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             V+ ELF+G + G +  +    +   G V+   +G  +   +  +       + S +  
Sbjct: 73  AAVLGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAVVNVVDPTSGQQIPLIGSFLYN 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + ++ L V + HH +  ALV+S+  +P+ G E N  ++     N   T F+  ++++ P 
Sbjct: 133 LAVIILLVTNGHHMLIAALVESFRAVPLAGLEANI-SLALIIANFTGTIFLTGMKIAMPI 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++ N+ +G+L++ +PQ+ I+ +  P
Sbjct: 192 TFAILLTNVGLGILSRTMPQMNIFVVGIP 220


>gi|310820309|ref|YP_003952667.1| type III secretion system inner membrane r protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|309393381|gb|ADO70840.1| Type III secretion system inner membrane R protein [Stigmatella
           aurantiaca DW4/3-1]
          Length = 273

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 111/240 (46%), Gaps = 13/240 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++CR+   ++  P L    +P +VR+   +  S+VL P + D +      +   Y  L+
Sbjct: 26  LLMCRIMPVLIFSPFLGGEVVPPEVRMGVGVTLSLVLFPSVADRMGALP-TSALPYIALL 84

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT----SMGISDSLAETPLNSLIG 129
           + E+F+G     ++ +     +  G+++ T  G N        +G   SL     +SL  
Sbjct: 85  LKEVFIGVSLAFIVNIIFDAARVAGTLVDTMAGSNNAQLYVPQLGQQVSL----FSSLKV 140

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF----MIMLRL 185
            + ++    +D HH V  AL  S+  +P+     F     +F  ++   F     I L L
Sbjct: 141 QLSVVLFLTLDGHHIVISALADSFAIVPLDSFPKFSKGTWAFFEVISRAFANLLAISLSL 200

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           ++P +    + ++++G +N++ P + ++FI+      +  L   L++ +++ +F   F++
Sbjct: 201 AAPQMLSAFLTDLAMGAVNRVAPNLQVFFIAMAIKPMVSVLIAALALHMLIGRFQSEFVH 260


>gi|302387777|ref|YP_003823599.1| flagellar biosynthetic protein FliR [Clostridium saccharolyticum
           WM1]
 gi|302198405|gb|ADL05976.1| flagellar biosynthetic protein FliR [Clostridium saccharolyticum
           WM1]
          Length = 253

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 110/228 (48%), Gaps = 9/228 (3%)

Query: 5   PEIIMMSLF-LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF 63
           P+I  M LF LI  R+   I+L P L     P  V+    M F+  LL + +    +   
Sbjct: 2   PDIGQMMLFSLIFMRMSGFILLNPILGRRNTPNVVKGGMIMVFT--LLVYSFSAAQVPEP 59

Query: 64  VNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
           VN   ++ L++ E  +G   G ++ ++ + + F G +I   +GL++ T   I D  + T 
Sbjct: 60  VNSIEFAVLMIKEFIMGYTIGFVMDLFLMVITFAGHIIDFQMGLSMAT---IYDPQSNTQ 116

Query: 124 L---NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +    SL     +L  + +D H  +   L+KS  T+P GQ +    +  + + +     +
Sbjct: 117 IAITGSLWNAYFMLLFFAVDGHLALIKLLIKSAETVPYGQVVIGTKVAWAMIEVFIQCII 176

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
           + ++ S P +    +  I++G+L K++PQI ++ ++    + +G L L
Sbjct: 177 MAIKFSLPIVAIEFITEIAVGILMKMIPQINVFVVNIQAKLVIGLLML 224


>gi|70729045|ref|YP_258779.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens Pf-5]
 gi|68343344|gb|AAY90950.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens Pf-5]
          Length = 255

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 110/235 (46%), Gaps = 13/235 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVN 65
           S  L + RV S +M++P    + +P +VRL FA+A ++V+ P L        +DL   + 
Sbjct: 12  SFMLPLFRVTSLLMVMPVFGTTLVPRRVRLYFALAITVVIAPGLPPMPEVHALDLSGLL- 70

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV  ++ +G V G  ++++       G +++  +G+   + +  ++ ++   + 
Sbjct: 71  ------LVAEQILIGAVLGFSLQLFFQAFVVAGQIVAIQMGMGFASMVDPTNGVSVAVIG 124

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  VF  L +S+ T+P+G  L   N +      L       L L
Sbjct: 125 QFFTMLVTLLFLAMNGHLVVFEVLTESFTTLPVGGGLMV-NHYWELAGKLGWVLGAALLL 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG   + +S+  I+ Q+ 
Sbjct: 184 VLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIVWISLADILNQYQ 238


>gi|121533744|ref|ZP_01665571.1| flagellar biosynthetic protein FliR [Thermosinus carboxydivorans
           Nor1]
 gi|121307735|gb|EAX48650.1| flagellar biosynthetic protein FliR [Thermosinus carboxydivorans
           Nor1]
          Length = 260

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 104/223 (46%), Gaps = 8/223 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI  RV   +   P L    IP+  +  FA+  S +L P +     +        Y  LV
Sbjct: 16  LIFTRVTGILTTAPILGSRNIPVYTKAGFALILSYILTPIVVQRSHIIVPDQFGAYVFLV 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG---- 129
           + EL +G + G +  +    +Q  G ++   IG  +   + I D  +   L  LIG    
Sbjct: 76  IGELLIGLILGYISSMIFYAVQMAGQLLDMQIGFGI---VNIIDPQSGQQL-PLIGNFKY 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           I  LL  +  + HH +  AL  S+ T+P+G  +    +    +++  +  +I L++S P 
Sbjct: 132 IFSLLVFFATNGHHILLSALFTSFKTVPVGAAVFRPQLADLVIDITFSVLIIALKISLPI 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           L    + +I++G+L +++PQ+ I+ +  P  I +G   L L++
Sbjct: 192 LVAIFLTDIAMGILARIMPQMNIFIVGIPGKIIVGIFMLALTL 234


>gi|310816837|ref|YP_003964801.1| flagellar biosynthetic protein FliR [Ketogulonicigenium vulgare
           Y25]
 gi|308755572|gb|ADO43501.1| flagellar biosynthetic protein FliR [Ketogulonicigenium vulgare
           Y25]
          Length = 259

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 103/219 (47%), Gaps = 2/219 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E +  + FL+  R G+   LLP      +P+++RL  A+A +++ L      +     V 
Sbjct: 12  EPVGFAAFLVFLRAGAFCALLPAFGEQTLPLRLRLSVAIAMTMITL-PAVLPLMPPPPVQ 70

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    L++ E+  G + GL +R+    L+  G++ + ++G+      G++     +  +
Sbjct: 71  ISQMGALLLTEIGAGLIFGLSLRLLVWALETAGAIAAQSVGVAQIFGPGMTAE-PSSAFS 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            +  + G      +    Q    ++ SY  I  G       +  + +     +F + +RL
Sbjct: 130 QIFIMAGFALACAMGLPVQAVAMMIGSYNVISPGIFPAPDMLAQAILPGFSESFSLAVRL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++PF    +++N+++G +N+ +PQ+ + F+  P L G+G
Sbjct: 190 AAPFFIAGLLYNLTLGFVNRAMPQMMVTFVGAPALTGIG 228


>gi|28869178|ref|NP_791797.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967545|ref|ZP_03395693.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato T1]
 gi|301382882|ref|ZP_07231300.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061092|ref|ZP_07252633.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tomato K40]
 gi|302131292|ref|ZP_07257282.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852418|gb|AAO55492.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927846|gb|EEB61393.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato T1]
          Length = 258

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 112/232 (48%), Gaps = 7/232 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q        S
Sbjct: 15  SFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQAL----DLS 70

Query: 71  KLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            L+++  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +    
Sbjct: 71  GLLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIGQFF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H      LV+S+ T+P+G  L   N F    N L       LRL  P
Sbjct: 131 TMLVTLLFLSMNGHLVALEILVESFTTMPVGGGLLVNN-FWELANGLGWALSAGLRLVLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+ 
Sbjct: 190 AVTALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQ 241


>gi|85859182|ref|YP_461384.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
 gi|85722273|gb|ABC77216.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
          Length = 259

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 113/236 (47%), Gaps = 3/236 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSY-IPMQVRLCFAMAFSIVLLPFLWDTIDL 60
            I+PE I   +F I  RV S I+++P       IP+ ++   ++  + +L PF+      
Sbjct: 5   VITPEQIACLIF-IFLRVSSMIVVMPIFGGDKTIPVGIKGGLSLLITFLLFPFVRMDFGF 63

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q  +       +++ E+ +G + G + R    G+QF G +I   +G ++   +    S  
Sbjct: 64  Q-LMELTPMVVIMIGEILIGVIIGFVARFIFAGIQFAGELIGFQMGFSVVNIIDPVTSTQ 122

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
            + ++ L   + +L    ++ HH    A+ +S+  I   Q      + +    +    F+
Sbjct: 123 VSLISQLKYFLAMLVFLAVNAHHIFLSAMAESFVRISPMQFHLTERVIAPLCLLSMEVFI 182

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
           I +++S+P +   I  ++++G++ + VPQI I+ +  P  I LG +FL LS  I V
Sbjct: 183 IAVKISAPVVAVLIFTHVALGVVARTVPQINIFIVGFPLQIALGLIFLGLSAPIFV 238


>gi|206603140|gb|EDZ39620.1| flagellar biosynthesis protein, FliR [Leptospirillum sp. Group II
           '5-way CG']
          Length = 262

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 97/206 (47%), Gaps = 6/206 (2%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           ++ RV   ++ +P LS   +P++++   A+A + ++ P +   +      + A+   LV 
Sbjct: 17  VLARVSGLVVSMPVLSGKAVPVRIKALIAVALAFLIEPVVLGNVSPPRLFS-AWLGSLV- 74

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGL 133
            E F+G   G    +    + F G +    +G  L   +     LAE PL  +    +  
Sbjct: 75  TEFFVGVALGFSSYLVFAAVSFAGELAGVQVGFGLVDVIN-PLGLAEVPLLGTFQNSVAF 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIF-SSFVNMLQTTFMIMLRLSSPFLFF 192
           L       H  + +AL +SY  +P G E  F  IF   ++ +     ++ + L++PFL  
Sbjct: 134 LVFLASGTHEALIWALGRSYAVVPPG-EGRFRTIFYEGYLGVFAHFMVLGITLAAPFLVG 192

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP 218
            IV N+++G L++++PQ+ +  +  P
Sbjct: 193 GIVLNLAMGFLSRMMPQMNLISVGFP 218


>gi|147678409|ref|YP_001212624.1| flagellar biosynthesis protein FliR [Pelotomaculum
           thermopropionicum SI]
 gi|146274506|dbj|BAF60255.1| flagellar biosynthesis pathway, component FliR [Pelotomaculum
           thermopropionicum SI]
          Length = 254

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 102/229 (44%), Gaps = 6/229 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV--NR 66
           + + FL+  R  + +   P  ++  +P  ++  F +A + V+ P L    DL   +  + 
Sbjct: 7   LAAFFLVFLRTAAFMTAGPLYALRGVPPLLKAAFCLALAAVIFPVL----DLNEPLPLDA 62

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             Y      E  LG + G  + +     +  G +I   IG ++            T L+ 
Sbjct: 63  WGYGLAAARETGLGLLLGTAVTMILNSFRMAGQIIDFQIGYSMAALADPQYGTQNTLLSQ 122

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ L+   V+D H+ +   LV+SY  +P+   +  G   S  + M   +F I L++S
Sbjct: 123 YLYLLALVFFLVVDGHYSLIAGLVESYRLVPLNAAVFNGAAASVLLRMFSGSFAIALQVS 182

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           +P L   ++ ++++G L +  PQ+ ++    P  I  G L L   I ++
Sbjct: 183 APVLAVLVICDLTLGFLARTAPQLNVFLTGFPVKIAAGLLTLSFLIPLL 231


>gi|237799250|ref|ZP_04587711.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022105|gb|EGI02162.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 258

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 108/223 (48%), Gaps = 3/223 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ + +  +P +  + +P +VR+  A A ++V+ P L D   +Q     A    L+  ++
Sbjct: 22  RIIALLTTMPVIGTTLVPRRVRMYLAFAITVVVAPALPDMPPVQALDLSALL--LIGEQI 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   GL ++++       G +IST +G+   + +  ++ ++   +     ++  L   
Sbjct: 80  IIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTLLVTLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  V   LV+S+ ++P+G  L   N F    N L       LRL  P +   ++ N
Sbjct: 140 SMNGHLVVLEILVESFTSMPVGSGLLVNN-FWELANGLGWVLGSGLRLVLPAITALLIIN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I+ G++ +  PQ+ I+ I  P  + +G + L +++  I+ Q+ 
Sbjct: 199 IAFGVMTRAAPQLNIFSIGFPLTLVMGMVILWMTMGDILNQYQ 241


>gi|150390467|ref|YP_001320516.1| flagellar biosynthesis protein FliR [Alkaliphilus metalliredigens
           QYMF]
 gi|149950329|gb|ABR48857.1| flagellar biosynthetic protein FliR [Alkaliphilus metalliredigens
           QYMF]
          Length = 263

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 104/217 (47%), Gaps = 12/217 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+    ++ P  S + IPM  ++ F++  ++++LP +  TI  ++F    +++ +V
Sbjct: 17  LLIVRISGIFIIAPIFSRNNIPMMSKIIFSVFLALIILPLV--TIS-EDFAANTFFALMV 73

Query: 74  --MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + E  LG   G +  +Y       G ++ T IG  +   + + D    T L  +  + 
Sbjct: 74  YAIQEFALGITIGFIGSIYFSTFYLAGMIVDTQIGFGM---VNVFDPQMNTQLPIMGNVY 130

Query: 132 GLL---ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNML-QTTFMIMLRLSS 187
            LL       ++ HH +  A+  SY  +PIG +          + ++    FM+  +LS+
Sbjct: 131 NLLISLVFLAVNGHHLLIKAMFDSYDVLPIGFQFQVSEALIMHLTIIFMEIFMMAFKLSA 190

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           P L    + N+ +G+L + +PQ+ ++ +  P  I +G
Sbjct: 191 PILATIFLANVLLGILARTMPQMNVFIVGMPLKIIVG 227


>gi|289548903|ref|YP_003473891.1| flagellar biosynthetic protein FliR [Thermocrinis albus DSM 14484]
 gi|289182520|gb|ADC89764.1| flagellar biosynthetic protein FliR [Thermocrinis albus DSM 14484]
          Length = 253

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 105/218 (48%), Gaps = 5/218 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + + L+P     ++P   ++  + A S+ +  F++   D Q     A     V+ E 
Sbjct: 21  RVTAFLFLVPFFGKEFLPQTFKVFLSTALSLSI--FMYT--DPQPLSPEAPLLTYVVKEF 76

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            LG V GL++R+     Q  G +IS +IGL+  T + +      +  +  + ++  +   
Sbjct: 77  LLGFVAGLVLRLVFDAAQTAGEIISYSIGLSYAT-LFVPQLAQMSLFSLFLSLLTTVTFL 135

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            I     VF ALVKS+ TIP+G    +       V +   +F +  R++ P +   ++ N
Sbjct: 136 QIGGPEVVFLALVKSFQTIPVGSFPLWSLDPQQMVKLFHESFSLGFRVALPLVISTLLVN 195

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           + + L+N+L+PQ+ ++ +  P  + +G + L L   +I
Sbjct: 196 LGLALINRLIPQVNVFMVGLPLQLMVGYIILFLVFPLI 233


>gi|197120183|ref|YP_002140610.1| flagellar biogenesis protein FliR [Geobacter bemidjiensis Bem]
 gi|197089543|gb|ACH40814.1| flagellar biogenesis protein FliR [Geobacter bemidjiensis Bem]
          Length = 261

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/235 (19%), Positives = 104/235 (44%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++ L L++ RV      +P      +P +V++    A ++++ P +   + + N  +   
Sbjct: 13  LIPLALVLARVAGLFSAIPMFGARLVPARVKMGLIFAMTLLIFPVIKPHV-VPNVSDSLG 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV+ E  +G   G + +     ++F G ++ T +G+++      +       +    
Sbjct: 72  LMLLVLQETLIGLTLGAVSQFIFAAVEFCGQLVGTQMGISMAAQFDPATQNNVPTMAIFQ 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           G +  L     + H      +V SY  +P+G     G +    V      F+I ++L++P
Sbjct: 132 GALATLLFLAFNVHEYFIRGIVDSYRVVPLGAWHVSGGLLKFLVETSTGIFIIAIKLAAP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
                +  ++++G++ +  P + ++ +S P  IG+G + L +S+ + V     SF
Sbjct: 192 VSVALLATSVALGIVARSFPAMNVFMVSMPLNIGIGFVILGISLPVFVRVLQGSF 246


>gi|158320531|ref|YP_001513038.1| flagellar biosynthesis protein FliR [Alkaliphilus oremlandii
           OhILAs]
 gi|158140730|gb|ABW19042.1| flagellar biosynthetic protein FliR [Alkaliphilus oremlandii
           OhILAs]
          Length = 262

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 115/224 (51%), Gaps = 8/224 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI--DLQNFVNRAYYSK 71
           LI+ R+    ++ P  S + +PM +++  A+  S++LLP     +  D+ N     ++S 
Sbjct: 18  LILTRLTGLFVISPIFSRANVPMTMKIGLAVTLSLILLPLSIHNVNLDINNIRALIFFST 77

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS-LIGI 130
               E  +G + G +  +Y   +   G+VI   +G  +   M    + A+ P+ S L  I
Sbjct: 78  ---TEFLIGIIIGFISFIYFSVVYLAGTVIDIQMGFGMVNIMD-PQTNAQMPIMSGLYSI 133

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTTFMIMLRLSSPF 189
           +  L    ++ HH +  +++ SY  +PIG +++   NI +   +ML  TF + L+LS+P 
Sbjct: 134 LISLVFLTVNGHHMLIQSIIHSYEVLPIGFQISINQNIITHLTHMLLETFALSLQLSAPI 193

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
           L    + N+ +G+L + +PQ+ I+ +  P  I +G + + LS+ 
Sbjct: 194 LISIFLVNVILGILARTMPQMNIFMVGMPLKIFIGIIIVFLSLS 237


>gi|220903477|ref|YP_002478789.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867776|gb|ACL48111.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 263

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 115/243 (47%), Gaps = 14/243 (5%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +SL L + RV   + +LP  S + IP+QV+    + F++ +    W  + L      A+ 
Sbjct: 12  LSLILTMMRVSIVMFMLPVFSTNNIPIQVKAAVTLVFTLGV----WPHLALPGSSMPAHP 67

Query: 70  SKLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA--ETPL 124
             LV++   E  LG V G+ +    +G+Q  G ++   +G    T +  +D L   +T +
Sbjct: 68  FDLVLMVLGEAVLGLVLGMAVNFLFMGIQAGGELLGFQMGF---TMINFADPLTGNQTGI 124

Query: 125 NSL-IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
            +  + ++ LL    +D H  +      S+  +P G      NI    +++    F++ L
Sbjct: 125 TAFFLWMVSLLTFLSLDGHLYMIKGFAASFKIVPPGALFIGSNILWQILHLAAQMFVLAL 184

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++++P +    +  +++GL+ +  PQI I     P  IG+G  F+ L + +I+     +F
Sbjct: 185 QIAAPVMVALFMVEVALGLVARTSPQIHIMEFGFPAKIGVGFFFVGLLL-VIMADHVETF 243

Query: 244 LYG 246
           + G
Sbjct: 244 ILG 246


>gi|163789633|ref|ZP_02184071.1| flagellar biosynthetic protein fliR/B [Carnobacterium sp. AT7]
 gi|159875165|gb|EDP69231.1| flagellar biosynthetic protein fliR/B [Carnobacterium sp. AT7]
          Length = 250

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 103/219 (47%), Gaps = 15/219 (6%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFV 64
            I + ++ LI  RV S I++ PG S   +P   ++  +M  ++      +  +  ++   
Sbjct: 2   NIQLQTIILIFIRVTSFIVVSPGFSFKGLPSVAKIALSMGITLAA----YSAVPVMEQEA 57

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNL----QTSMGISDSLA 120
               ++ LV+ E+ LG   G + +++   ++  G+ +   +G ++      SMGI+ S  
Sbjct: 58  GTVLFAVLVIKEVLLGIALGFITKLFFTAVEIAGNFVDFQVGFSMGAVYDPSMGINVSY- 116

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNI-FSSFVNMLQTTF 179
                 +   + +   ++ + HH V  +LVKS+ T+PI    N G+      + +L   F
Sbjct: 117 ---YGKIYYWLSMCVFYLTNLHHVVIKSLVKSFTTVPISNS-NLGDFGVEGMMKLLGIIF 172

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            I   ++ P +   ++  + +GL+++ VPQI +  +  P
Sbjct: 173 EIAFNIAVPMMIVALLTEVILGLISRSVPQINVLILGMP 211


>gi|237755397|ref|ZP_04584024.1| flagellar biosynthetic protein FliR [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692438|gb|EEP61419.1| flagellar biosynthetic protein FliR [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 257

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 114/226 (50%), Gaps = 8/226 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI  R+ +  +  P +S   IP  V++   ++F+   +      ++++ + +   +  L+
Sbjct: 14  LIFSRIIAFFLAFPLISSPIIPHNVKVLLVVSFAYFTMLNFNIKLEIKEY-DLLIFLTLI 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGI-SDSLAETPLNSLIGIIG 132
           + E+F+G   G+++ ++     +   +IS  +GL   T + I + +  +T + S   +  
Sbjct: 73  LKEIFIGFSLGMIVNIFIGAFSYAAEIISYLMGL---TVLNIFNPAFGQTSVLSGYFLFL 129

Query: 133 LLALWVIDFHHQVFY-ALVKSYGTIPIGQELNFGN-IFSSFVNMLQTTFMIMLRLSSPFL 190
              L+ I   +Q+F  AL KS+  IP+    N  N +F   +      F++  +++ PF+
Sbjct: 130 FYLLFFISGAYQIFIGALFKSFEVIPL-SSFNINNGVFEFIIKKSSDIFLLSFQMAFPFI 188

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
              +VFNI + L+N+L+PQI ++ +  P  I +G + L  +  +I+
Sbjct: 189 LVLLVFNIVLALVNRLIPQINVFIVGLPAQIFIGFVILIFASSLII 234


>gi|212639549|ref|YP_002316069.1| flagellar biosynthesis protein FliR [Anoxybacillus flavithermus
           WK1]
 gi|212561029|gb|ACJ34084.1| Flagellar biosynthesis pathway, component FliR [Anoxybacillus
           flavithermus WK1]
          Length = 259

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 101/211 (47%), Gaps = 8/211 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  LI  RV S  + +P  S   +P   ++ FA  F I  L F   ++D +       Y 
Sbjct: 12  TFLLIFARVASFFVTMPLFSYRNVPNVHKIGFA--FFISWLMFF--SLDPKPLDIDGTYM 67

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
            L++ E+ +G + GL+  +    +Q  G  I   +G  +   +    + A++PL    + 
Sbjct: 68  MLLIKEVLVGLLIGLVAFIIMSAIQIAGGFIDFQMGFAIANVID-PQTGAQSPLMGQYLY 126

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN--IFSSFVNMLQTTFMIMLRLSS 187
            I L  L  ++ HH +   +  SY  IP+   ++FGN  I    V + Q  F+I L+++ 
Sbjct: 127 TIALFFLLAVNGHHMLLDGIFYSYQFIPLDHLVSFGNEQIAEQVVRLFQAMFVIALQMAI 186

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           P +    + ++++G++ + VPQ+ I+ I  P
Sbjct: 187 PIVGCLFLVDVALGIVARTVPQMNIFVIGLP 217


>gi|312962261|ref|ZP_07776753.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens WH6]
 gi|311283598|gb|EFQ62187.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens WH6]
          Length = 261

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 106/225 (47%), Gaps = 7/225 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           RV + +M +P    + +P ++RL FA+A ++V++P L         VN    S L+++  
Sbjct: 25  RVTAMLMAMPVFGTTLVPRRIRLYFAVAITVVIVPGL----PPMPAVNALDLSALMLIAE 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G + G  + ++       G +IS  +G+   + +  ++ ++   +   + ++  L 
Sbjct: 81  QVLIGAMLGFSLSLFFQAFVIAGQIISIQMGMGFASMVDPTNGVSAAVIGQFLTMLVTLL 140

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H   F  L +S+ T+P+G  L   N F   V  L       L L  P +   +V
Sbjct: 141 FLAMNGHLVAFEVLTESFTTLPVGSGLVV-NHFWEVVGRLGWVLGASLLLVLPAITALLV 199

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            NI+ G++ +  PQ+ I+ I  P  + LG     + +  I+ Q+ 
Sbjct: 200 VNIAFGVMTRAAPQLNIFSIGFPLTLVLGMWIFWVGMADILNQYQ 244


>gi|91785624|ref|YP_560830.1| flagellar biosynthesis protein FliR [Burkholderia xenovorans LB400]
 gi|91689578|gb|ABE32778.1| Flagellar biosynthesis protein FliR [Burkholderia xenovorans LB400]
          Length = 260

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 100/214 (46%), Gaps = 2/214 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L    +P++V++  A   +I++ P L        F     +  +++ +
Sbjct: 21  VRILALVATAPVLGNRSLPIRVKIGLAAFVTIIVAPTLGALPQFTVFSAEGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  +   +GL   T      S +   L+S +  I +L  
Sbjct: 79  FLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDSQASSSSQVLSSYMNTIAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            VID H Q+  AL+ ++ ++P+   +     + +  N   T F   L LS P +   ++ 
Sbjct: 139 LVIDGHLQMISALLATFQSVPVSANILGAPGWRTLANFGGTVFSAGLLLSLPVVVALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           N+++G+LN+  PQI ++ I  P  I +G L L L
Sbjct: 199 NLALGILNRAAPQIGVFQIGFPLTILIGMLLLQL 232


>gi|323705429|ref|ZP_08117004.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535331|gb|EGB25107.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 260

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 108/222 (48%), Gaps = 7/222 (3%)

Query: 13  FLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           FLIV  R+    +L P      +P   ++  A   SI++   +   ID  N      Y +
Sbjct: 14  FLIVFVRMLGIFILTPLFGTKTLPSTFKIGLAFFTSIMIFELVNVKIDANNLYQ---YVE 70

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V  E  +G + GL   +    +   G +I   +G ++   +   +      + + + I+
Sbjct: 71  IVFNEFLIGLLIGLSSMISFSAIYLAGQIIDYQLGFSIVNVLAAGEETQVPLIGNFVYIL 130

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            LL   +ID HH++F  L +SY  IP+G   L+  +I +    ++   F++  R+S+P +
Sbjct: 131 TLLLFLLIDGHHKLFQLLFQSYSMIPVGTPFLHLESINTVITKIVSDMFVLGFRISAPIV 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
              ++ +I++ ++++ +PQ+ ++ I  P    +G+ +LF+ L
Sbjct: 191 VSTLLTDITLSIISRTIPQLNVFMIGMPIKIFVGIFTLFIML 232


>gi|299534769|ref|ZP_07048099.1| flagellar biosynthesis protein FliR [Lysinibacillus fusiformis ZC1]
 gi|298729857|gb|EFI70402.1| flagellar biosynthesis protein FliR [Lysinibacillus fusiformis ZC1]
          Length = 257

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 113/232 (48%), Gaps = 14/232 (6%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV +    +P  S   IP QV++  A+    VL   ++ TID++ F     Y  LV
Sbjct: 13  LVLVRVSAFFATVPFFSYRTIPPQVKITLAL----VLAWMMYYTIDVEPFAFNDDYILLV 68

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIG 132
           M E  +G + GL+  +    +Q  GS I   +G  +   +    + A++PL      ++ 
Sbjct: 69  MKEALVGLLLGLMGYIIMSAIQIAGSFIDFQMGFAIANIID-PQTGAQSPLIGQFFNMLA 127

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT----FMIMLRLSSP 188
           LL L  ID HH +   +  SY   P+ Q  +F N   +F   + TT    F I  ++++P
Sbjct: 128 LLLLLAIDGHHMILNGIYYSYQFFPMDQFPSFMN--ENFPQFIITTFTAVFAIAFQMAAP 185

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
            +    + ++++G+  K VPQ+ I+ +  P  IG+    LF  +++ I V Q
Sbjct: 186 VVATLFLVDLALGITAKTVPQLNIFVVGFPIKIGVSFLVLFTMMAVMIQVIQ 237


>gi|297617156|ref|YP_003702315.1| flagellar biosynthetic protein FliR [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144993|gb|ADI01750.1| flagellar biosynthetic protein FliR [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 254

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 104/226 (46%), Gaps = 5/226 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  RV    +  P  S   IP+Q+++   +  + ++  ++          N   +   +
Sbjct: 10  LVFARVSGLFLSAPVYSSRQIPVQIKVFLGLLLAAII-TYVRPISTRVELDNTGIFLVAL 68

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
            VE+F G   GL   V    +Q  G ++   +G  +   M     +    + S   ++ +
Sbjct: 69  AVEVFTGYALGLAGYVLFAAVQLAGQLVDMQMGFGIVNVMDPQSGMQVPLVGSFYYLLAI 128

Query: 134 LALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSF-VNMLQTTFMIMLRLSSPFLF 191
           L    ID HHQ+  A+  SY  IPI G +   G  F++F V +    F++ +++++P + 
Sbjct: 129 LVFLGIDGHHQLLSAVYHSYDVIPILGAKFQPG--FTAFLVKLGGYMFVLGVKIAAPVVA 186

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
             +V + ++G + + VPQ+ I+ +  P  I  G + L L I + V+
Sbjct: 187 ALLVADTALGFMARTVPQMNIFLVGMPLKILGGIVMLLLVIPVYVW 232


>gi|296157444|ref|ZP_06840279.1| flagellar biosynthetic protein FliR [Burkholderia sp. Ch1-1]
 gi|295892216|gb|EFG71999.1| flagellar biosynthetic protein FliR [Burkholderia sp. Ch1-1]
          Length = 260

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 101/214 (47%), Gaps = 2/214 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L    +P++V++  A   +I++ P L     +  F     +  +++ +
Sbjct: 21  VRILALVATAPVLGNRSLPIRVKIGLAAFVTIIVAPTLGALPQVTVFSAEGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  +   +GL   T      S +   L+S +  I +L  
Sbjct: 79  FLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDSQASSSSQVLSSYMNTIAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            VID H Q+  AL+ ++ ++P+   +     + +  N   T F   L LS P +   ++ 
Sbjct: 139 LVIDGHLQMISALLATFQSVPVSANILGAPGWRTLANFGSTVFSAGLLLSLPVVVALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           N+++G+LN+  PQI ++ I  P  + +G L L L
Sbjct: 199 NLALGILNRAAPQIGVFQIGFPLTMLIGMLLLQL 232


>gi|295678049|ref|YP_003606573.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1002]
 gi|295437892|gb|ADG17062.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1002]
          Length = 260

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 98/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + I   P L  + +P +V++  A   +I++ P +     +  F     +  ++  +
Sbjct: 21  ARIAALIATAPVLGNTSLPSRVKIGLAAFTTIIVAPTIGALPQVTVFSADGVW--ILANQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  I   +GL   T      + +   ++  +  I +LA 
Sbjct: 79  FLIGIALGVTMQIVFQAIDATGYFIGLGMGLGFATFFDQQATGSGVVISRYMTTIAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H Q+  ALV ++ ++P+   L   + + +  N   + F   L LS P +   ++ 
Sbjct: 139 LAVDGHLQMIAALVTTFQSVPVSANLLAPHGWQTLANWGSSIFSAGLLLSLPVVVALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTP--YLIGL 223
           N+++G+LN+  PQI ++ I  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGVFQIGFPLTMLVGL 227


>gi|90415340|ref|ZP_01223274.1| Bacterial export protein, family 1 [marine gamma proteobacterium
           HTCC2207]
 gi|90332663|gb|EAS47833.1| Bacterial export protein, family 1 [marine gamma proteobacterium
           HTCC2207]
          Length = 256

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 108/227 (47%), Gaps = 16/227 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRAYYSKLVMVE 76
           RV + ++  P  S+  + ++VR+  A   ++++ P + W  ID         YS   + E
Sbjct: 21  RVSAFLLASPFFSLRAVNVRVRVLLAALLTLMIYPLVDWPIID--------PYSAAGLRE 72

Query: 77  LF----LGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII- 131
           +F    +G V G+L+++    L   G  +S+A+GL +     I  ++   P+ S   II 
Sbjct: 73  IFNQILIGTVMGMLLQIVNASLVIGGQAVSSAMGLGMANM--IDPNMGNVPVISQFFIIC 130

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L    I  H  V   +++S+ T+P+GQ L    + +  +      F+  L L+ P + 
Sbjct: 131 STLIFMGIGGHVLVISLILESFKTLPVGQMLAPDMLMAVLLQWSSMIFLGGLLLALPIMV 190

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
             +  NI +G++ +  P + I+ +  P +I +G + L  S+  I Y+
Sbjct: 191 SLLFVNIGVGVITRAAPALNIFAVGFPAMIMVGMVLLATSMTSIGYR 237


>gi|268589972|ref|ZP_06124193.1| flagellar biosynthetic protein FliR [Providencia rettgeri DSM 1131]
 gi|291314689|gb|EFE55142.1| flagellar biosynthetic protein FliR [Providencia rettgeri DSM 1131]
          Length = 259

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 78/160 (48%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   GL +++    ++  G VI   +GL+  T    +       L  +  +I LL 
Sbjct: 77  QMVIGVAMGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRIFNVITLLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + Y +V S+  IPI       + F  FV    T F+  L L+ PF+  +++
Sbjct: 137 FLAFDGHLWLIYIVVNSFELIPIQTAPLNRDGFWVFVQFANTIFINGLMLALPFITLFLI 196

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            N+++G+LN++ PQ+ ++ +  P  + +G   L L I I+
Sbjct: 197 LNLALGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISIL 236


>gi|319649549|ref|ZP_08003705.1| flagellar biosynthetic protein fliR [Bacillus sp. 2_A_57_CT2]
 gi|317398711|gb|EFV79393.1| flagellar biosynthetic protein fliR [Bacillus sp. 2_A_57_CT2]
          Length = 258

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 114/237 (48%), Gaps = 9/237 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  LI  RV S  +++P  S   IP   ++   + F +  + FL   +D+        YS
Sbjct: 10  AFLLIFVRVTSFFLMMPLFSYRSIPAAHKI--GLGFFLAWIMFL--GMDVPMLEIDGTYS 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
            L++ E  +G + G +  +    +Q  G  I   +G  +   +    + A++PL    + 
Sbjct: 66  LLIIKEALVGLMVGFIAYLILSAIQIAGGFIDFQMGFAIANVID-PQTGAQSPLMGQYLY 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGN--IFSSFVNMLQTTFMIMLRLS 186
            I L  L  ++ HH +   +  SY  IP+ Q  ++FG+  +    +  L T F+I  ++S
Sbjct: 125 TIALFFLLTVNGHHLMLDGVFYSYDFIPLDQAWISFGDEDMAEYVIKALNTMFVIAFQMS 184

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            P +    + ++++G++ + VPQ+ ++ +  P  IG+  + L + + +++Y  S +F
Sbjct: 185 IPVVGSLFLVDVALGIVARTVPQLNVFVVGLPLKIGVSFIVLIIVMSVLMYAVSLAF 241


>gi|229591838|ref|YP_002873957.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens SBW25]
 gi|229363704|emb|CAY51086.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens SBW25]
          Length = 258

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 110/232 (47%), Gaps = 7/232 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+ + +M +P    + +P ++RL FA+A ++VL+P L         VN    S
Sbjct: 15  SFILPLFRITAMLMAMPVFGTTLVPRRIRLYFAVAITVVLVPGL----PPMPPVNALDLS 70

Query: 71  KLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            L+++  ++ +G + G  ++++       G +IS  +G+   + +  ++ ++   +   +
Sbjct: 71  ALMLIAEQVLIGTLLGFSLQLFFQAFVIAGQIISIQMGMGFASMVDPTNGVSAAVIGQFL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H   F  L +S+ T+P+G  L   N F   V  L       L L  P
Sbjct: 131 TMLVTLLFLAMNGHLVAFEVLTESFTTLPVGSGLVV-NHFWEVVGRLGWVLGASLLLVLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   +V NI+ G++ +  PQ+ I+ I  P  + LG     + +  I+ Q+ 
Sbjct: 190 AITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIFWVGLADILNQYQ 241


>gi|224438386|ref|ZP_03659313.1| flagellar biosynthesis protein FliR [Helicobacter cinaedi CCUG
           18818]
 gi|313144828|ref|ZP_07807021.1| flagellar biosynthesis protein FliR [Helicobacter cinaedi CCUG
           18818]
 gi|313129859|gb|EFR47476.1| flagellar biosynthesis protein FliR [Helicobacter cinaedi CCUG
           18818]
          Length = 258

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 96/234 (41%), Gaps = 3/234 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+V R        P      I + VR       S+   P    T+   + V   + +   
Sbjct: 18  LLVARFSGVFAFFPFFDNQLISINVRAAMVFFMSVAFYPLASYTLPDMSMVEFLFAA--- 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ LG +  + +++    L F G +IS  +GL + ++        +  +  LI I+GL
Sbjct: 75  LFEILLGFLASVCLQIVFAMLSFGGELISFTMGLTMASAYDPVSGTQKPIVAQLIAILGL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L    +DFHH +F  +  S    P+G  +        F+      F +   ++ P L   
Sbjct: 135 LIALSLDFHHTIFLIISHSIQATPLGGFVFEPKSVEYFIKAFGNIFAVGFSMAFPILAII 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           ++ +I  G++ K  PQ  +  I  P  I +  + L L+I  I++ F +     F
Sbjct: 195 LLSDIIFGMIMKTHPQFNLLAIGFPVKIAIAFVVLFLTISSIIFTFKNELAKAF 248


>gi|94968668|ref|YP_590716.1| flagellar biosynthetic protein FliR [Candidatus Koribacter
           versatilis Ellin345]
 gi|94550718|gb|ABF40642.1| flagellar biosynthetic protein FliR [Candidatus Koribacter
           versatilis Ellin345]
          Length = 253

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 114/236 (48%), Gaps = 8/236 (3%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E+ + S+ L+  R+ + ++  P  S + IP +V+    +  +I+L P    ++     ++
Sbjct: 5   EVWVQSIVLVGTRIAALVLFAPFFSHAAIPPRVKGGLVVLLTILLYP----SVISATVLS 60

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-L 124
            +    +V+ E F+G + GL   +    +QF G  +   +GL+L + +    + A++P L
Sbjct: 61  ASEVVGVVLHETFIGMLIGLSSVLVFEAVQFAGQCLGIEVGLSLVSVLD-PQTQADSPVL 119

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
           + L+  I LL    ++ HH +  AL  SY  IP G     G +           F + ++
Sbjct: 120 SVLLQTILLLLFLDLNVHHWLLRALADSYRLIPPGAGRLTGVVVQDLFQQAGMIFALGVQ 179

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQ 238
           +++P L   ++ +I    L K  PQ+P+  +  P  +++GL +L+  L    +++ 
Sbjct: 180 IAAPVLAATLLADIVFAFLAKASPQMPVLLLGMPVKFVLGLTTLWAGLRFWPVIFD 235


>gi|169831896|ref|YP_001717878.1| flagellar biosynthetic protein FliR [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638740|gb|ACA60246.1| flagellar biosynthetic protein FliR [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 253

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 102/236 (43%), Gaps = 4/236 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTID-LQNFVNRA 67
           +++  L+  R+ + I   P  +M  IP  V+   A   S+ LLP        L +F+   
Sbjct: 4   LVTFLLVFTRLAAFIAACPVFAMREIPPTVKAGLAFVLSLALLPSAGTAAPPLDSFLG-- 61

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +S  +  E  +G   G+   +   GL   G  I   IG  +   M          ++ L
Sbjct: 62  -FSLALAKEAAVGLGLGIFTSLVFHGLLLAGQYIGFQIGFAIAEMMSPGTEGERAIVSRL 120

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +  L+    ID HH +   L KS+  +P+G  +                F+I L +++
Sbjct: 121 MWLFALVFFVSIDGHHLLIAGLAKSFELVPLGAAVAQMKTTLFMAKAYGGLFVIALTIAA 180

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   +V +  +GL+ ++VPQI ++ +  P+ +  G   L ++I +I +  +  F
Sbjct: 181 PVMAVLLVTDAILGLMVRMVPQINVFMLGFPFKVFAGLFALMVTIPVIGWALTRVF 236


>gi|91200238|emb|CAJ73282.1| similar to flagellar biosynthetic protein FliR [Candidatus Kuenenia
           stuttgartiensis]
          Length = 262

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY-YS 70
           L L+  RVG  ++  P  S ++IPM +R+  A+  + +L P L    +L    +    + 
Sbjct: 16  LMLVFFRVGGILLFAPVFSNTHIPMLLRIAIALILAFILYPNLDK--NLHELPSELIPFG 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-SLAETPLNSLI- 128
            +V+ E+ +G + G    +        G ++S  +GL++      S  S  E P  S+  
Sbjct: 74  LIVVKEIAIGAIVGFAASILFAAFSMAGYLLSNQMGLDMAVIADPSSLSGDEEPTVSVFY 133

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +I +L L  ID HH    A+ +S+  +PIG       I +  +++ +T F+I +++S P
Sbjct: 134 NLIAILLLLAIDGHHYFINAIAQSFHAVPIGSFDYTTAILTKILSLFRTLFVIGIKISIP 193

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
                ++  +++ L+ K+  +I I+ I+ P  I +G
Sbjct: 194 AFVVLMLSVVAMALMAKVAKEINIFVIAYPIKIIIG 229


>gi|325525520|gb|EGD03319.1| flagellar biosynthetic protein FliR [Burkholderia sp. TJI49]
          Length = 260

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 105/230 (45%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +    +P++V++  A   ++++ P L     +  F     +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHPSVPVRVKIGVAAFMALIVAPTLGAMPPVTVFSAEGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAAMGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QVF AL  S+ ++P+   L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVFAALAASFQSLPVSAALLHAPGWRTLAAFGATVFGMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI ++ I  P  + +G L + L +  +V   S  F  G
Sbjct: 199 NLALGILNRAAPQIGVFQIGFPVTMLVGLLLVQLMVPNLVPFVSRLFDMG 248


>gi|114762170|ref|ZP_01441638.1| flagellar biosynthetic protein FliR [Pelagibaca bermudensis
           HTCC2601]
 gi|114545194|gb|EAU48197.1| flagellar biosynthetic protein FliR [Roseovarius sp. HTCC2601]
          Length = 255

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 103/213 (48%), Gaps = 4/213 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RVG+ + +LPGL    +PM+VRL   +  ++ +LP     + L         +  ++ E 
Sbjct: 24  RVGAMMAVLPGLGEQTVPMRVRLALGLVLTVTVLPATGADLALPP-PGLGTVAWALVTES 82

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + GL +R++   LQ  GS+ + +   +L   +G S +     +  ++ +  L  L 
Sbjct: 83  VIGLILGLWLRLFMHALQTAGSIAAQST--SLAQLLGNSAADPMPAIGHVLTVAALALLM 140

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
              FH +V   ++ S+   P     +   I  +    +   F +   L++PF+    ++N
Sbjct: 141 STGFHVKVAGFIILSFELFPALLLPDPSLIAQAGRGHIAMAFALAFTLAAPFVILSALYN 200

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           +++G +NK +PQ+ + F+  P +I  GS+ L L
Sbjct: 201 LTLGFINKAMPQLMVAFVGAP-VITFGSIALLL 232


>gi|46581636|ref|YP_012444.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601205|ref|YP_965605.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris DP4]
 gi|46451059|gb|AAS97704.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561434|gb|ABM27178.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris DP4]
 gi|311235278|gb|ADP88132.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris RCH1]
          Length = 263

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 111/237 (46%), Gaps = 18/237 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVR--LCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV 75
           RV   + LLP      +PMQV+  LC  MA +      LW  + L   V  ++  +LV++
Sbjct: 20  RVSLVMFLLPFFGGDAVPMQVKVALCLVMAMA------LWPRLSLAGAVMPSHPFELVVM 73

Query: 76  ---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN---SLIG 129
              EL LG V G+ +     G+Q  G ++   +G    T + I+D L+   ++     + 
Sbjct: 74  LASELVLGLVLGMAVHFLFAGIQTGGQLLGFQMGF---TMISIADPLSGAQISITSHFLY 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++ LL    +D H  +  A  +S+  +P G  +    + +  V +    F+I +++++P 
Sbjct: 131 MVSLLTFLALDGHLFLLRAFAESFALVPAGGLVANPAVANELVRLAGGMFVIAVKIAAPV 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           L    +  +++ L+ +  PQ+ +  I  P  I +G  F+ L   I+  Q+   F+ G
Sbjct: 191 LVTLFLVELALALMARAAPQMNLLMIGFPLKIAVGFFFMGLLFTILA-QYIEEFIIG 246


>gi|206889278|ref|YP_002249864.1| putative flagellar biosynthetic protein-like protein
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741216|gb|ACI20273.1| putative flagellar biosynthetic protein-like protein
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 243

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 106/231 (45%), Gaps = 16/231 (6%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           +  RV   +  LP +    +P+  R  FA++ S+ ++PF+   +  +N +   + + +  
Sbjct: 17  VFIRVSIILFFLPYIGSRTVPIMFRFFFALSISLAIIPFI--HVKEENLLISLFNAVV-- 72

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
                G   G+++RV    ++     +S  IG  +             PL+    +  + 
Sbjct: 73  ----FGMAIGIMVRVIIAAVEIASQWMSMQIGFTIANVFNPQFGELMGPLSIFYEMFTIA 128

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS-SFVNMLQTTFMIMLRLSSPFLFFY 193
             + +D H      +VK++   PI    + GNI + S++      F + L+L++P L   
Sbjct: 129 LFFSLDLHLSFVEMIVKTF-EFPIKFSFS-GNIIAFSYI-----MFPLALKLAAPVLLVQ 181

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ NI +G L++++PQ  ++F+  P L+  G   + LSI I     S +F+
Sbjct: 182 VLMNIGLGFLSRIMPQANVFFVGFPLLLATGIAVMWLSIPIFTMVLSKAFI 232


>gi|167579279|ref|ZP_02372153.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           TXDOH]
          Length = 260

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 97/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + L P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVALAPVTGHRATPVRVKIGLAGFMALVVAPTLPPMPAATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +PI  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPISADLLRAAGWQTLVAFGSAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|304316891|ref|YP_003852036.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778393|gb|ADL68952.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 260

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 107/222 (48%), Gaps = 7/222 (3%)

Query: 13  FLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           FLIV  R+    +L P      +P   ++  A   SI++   +   ID  N      Y  
Sbjct: 14  FLIVFVRMLGIFILTPLFGTRSLPSMFKIGLAFFTSIIMFDLVKVNIDANNLYQ---YVV 70

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V  E  +G + GL   V    +   G +I   +G ++   +   +      + + + I+
Sbjct: 71  IVFNEFLVGLLIGLASMVSFSAIYLAGQIIDYQLGFSIVNVLAAGEETQVPLVGNFVYIL 130

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            LL   +I+ HH++F  L +SY  IP+G   L+  +I   F  ++   F++  R+S+P +
Sbjct: 131 TLLLFLLINGHHKLFVILFQSYSLIPVGTAFLHSESINVVFTKIVSDMFVLGFRISAPIV 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
              ++ +I++ ++++ +PQ+ ++ I  P    IG+ +LF+ L
Sbjct: 191 LSTLLTDITLSIISRTIPQLNVFMIGMPIKIFIGIFTLFIML 232


>gi|254436544|ref|ZP_05050038.1| flagellar biosynthetic protein FliR [Octadecabacter antarcticus
           307]
 gi|198251990|gb|EDY76304.1| flagellar biosynthetic protein FliR [Octadecabacter antarcticus
           307]
          Length = 275

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 109/239 (45%), Gaps = 28/239 (11%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFA--MAFSIVLLPFLWDTIDLQNFVNR 66
           M+  FL + R+ +  M  P    + IP+Q R+  +  +AFS      L+  I++ +    
Sbjct: 26  MLIFFLHILRLSAFFMAAPFFGAAAIPVQARIIISVLIAFS------LYGLIEVPDPNQL 79

Query: 67  AYYS--KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
            + +  ++V++E+ +G   GL   +    +   G  I+ + GL     +   +S  +TP+
Sbjct: 80  PFLALIEVVLIEIAIGVSLGLTFTILFASVAMAGEQIAISAGLGFAAQVD-PNSGGQTPV 138

Query: 125 -NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
            +  + +  + A   ++ H  V   +  S+  +P+G+  NF  + S  +      F+I  
Sbjct: 139 VSQFLNLFAIAAFLSLNGHLHVIGVIRMSFEILPLGEPFNFSGLISGGLTAGGHMFVIAS 198

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQ----------------IPIYFISTPYLIGLGSL 226
           RL+ P +   ++ NI++G++ +  PQ                + +YF +TP+  G+  +
Sbjct: 199 RLALPIVSILLLANITVGVVTRSAPQLNLFSFGFPLTILTCFVALYFSTTPFAAGIADM 257


>gi|161523218|ref|YP_001578230.1| flagellar biosynthetic protein FliR [Burkholderia multivorans ATCC
           17616]
 gi|189348925|ref|YP_001944553.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
 gi|221214542|ref|ZP_03587512.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD1]
 gi|160340647|gb|ABX13733.1| flagellar biosynthetic protein FliR [Burkholderia multivorans ATCC
           17616]
 gi|189332947|dbj|BAG42017.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
 gi|221165432|gb|EED97908.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD1]
          Length = 260

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 105/230 (45%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P +V++  A   ++++ P L     +  F     +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHASVPARVKIGVAAFMALIVAPTLGPMPAVTVFSAEGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGTAMGFTMQIVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QV  AL  S+ ++P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVLAALTASFQSLPVSADLLHAPGWRTLATFGATVFGMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI ++ +  P  + +G L + L +  +V   S  F  G
Sbjct: 199 NLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMVPNLVPFVSRLFDMG 248


>gi|167617385|ref|ZP_02386016.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           Bt4]
          Length = 260

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 97/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + L P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVALAPVTGHRATPVRVKIGLAGFMALVVAPTLPPMPAATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAVEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +PI  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPISADLLRAAGWQTLVAFGSAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|312126837|ref|YP_003991711.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776856|gb|ADQ06342.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 260

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 102/219 (46%), Gaps = 4/219 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL++ R+    +  P      IP   ++ FA   S++++     +  +    N   Y   
Sbjct: 16  FLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSLLVVTTYRFSYSVP--ANLLEYIFA 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + +  
Sbjct: 74  VIKEFIVGLLVGYISYMIFSAILLAGQIIDNAIGFGMANVIDPMSEIQVPLLGNFLYLYM 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS-SFVNMLQTTFMIMLRLSSPFLF 191
           L+  +  D HH +  A+V SY  +PIG E +F + F+ SF+      F+I + +S P L 
Sbjct: 134 LVVFFGTDAHHLLIRAVVYSYKLVPIGHE-SFRSEFTWSFLRFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L +
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVI 231


>gi|320107035|ref|YP_004182625.1| type III secretion system inner membrane R protein [Terriglobus
           saanensis SP1PR4]
 gi|319925556|gb|ADV82631.1| type III secretion system inner membrane R protein [Terriglobus
           saanensis SP1PR4]
          Length = 262

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 103/222 (46%), Gaps = 12/222 (5%)

Query: 4   SPEI------IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT 57
           SPEI      I+ S  L++ R+G  I L P  +   IP ++++ F +A +I+L P     
Sbjct: 8   SPEILNPWAHILASGTLVMVRLGGVIALAPPFNSPGIPPRIKVGFLLAMTILLAPIAAGI 67

Query: 58  IDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD 117
            +    V+    S  V+ E+ +G + G  + +    L F GS++  +   +L   +   +
Sbjct: 68  PEAH--VDLEITS--VLGEMAVGLLFGFSLTLLNEALLFAGSLLGISFSFSLANLLD-PN 122

Query: 118 SLAETP-LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ 176
           S  +TP L  L+   G+L ++       +  A+++S   +P+G+           V M+ 
Sbjct: 123 SRVDTPVLGILLNWFGILIIFGAGLDRLILAAVMRSLAVVPLGRATMHLGAVHQCVAMIS 182

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
             F   L+L++P +   +   +++ L+++  P +P   +  P
Sbjct: 183 GVFFAGLQLATPIMAAALAVEVTVALISRFAPALPAQVVGIP 224


>gi|326791524|ref|YP_004309345.1| flagellar biosynthetic protein FliR [Clostridium lentocellum DSM
           5427]
 gi|326542288|gb|ADZ84147.1| flagellar biosynthetic protein FliR [Clostridium lentocellum DSM
           5427]
          Length = 261

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 104/210 (49%), Gaps = 7/210 (3%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVR--LCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           L +I CR+ + ++ LP +  S IP      LC  +A ++ ++  L         ++   Y
Sbjct: 14  LLIIFCRIIAAVLFLPIIEESRIPKLATSGLCLCLAITVFMVTDLGQIYYEPTLIS---Y 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           + L++ E  +G + G ++++Y    QF GS+ ST  GL +  ++     + +TP+     
Sbjct: 71  TILLLKETLVGLIIGFVLKIYFQIYQFIGSLWSTQGGLGMSMALDPVGGV-QTPVLGRFY 129

Query: 130 IIGLLALWVIDF-HHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            + L A++V+   +H     L+ ++  IPI + +   ++ +  ++ +    +I   L+ P
Sbjct: 130 NLCLCAIFVLSGGYHWFIKTLIDTFTLIPINKGVFGTHLVTGIIDTVGNYLLISFELAMP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            L   I+ +  +G+L + VPQ+ ++ I  P
Sbjct: 190 VLGLLILIDFGLGILARTVPQMNMFVIGIP 219


>gi|322421719|ref|YP_004200942.1| flagellar biosynthetic protein FliR [Geobacter sp. M18]
 gi|320128106|gb|ADW15666.1| flagellar biosynthetic protein FliR [Geobacter sp. M18]
          Length = 261

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 105/238 (44%), Gaps = 17/238 (7%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVR--LCFAMA---FSIVLL---PFLWDTIDLQNFVN 65
           L++ RV    M +P      +P +V+  L FA+A   F I+ L   P   D++ L     
Sbjct: 18  LVLARVAGLFMAIPMFGARLVPNRVKAVLIFALALLIFPIIRLHAIPAADDSLSLM---- 73

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV+ E  +G   G + +     ++F G ++ T +G+++      +       + 
Sbjct: 74  -----LLVLRESLIGLTLGAISQFVFAAVEFCGQLVGTQMGISIAAQFDPTTQNNVPTMA 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
              G +  L    +  HH     +V+SY  IP+G     G +    +      F+I ++L
Sbjct: 129 IFQGALATLIFLSLGVHHFFIRGIVESYQLIPLGAWHTSGGLLKFLIEASTGIFVIGIKL 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++P     +  ++ +G++ +  P + ++ +S P  IG+G L L +S+ + +     SF
Sbjct: 189 AAPVSVALLATSVVLGIVARSFPAMNVFMVSMPLNIGIGFLILGISLPVFLRVLQGSF 246


>gi|317051543|ref|YP_004112659.1| type III secretion system inner membrane R protein
           [Desulfurispirillum indicum S5]
 gi|316946627|gb|ADU66103.1| type III secretion system inner membrane R protein
           [Desulfurispirillum indicum S5]
          Length = 264

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 109/222 (49%), Gaps = 13/222 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R  S ++ +P L    + MQV++  ++  S +L P     +     V      +L++V  
Sbjct: 22  RTLSIVVSMPVLGGEQVKMQVKIGLSLLVSALLFP----MVSAHGAVIPPNIFELMIVIF 77

Query: 76  -ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            E+F+G   G   ++    +QF G ++   +GL++   +    ++    +   + I  +L
Sbjct: 78  KEIFIGLAIGFAGQIILGIIQFAGQIMGFQVGLSMSNVLDPMTNIQVPIIGQFLTIFVVL 137

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNI--FSSFV-NMLQTTFMIMLRLSSPFLF 191
              + + HH VF  L +SY  IP+G  L+FGN+  F+  V  +  T F +  +++ P +F
Sbjct: 138 LFLLANGHHYVFMGLYESYTLIPLGM-LSFGNLGGFAQLVIELAATIFYVGFKITGP-VF 195

Query: 192 FYIVFNISI-GLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
             ++ + SI G+L K+VPQI +  +  P  I  G L L L I
Sbjct: 196 VVVLISQSINGILGKMVPQINLLTVGLPVQIFFGLLTLALVI 237


>gi|330502778|ref|YP_004379647.1| flagellar biosynthesis protein FliR [Pseudomonas mendocina NK-01]
 gi|328917064|gb|AEB57895.1| flagellar biosynthesis protein FliR [Pseudomonas mendocina NK-01]
          Length = 258

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 102/207 (49%), Gaps = 3/207 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ + +M++P +    +P +VRL  A+A S+VL+P L     +     R+    +++ ++
Sbjct: 22  RIAAMLMVMPIIGTQLVPTRVRLYLALAISVVLVPTLPPMPQVDALSLRSLL--MILEQV 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + G +++++       G +I+  +GL   + +  ++ ++   L   + ++  L   
Sbjct: 80  LIGAMFGFILQLFFHLFAVAGQIIAMQMGLGFASMVDPTNGVSVPVLGQFMLMLVTLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            I+ H  V   L +S+ ++P GQ +   N + +    L       L L+ P +   +V N
Sbjct: 140 AINGHLVVLEILAESFISLPPGQGMMV-NHYWTLAGKLSWVIGAGLLLTLPMVTALLVIN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++ G++ +  PQ+ I+ I  P  + +G
Sbjct: 199 LAFGVMTRAAPQLNIFSIGFPLTLAMG 225


>gi|221201781|ref|ZP_03574818.1| flagellar biosynthetic protein FliR [Burkholderia multivorans
           CGD2M]
 gi|221207714|ref|ZP_03580722.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD2]
 gi|221172560|gb|EEE04999.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD2]
 gi|221178201|gb|EEE10611.1| flagellar biosynthetic protein FliR [Burkholderia multivorans
           CGD2M]
          Length = 260

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 106/230 (46%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P +V++  A   ++++ P L     +  F  +  +  +V+ +
Sbjct: 21  VRMLALVATAPVVGHASVPARVKIGVAAFMALIVAPTLGPMPAVTVFSAQGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGTAMGFTMQIVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAMLAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QV  AL  S+ ++P+  +L     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAVDGHLQVVAALTASFQSLPVSADLLHAPGWRTLAAFGATVFGMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQI ++ +  P  + +G L + L +  +V   S  F  G
Sbjct: 199 NLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMVPNLVPFVSRLFDMG 248


>gi|258592486|emb|CBE68795.1| putative Flagellar biosynthetic protein fliR [NC10 bacterium 'Dutch
           sediment']
          Length = 266

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 95/199 (47%), Gaps = 2/199 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ R+G   +  P  + S++P+  ++  A++ ++ L P L  +  L   +     +  +
Sbjct: 16  LILFRLGGLFLTAPIFAGSHLPIPFKIGLALSLTVSLYPLLGKSALLARGMEPFSLALSI 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G V GL  R+  +G+   G +    +GL +   +        + +   + ++ +
Sbjct: 76  VGEVAVGVVIGLAARLLFVGVSLAGELAGVQMGLGIANVVDPQFPQQASIVAQFLELMTI 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQ--ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           L    +  HH    A+  S+ +IP+G           S  V +   + ++ LRLSSP + 
Sbjct: 136 LTFLTLHGHHAFLEAVWASFESIPLGTFSGAAAAGAASVLVALFGKSLVLALRLSSPIMV 195

Query: 192 FYIVFNISIGLLNKLVPQI 210
             ++ N+++GLL ++ PQ+
Sbjct: 196 AVLITNVAMGLLARVAPQL 214


>gi|78355425|ref|YP_386874.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217830|gb|ABB37179.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 261

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 116/240 (48%), Gaps = 15/240 (6%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E   +S  L + R+   + LLP    +  P  V+    M  ++ L P L  +  L     
Sbjct: 8   EASFLSFLLTLMRISLVVFLLPVFGGNSAPRLVKGALCMVLTLALWPHLSFSGSL--LPG 65

Query: 66  RAYYSKLVMV-ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA--ET 122
             +   L++  E+ +G + GLL+R +  G+Q  G ++   +G    T + ++D L+   T
Sbjct: 66  HPFGIALMLAGEIIMGIMLGLLVRFFFAGIQTGGELLGFQMGF---TMVSVADPLSGQST 122

Query: 123 PLNS-LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT--- 178
            ++S  + ++ LL   V+D H  +   L  S+  +P GQ L F +  +S  NML      
Sbjct: 123 SISSHFMYMVSLLIFLVLDGHLVMLKGLTDSFALVPPGQ-LVFRH--ASLHNMLTLAGGM 179

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
           F++ + +++P +    +  +++ L+ +  PQ+ +  I  P  IG+G LF+ L   I+ +Q
Sbjct: 180 FVMAVHIAAPVMAALFLVELALALMGRAAPQMNLLMIGFPLKIGVGFLFMGLLFTIMRHQ 239


>gi|217424090|ref|ZP_03455590.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 576]
 gi|254184097|ref|ZP_04890688.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1655]
 gi|184214629|gb|EDU11672.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1655]
 gi|217393153|gb|EEC33175.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 576]
          Length = 260

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 98/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P  S    P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTSHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +P+  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|242280057|ref|YP_002992186.1| flagellar biosynthetic protein FliR [Desulfovibrio salexigens DSM
           2638]
 gi|242122951|gb|ACS80647.1| flagellar biosynthetic protein FliR [Desulfovibrio salexigens DSM
           2638]
          Length = 267

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 108/225 (48%), Gaps = 7/225 (3%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ-NFVNRA 67
           +MS +L + RV   + LLP    + IP  V+     A +IVL   +W  +  + + +  +
Sbjct: 11  LMSFYLTLFRVSIVLFLLPFFGGNSIPKTVK----AALTIVLTLGIWPHVTFEGSLMPAS 66

Query: 68  YYSKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            Y+  +M+  E+ LG V G+ + V    +Q  G++I   +G ++   +       E    
Sbjct: 67  PYNIALMILGEMVLGLVMGISVHVMFAAIQTGGNLIGVQMGFSMVNVLDPLTGTNEAVTA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + +  +L    I+ H  +  A+V+S+  IP GQ      + S  +++ +  F++ +++
Sbjct: 127 HFLYMCAILVFLSINGHLYLMSAMVESFKYIPPGQIFISSTLTSQIMSISKDLFVLAVKV 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           +SP +    V ++ + L++K+ PQ+ +  +  P  I  G   L L
Sbjct: 187 ASPIIATIFVVDLGLALISKMAPQMNVLMLGFPLKILAGFFVLSL 231


>gi|312135836|ref|YP_004003174.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           owensensis OL]
 gi|311775887|gb|ADQ05374.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           owensensis OL]
          Length = 260

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 102/222 (45%), Gaps = 10/222 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL++ R+    +  P      IP   ++ FA   S+++      T  + +  N   Y  +
Sbjct: 16  FLVLARMSGLFIASPIFGRRNIPAYFKVGFAFFLSMIVFTAYNFTYSIPD--NVVEYVFV 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP---LNSLIG 129
           V+ E  +G + G +  +    +   G +I  AIG  +     + D ++E     L + + 
Sbjct: 74  VIKEFIIGLLIGYISYMIFSAILLAGQIIDNAIGFGMAN---VVDPMSEVQVPLLGNFLY 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS-SFVNMLQTTFMIMLRLSSP 188
           +  L+  +  D HH +  A+  SY  +PIG    F   F+ SF+      F+I + LS P
Sbjct: 131 LYMLVVFFGTDAHHLLIRAIFYSYKLVPIGYG-GFKTEFAWSFLRFFSELFLIGVELSLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            L   ++ +I + +L++ VPQ+ ++ +  P  I +G L L +
Sbjct: 190 ILMSMLIVDIILAVLSRAVPQMNVFMVGLPVKIAIGFLVLVI 231


>gi|325920562|ref|ZP_08182484.1| flagellar biosynthetic protein FliR [Xanthomonas gardneri ATCC
           19865]
 gi|325548955|gb|EGD19887.1| flagellar biosynthetic protein FliR [Xanthomonas gardneri ATCC
           19865]
          Length = 263

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 89/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   S+VL P L    +   F  +A  S  V  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLAGTLSMVLAPLLPPVPEWDGFTAQAVLS--VAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     PL  +    G++A W
Sbjct: 85  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PLRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  +      ++F  +  T F+ +LR   
Sbjct: 135 FYIGFGLLFFAANGHLAVISLLVDSYKALPIGTAVPDA---AAFAEVAPTLFLQILRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|152990383|ref|YP_001356105.1| flagellar biosynthetic protein FliR [Nitratiruptor sp. SB155-2]
 gi|151422244|dbj|BAF69748.1| flagellar biosynthetic protein FliR [Nitratiruptor sp. SB155-2]
          Length = 255

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 104/213 (48%), Gaps = 6/213 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  RVG+  + LP  + +YIP  +++   +AFS  L+  L    D    V    ++ ++
Sbjct: 13  LVFFRVGAIFLSLPVFNANYIPSNIKILLILAFSFYLIQNLTIYYDFSK-VTLMQFTLMI 71

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL--AETPLNSLIGII 131
           + E+ LG   GLL+ ++     +   +IS  +G    T + + D      + L+ L  ++
Sbjct: 72  LKEILLGFSIGLLVSIFVAAFTYAAEIISYFMGF---TIVNVFDPTYGQVSILSRLFIML 128

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             +  +V D +H    +++KS+  IP+ Q     + F+         F +  +LS PF  
Sbjct: 129 FFILFFVTDAYHIFIISIIKSFSYIPLVQTSYPDSFFTYLFEKSSLIFTLSFQLSFPFAL 188

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
              + N+++ L+N+L+PQI ++ +  P  I +G
Sbjct: 189 IVYLINLALALVNRLIPQINVFIVGLPLQIFVG 221


>gi|218778858|ref|YP_002430176.1| flagellar biosynthetic protein FliR [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760242|gb|ACL02708.1| Flagellar biosynthetic protein FliR [Desulfatibacillum alkenivorans
           AK-01]
          Length = 260

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 110/228 (48%), Gaps = 4/228 (1%)

Query: 10  MSLF-LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M++F LI+ RV   + + P    + IP+ V+   ++  ++ L P +   ++ Q+F +   
Sbjct: 11  MAVFALILIRVSVILFMFPVFGSNLIPLPVKAGLSLLLTLYLTPIV--QVNPQSFPDTVL 68

Query: 69  YSK-LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +++ E  +G    L++  +   +Q  G ++   +G  +            + L++ 
Sbjct: 69  EGGVMILCEAVMGLTLSLIVSFFFAAVQVGGQLVGYQMGFAIANVFDPVSGGQMSILSNF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + L+   V++ HH    A+  S+  +P+G      +I  S + +    F + L+++ 
Sbjct: 129 AFWVTLVLFIVLNGHHIFIRAVAHSFEIVPVGHLYAGRSIMPSMIKLSTDMFTLSLQIAG 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           P +   ++ N + G++ K+VPQI I  ++ P  +G+G  F  +S+++I
Sbjct: 189 PAIVALLLVNAAFGIVAKVVPQINILIVAFPINVGMGLFFFGVSLQLI 236


>gi|84514804|ref|ZP_01002167.1| Flagellar protein FliR [Loktanella vestfoldensis SKA53]
 gi|84510963|gb|EAQ07417.1| Flagellar protein FliR [Loktanella vestfoldensis SKA53]
          Length = 275

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 98/216 (45%), Gaps = 8/216 (3%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M+  FL   R+ +  +  P    + IP+QVR+  ++A +       +  ID+ +  N  +
Sbjct: 26  MLVFFLHTLRLSAFFLSAPFFGAAAIPVQVRVIVSVAIAFGF----YGLIDVPDPQNLPF 81

Query: 69  YS--KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LN 125
            S  ++ ++E+ +G   GL   +    +  TG  I+ + GL     M   +S  +TP ++
Sbjct: 82  LSMIEVALIEVVIGLSLGLAFTIAFSAVALTGEKIAASAGLGFAAQMD-PNSGGQTPVIS 140

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + +  + A   +D H  +   +  SY  +P+GQ   F    +  +      F I  +L
Sbjct: 141 QFLNLFAIAAFLSLDGHLHMIGLIRMSYEVLPLGQPFKFSAFITGGLAAAGHMFTIASQL 200

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
             P +   ++ NI++G++ +  PQ+ ++    P  I
Sbjct: 201 MLPVVSILLLANITVGVVTRSAPQLNLFSFGFPLTI 236


>gi|253996311|ref|YP_003048375.1| flagellar biosynthetic protein FliR [Methylotenera mobilis JLW8]
 gi|253982990|gb|ACT47848.1| flagellar biosynthetic protein FliR [Methylotenera mobilis JLW8]
          Length = 263

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 112/226 (49%), Gaps = 7/226 (3%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +SL   + R+ + I ++P LS + IP +V+L  ++  +I+++P +     L  F   +  
Sbjct: 14  ISLLWPLTRILAVIAIVPILSHATIPRRVKLGLSVLLTIIIVPTI---PPLPQFEAFSLE 70

Query: 70  SKLVMVE-LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
             L++V+ + +G   G  +R+    +   G +I   +GL          +   T LN L+
Sbjct: 71  GLLILVQQVIIGFAIGFSMRLVFAAVDLAGQLIGLTMGLGFAQFFDPQTNGQSTALNQLL 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNML-QTTFMIMLRLSS 187
            ++ +L    +D H  +  A+ +S+ T+PIG  L    I +  + +   T F   L L+ 
Sbjct: 131 VLLAMLIFLSLDGHLIIVSAMARSFITMPIG--LGGAGIDAMQIALWGNTIFSAGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
           P +   ++ N+++G+L +  PQ+ ++ I  P  + +G + + LS+ 
Sbjct: 189 PAVCALLITNMALGILTRTAPQLNLFGIGFPITLSMGFVVVALSLS 234


>gi|121596082|ref|YP_987978.1| flagellar biosynthetic protein FliR [Acidovorax sp. JS42]
 gi|120608162|gb|ABM43902.1| flagellar biosynthetic protein FliR [Acidovorax sp. JS42]
          Length = 256

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 94/205 (45%), Gaps = 12/205 (5%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P  SM  IP++ R+  A   ++     L +   +   +N    +  V+ ++ +G   G  
Sbjct: 31  PVFSMRVIPVRTRIGLAFLVAVCAQAVLPEQPVIS--LNSREAAGAVVQQVGIGLAMGFA 88

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           +R+    ++  G +I   +GLN  +    + +   + +    G I +L   VI+ H  V 
Sbjct: 89  VRLVFAAVELAGEIIGLQMGLNFASFFDPASNAQVSAVARFFGNISMLLFVVINGHLMVL 148

Query: 147 YALVKSYGTIPIGQELNFGNIFSSFVNML-----QTTFMIMLRLSSPFLFFYIVFNISIG 201
            A+VKS+ + P+G     GN   +   M       + F   L ++ P +   +  N+++G
Sbjct: 149 MAVVKSFDSFPVG-----GNFLQAIGQMRLHELGASLFSSALWIALPMIALLLFVNLTLG 203

Query: 202 LLNKLVPQIPIYFISTPYLIGLGSL 226
           +++++ PQ+ IY +  P  + +G L
Sbjct: 204 IISRVAPQMNIYAVGFPVTLTVGML 228


>gi|332799193|ref|YP_004460692.1| flagellar biosynthetic protein FliR [Tepidanaerobacter sp. Re1]
 gi|332696928|gb|AEE91385.1| flagellar biosynthetic protein FliR [Tepidanaerobacter sp. Re1]
          Length = 258

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 103/219 (47%), Gaps = 5/219 (2%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M ++ E+ ++   LI+ R    + L P      IP Q+++  A   S ++ P + + ++L
Sbjct: 1   MNVNYEVALIKYLLILFRCLGFLTLTPVFGRREIPFQIKIGLAALLSFIVYPIIPE-LEL 59

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
            N  N    S  V+ EL  G   G    +    L   G +I   +G  +   +    S A
Sbjct: 60  NN--NLWIVSASVLRELMAGITMGYATFLLFSSLYLAGGIIDLEMGFGMVNVLD-PQSNA 116

Query: 121 ETPL-NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
           + PL  +   I+ +L    ++ HH +  A++KSY  +P+G+ +    + +  +   +  F
Sbjct: 117 QVPLMGNYYYILTILLFLTVNGHHMLISAIIKSYDLLPLGKPVYQEGLLNVIIVSFKDMF 176

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           ++ ++++ P      + + ++G++ + VPQ+ ++ +  P
Sbjct: 177 ILGVQIALPVTAIIFLTDFALGIIARTVPQMNVFIVGLP 215


>gi|222112238|ref|YP_002554502.1| flagellar biosynthetic protein flir [Acidovorax ebreus TPSY]
 gi|221731682|gb|ACM34502.1| flagellar biosynthetic protein FliR [Acidovorax ebreus TPSY]
          Length = 247

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 94/205 (45%), Gaps = 12/205 (5%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P  SM  IP++ R+  A   ++     L +   +   +N    +  V+ ++ +G   G  
Sbjct: 22  PVFSMRVIPVRTRIGLAFLVAVCAQAVLPEQPVIS--LNSREAAGAVVQQVGIGLAMGFA 79

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           +R+    ++  G +I   +GLN  +    + +   + +    G I +L   VI+ H  V 
Sbjct: 80  VRLVFAAVELAGEIIGLQMGLNFASFFDPASNAQVSAVARFFGNISMLLFVVINGHLMVL 139

Query: 147 YALVKSYGTIPIGQELNFGNIFSSFVNML-----QTTFMIMLRLSSPFLFFYIVFNISIG 201
            A+VKS+ + P+G     GN   +   M       + F   L ++ P +   +  N+++G
Sbjct: 140 MAVVKSFDSFPVG-----GNFLQAIGQMRLHELGASLFSSALWIALPMIALLLFVNLTLG 194

Query: 202 LLNKLVPQIPIYFISTPYLIGLGSL 226
           +++++ PQ+ IY +  P  + +G L
Sbjct: 195 IISRVAPQMNIYAVGFPVTLTVGML 219


>gi|187933790|ref|YP_001885058.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum B str. Eklund 17B]
 gi|187721943|gb|ACD23164.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum B
           str. Eklund 17B]
          Length = 613

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 105/215 (48%), Gaps = 13/215 (6%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRAY 68
           ++LF I  R+ S  +++     +  P  ++   ++  SI +L  + + T+   N +N  Y
Sbjct: 8   LALFFIFLRLTSYFVIVNAFFQTGTPHILKGTLSLIISIAVLAGVDYSTV---NEINNVY 64

Query: 69  YS-----KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
           Y        VM  L LG +  ++  V    ++F GS +    G ++ + +  +     T 
Sbjct: 65  YLIIYGLNEVMTGLVLGFITNMIFEV----VKFAGSWMDIHAGFSMVSVLDPTSHSQTTL 120

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           + +   +I  +  +++D HH V   L++S+  +PIGQ L +     + ++ +   F++ +
Sbjct: 121 IGNFSYMIATVIFFIVDGHHIVIKLLIESFRIVPIGQTLVYQETMMAVISTITEYFVLGV 180

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +++ P +   ++ ++ +GL+++ VP IPI     P
Sbjct: 181 KIAVPIVLIIVITDLCLGLISRTVPTIPIMIFGLP 215


>gi|84624129|ref|YP_451501.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576797|ref|YP_001913726.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576989|ref|YP_001913918.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84368069|dbj|BAE69227.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188521249|gb|ACD59194.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521441|gb|ACD59386.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 257

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 89/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +A  S  +  EL
Sbjct: 21  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQAVLS--IAREL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 79  AIGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 128

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 129 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 185

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L+K  P +
Sbjct: 186 TLALPMMVAMLAVNLAFGALSKAAPAL 212


>gi|58582236|ref|YP_201252.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58426830|gb|AAW75867.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 263

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 89/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +A  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQAVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 85  AIGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 135 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L+K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALSKAAPAL 218


>gi|119899018|ref|YP_934231.1| flagellar biosynthesis protein FliR [Azoarcus sp. BH72]
 gi|119671431|emb|CAL95344.1| flagellar biosynthesis protein FliR [Azoarcus sp. BH72]
          Length = 270

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 87/178 (48%), Gaps = 7/178 (3%)

Query: 72  LVMVE-LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIG 129
           LVMV+ +F+G   G +IR+    +   GS+I   +GL+        D+  +T  L+  + 
Sbjct: 73  LVMVQQMFIGIAIGFMIRIVFAAIDMAGSLIGMQMGLSFAVFFD-PDAGGQTAVLSDFLS 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++  L    I+ H  +  AL++S+  +PIG  +   + ++         F   L LS P 
Sbjct: 132 LVATLLFLSINGHLMLVAALIRSFEWLPIGLNVVSASGWAYIARAGAAVFATGLLLSLPI 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE----IIVYQFSHSF 243
           +   +V NI++G+L +  PQ+ ++ I  P  + +G + L L +     ++V  F H F
Sbjct: 192 VAVLLVANIALGILTRAAPQLNLFAIGFPVTLAMGFMGLILIMTNFGPVVVSLFEHGF 249


>gi|114566402|ref|YP_753556.1| flagellar biosynthetic protein FliR [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337337|gb|ABI68185.1| flagellar biosynthetic protein FliR [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 253

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 93/209 (44%), Gaps = 3/209 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S F ++ R+    +  P  S   +P +VR    +  +  L  F+      +N      + 
Sbjct: 7   SFFFLLARLSGLFITAPIFSSRMMPGRVRALIVIMLAATLAYFVPVEYS-RNINTPGLFI 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
             + VE+F+G   G +I      +Q +G ++   +G ++   +    S  + PL  +   
Sbjct: 66  AALAVEIFIGYTIGFVIYAVLATIQLSGQLMDMLMGFSIVNVVD-PQSGTQIPLMGNFTQ 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            + LL    ID HH +  AL +SY  +P+      G      V +    F++ +++++P 
Sbjct: 125 ALALLTYLAIDGHHYLLQALAQSYAIVPVMSAHLPGGFLELLVEVGTYIFVVAVKIAAPM 184

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           L   +  ++++G + + VPQ+ ++ +  P
Sbjct: 185 LVAILTSDVAMGFIARTVPQMNVFLVGLP 213


>gi|312884813|ref|ZP_07744505.1| putative flagellar biosynthetic protein FliR [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309367465|gb|EFP95025.1| putative flagellar biosynthetic protein FliR [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 258

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 111/227 (48%), Gaps = 9/227 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIV---LLPFLWDTIDLQNFVNRAYYSKLVM 74
           R+G+ ++ +P    S IP+ VR  FA+A  +V   L+P +   +DL +F   A   + V+
Sbjct: 21  RIGTALISMPFFGDSLIPVWVRSLFALAIVVVSASLMPAM-PKVDLISFSAIALALEQVL 79

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
             LF G +   L  V+T      G ++S  +GL +       + L+   L  L  I   L
Sbjct: 80  WGLFFGLILHFLFAVFTT----LGQIVSMQMGLGMAIMNDPVNGLSVPILGRLFLIFCTL 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               ++ H  +   LV+S+   P+G  L+  ++ ++ V+++   F   + L+ P +   +
Sbjct: 136 LFLSLEGHLIIIDVLVQSFVIWPVGSGLSALSL-TNLVHLMTWMFASSVALALPAIIAML 194

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + NIS G++N+  P + +Y +  P  + LG   + +SI  +  +++ 
Sbjct: 195 LANISFGVMNRAAPALNVYALGFPMTMLLGLFSILISISGVPDKYAE 241


>gi|167900655|ref|ZP_02487860.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei NCTC
           13177]
          Length = 260

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 97/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +P+  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFKLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|146307832|ref|YP_001188297.1| flagellar biosynthesis protein FliR [Pseudomonas mendocina ymp]
 gi|145576033|gb|ABP85565.1| flagellar biosynthetic protein FliR [Pseudomonas mendocina ymp]
          Length = 258

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 109/230 (47%), Gaps = 19/230 (8%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+ + +M++P +    +P +VRL  A+A S+VL+P L     +D  +  +     + V++
Sbjct: 22  RIAAMLMVMPIIGTQLVPNRVRLYLALAISVVLVPTLPPMPQVDALSLRSLLLILEQVLI 81

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
               G + G +++++       G +I+  +GL   + +  ++ ++   L   + ++  L 
Sbjct: 82  ----GAMFGFILQLFFHLFAVAGQIIAMQMGLGFASMVDPTNGVSVPVLGQFMLMLVTLL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              I+ H  V   L +S+ ++P GQ L  G+ +      L       L L+ P +   +V
Sbjct: 138 FLAINGHLVVLEVLAESFVSLPPGQGLMIGH-YWELAGKLGWVIGAGLLLTLPMVTALLV 196

Query: 196 FNISIGLLNKLVPQIPIYFISTP---------YLIGL---GSLFLCLSIE 233
            N++ G++ +  PQ+ I+ I  P         + IGL   GSLF  L+ E
Sbjct: 197 INLAFGVMTRAAPQLNIFSIGFPLTLAMGLVIFWIGLSDFGSLFQALASE 246


>gi|83721282|ref|YP_440592.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           E264]
 gi|83655107|gb|ABC39170.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           E264]
          Length = 260

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 96/209 (45%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + L P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVALAPVTGHRATPVRVKIGLAGFMALVVAPTLPPMPAATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAVEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF  LV S+  +PI  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAVLVDSFRLVPISADLLRAAGWQTLVAFGSAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|188588311|ref|YP_001920219.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum E3 str. Alaska E43]
 gi|188498592|gb|ACD51728.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum E3
           str. Alaska E43]
          Length = 610

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 105/215 (48%), Gaps = 13/215 (6%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRAY 68
           ++LF I  R+ S  +++     +  P  ++   ++  SI ++  + + T+   N +N  Y
Sbjct: 8   LALFFIFLRLTSYFVIVNAFFQTGTPHILKGALSLIISIAVIAGVDYSTV---NEINNVY 64

Query: 69  YS-----KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
           Y        VM  L LG +  ++  V    ++F GS +    G ++ + +  +     T 
Sbjct: 65  YLIIYGLNEVMTGLVLGFITNMIFEV----VKFAGSWMDIHAGFSMVSVLDPTSHTQSTL 120

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           + +   +I  +  +++D HH V   L++S+  +PIG+ L +     + ++ +   F++ +
Sbjct: 121 IGNFAYMIATVIFFIVDGHHIVIKLLIESFRIVPIGETLVYQETMMAVISTITEYFVLGV 180

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +++ P +   ++ ++ +GL+++ VP IPI     P
Sbjct: 181 KIAIPIVLIIVITDLCLGLISRTVPTIPIMIFGLP 215


>gi|167834872|ref|ZP_02461755.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           MSMB43]
          Length = 260

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 98/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P       P++V++  A   ++V+ P L     +  F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTGHRATPVRVKIGLAGFMALVVTPTLPPMPVVTVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHASGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +PI  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPISADLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI ++ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGVFQVGFPVTMLVGL 227


>gi|21242685|ref|NP_642267.1| flagellar biosynthetic protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21108158|gb|AAM36803.1| flagellar biosynthetic protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 257

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +A  S  +  EL
Sbjct: 21  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQAVLS--IAREL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 79  AVGASMGFMLKLMFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 128

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 129 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 185

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 186 TLALPMMVAMLAVNLAFGALAKAAPAL 212


>gi|126730128|ref|ZP_01745940.1| flagellar biosynthetic protein FliR [Sagittula stellata E-37]
 gi|126709508|gb|EBA08562.1| flagellar biosynthetic protein FliR [Sagittula stellata E-37]
          Length = 256

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 71/148 (47%), Gaps = 2/148 (1%)

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           + +  E   G   G+++R +   +Q  G++ + +  L+        D L    +  ++ +
Sbjct: 76  RALATETISGLFLGIMLRTFVFAIQTAGAIAAQSTSLSQLLGQAGMDPLPA--IGHILTM 133

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            GL  L    FH  V   +V SY  +P  +  N  +I  +    +  +F +   L++PF+
Sbjct: 134 AGLALLMATGFHVNVAAFIVLSYDILPFMEFPNAASIAEAGRARVAQSFGLAFSLAAPFV 193

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
              +++N+++G +NK +PQ+ + F+  P
Sbjct: 194 ILSVIYNLTLGAINKAMPQLMVAFVGAP 221


>gi|126442304|ref|YP_001057089.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 668]
 gi|126455304|ref|YP_001064319.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106a]
 gi|134281514|ref|ZP_01768222.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 305]
 gi|167717399|ref|ZP_02400635.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           DM98]
 gi|167813517|ref|ZP_02445197.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 91]
 gi|167843672|ref|ZP_02469180.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           B7210]
 gi|167892143|ref|ZP_02479545.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           7894]
 gi|167916914|ref|ZP_02504005.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           BCC215]
 gi|237814427|ref|YP_002898878.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           MSHR346]
 gi|242317745|ref|ZP_04816761.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106b]
 gi|254194718|ref|ZP_04901149.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei S13]
 gi|254298635|ref|ZP_04966086.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           406e]
 gi|126221797|gb|ABN85303.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 668]
 gi|126228946|gb|ABN92486.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106a]
 gi|134247181|gb|EBA47267.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 305]
 gi|157808738|gb|EDO85908.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           406e]
 gi|169651468|gb|EDS84161.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei S13]
 gi|237506029|gb|ACQ98347.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           MSHR346]
 gi|242140984|gb|EES27386.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106b]
          Length = 260

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 97/209 (46%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +P+  +L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|149928150|ref|ZP_01916396.1| Bacterial export protein, family 1 [Limnobacter sp. MED105]
 gi|149823135|gb|EDM82373.1| Bacterial export protein, family 1 [Limnobacter sp. MED105]
          Length = 254

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 106/229 (46%), Gaps = 9/229 (3%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EI + S      R+ + +   P      +  + R+  A   +I+++P L         ++
Sbjct: 10  EIWIASFLWPFIRILAILATAPVFDNRTVQRRTRVGLAALIAILMMPLL----PAPPVLS 65

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL- 124
            A    +++ ++ +G   G  +R+     +  G ++   +GL     +  +    +TPL 
Sbjct: 66  SAQAIPVLIQQILIGVAMGFSMRLVFAAFEMAGDLLGLQMGLAFAQFIDPARG-TQTPLI 124

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT-TFMIML 183
            S +G++ +L   VID H  V  A+V+S+  IPI   L   N  S  + M  +  FM+ L
Sbjct: 125 GSFLGVLAMLTFLVIDGHLLVIAAVVQSFELIPISANLAVVN--SQSIAMAGSIMFMLAL 182

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           ++S P +   ++ NI +G+L +  PQ+ +  I     IG+G   L +S+
Sbjct: 183 QISLPVMAAVLISNIVLGILARAAPQLNVMSIGFSITIGVGLWILWVSL 231


>gi|186477690|ref|YP_001859160.1| flagellar biosynthetic protein FliR [Burkholderia phymatum STM815]
 gi|184194149|gb|ACC72114.1| flagellar biosynthetic protein FliR [Burkholderia phymatum STM815]
          Length = 260

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/230 (19%), Positives = 104/230 (45%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P      +P +V++  A   ++++ P +        F  +  +  +++ +
Sbjct: 21  VRILALMATAPAFGDKSLPNRVKIGLAGFVTLIVAPTIGALPSATVFSAQGIW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    +Q  G +I  ++GL   T      + +   ++  + +I +L  
Sbjct: 79  FLIGAALGFTMQIVFGAVQAAGDIIGMSMGLGFATFFDPHAAGSTDVMSRYVYMIAILTF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H QV  ALV+++  +P+   +   N +   V    T     L LS P +   ++ 
Sbjct: 139 LALDGHLQVLSALVQTFQALPVSANVLGANGWRVLVGWGSTVVSAGLLLSLPIVTALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQ+ ++ +  P  +  G L + L +  ++  F+  F  G
Sbjct: 199 NLALGILNRAAPQVGVFQVGLPVTVITGLLLIQLMLPNMMPFFARVFESG 248


>gi|266621913|ref|ZP_06114848.1| putative flagellar protein [Clostridium hathewayi DSM 13479]
 gi|288866386|gb|EFC98684.1| putative flagellar protein [Clostridium hathewayi DSM 13479]
          Length = 260

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 98/205 (47%), Gaps = 3/205 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLP-FLWDTIDLQNFVNRAYYSKL 72
           L+  R+G  I + P  +   IP  V+    +  S+V+ P  +  +  +Q + +    ++ 
Sbjct: 14  LVFARMGGLIFVHPVFARRGIPAMVKTGLVLTLSLVIAPTAVQGSAAIQAY-STFQMAEA 72

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +M E+ +G V G + +++   +   G ++ T  GL++   M  +  +    L   I +  
Sbjct: 73  LMREVIMGLVIGSVFQLFFYMIYAAGDLMDTVFGLSMGKIMDPAGGVQTAILGQFIHVFF 132

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L  +    H         +Y  IP+G   L   +I    V++  + F+++++L+ PF+ 
Sbjct: 133 FLYFFATGCHLLTVKLFAYTYEVIPVGAARLVTQDIAWYLVSIFGSVFLMVIKLALPFVA 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFIS 216
              V  +S+G+L KL+PQI ++ I+
Sbjct: 193 AEFVLEVSMGVLMKLIPQIHVFVIN 217


>gi|78777992|ref|YP_394307.1| flagellar biosynthesis protein FliR [Sulfurimonas denitrificans DSM
           1251]
 gi|78498532|gb|ABB45072.1| Flagellar biosynthesis protein FliR [Sulfurimonas denitrificans DSM
           1251]
          Length = 254

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 98/208 (47%), Gaps = 9/208 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL---LPFLWDTIDLQNFVNRAYYS 70
           L+  R  +  + +P  S + IP+ ++   A  F+IV    +P L   I + + V      
Sbjct: 17  LLFFRFAALFIAVPIFSHNNIPISIKTSLAFFFTIVFYSSMPPLTMVITVPSIVMA---- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             ++ EL  G   G+++++    + F G  IS  +G ++ +++     ++   ++  + +
Sbjct: 73  --ILSELLFGLAIGVILQIAFNAITFAGGQISFMMGFSMASAIDPQSGISMPIISQFLSL 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + L+ L+ ID HH +   +  S   IP+G  +   N+F+  +  +   F++   ++ P  
Sbjct: 131 MALMMLFAIDMHHWILLFIDSSLQNIPLGGFVMSENLFTYIIKAMSNMFLVGFMIAFPIT 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
              ++ +I  G+L K +PQ  +  I  P
Sbjct: 191 ALGLLADIIFGMLMKTMPQFNLLVIGFP 218


>gi|312792665|ref|YP_004025588.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179805|gb|ADQ39975.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 260

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 97/218 (44%), Gaps = 2/218 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL++ R+    +  P      IP   ++ FA   S++++     +  +    N   Y  +
Sbjct: 16  FLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSLLVVTTYRFSYSVP--ANLLEYIFV 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L +   +  
Sbjct: 74  VIKEFIVGLLIGYISYMVFSAILLAGQIIDNAIGFGMANVIDPMSEIQVPLLGNFFYLYM 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L+  +  D HH +  A+V SY  +PIG E        SF+      F+I + +S P L  
Sbjct: 134 LVVFFGTDAHHLLIRAVVYSYKLVPIGYESVKREAALSFLKFFSELFLIGVEISLPILMS 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            ++ +I + +L++ VPQ+ ++ +  P  I +G L L +
Sbjct: 194 MLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVI 231


>gi|118474587|ref|YP_892577.1| flagellar biosynthesis protein FliR [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118413813|gb|ABK82233.1| flagellar biosynthetic protein FliR [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 257

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 102/230 (44%), Gaps = 1/230 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           + FL++ R G+ ++  P  +   IP+ ++   +  F+I L P     + L+N ++  Y  
Sbjct: 14  TFFLLLVRTGALMVFFPFFNHMQIPVIIKAVLSFMFAIFLFPLAHAPVGLEN-LSVEYLI 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
                EL  G   G+L+ +    LQ  G  IS  +G ++ + +     +    +++++  
Sbjct: 73  LETFSELMFGMCAGVLLMLVFGALQLAGGQISMIMGFSMASVIDPQSGVNMPLISNMLNF 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           I LLA  + D HH V   +  S   IP+G      NI       +   F+    +S P L
Sbjct: 133 IVLLAFLLFDGHHIVLQFIAYSLQFIPLGGFYPDENIVKYTAKGVINLFLFGFIISFPIL 192

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
              ++ ++  G+L K +PQ  +  +  P  I +  + +   I  +V  F+
Sbjct: 193 ALSLLADLIFGMLMKTMPQFNLLVVGFPIKIAIAFVVIMAIISAMVKLFT 242


>gi|295111380|emb|CBL28130.1| Flagellar biosynthesis pathway, component FliR [Synergistetes
           bacterium SGP1]
          Length = 264

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 81/170 (47%), Gaps = 4/170 (2%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+ +G   G L  +  + L+  G  + T IG ++   +  +     + +  L  ++GL  
Sbjct: 79  EVLIGVALGFLSALPLVALRVAGEQVGTVIGFSMAQVLDPTTQTESSIIGQLEFLVGLWF 138

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            +  + H  +  A+++S    P+G+ L F          LQ  F++ +R++ PF    ++
Sbjct: 139 YYHWNGHLLMIQAVMESVRLAPVGRLLPFPPDLIEVGTWLQDLFILAMRITLPFFCSLVL 198

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLG----SLFLCLSIEIIVYQFSH 241
            ++ +G L + VPQ+ I+ +  P  + LG    +  L L++++I  QF  
Sbjct: 199 ADVGLGFLARTVPQMNIFVLGLPIKVALGFMVLAAVLPLTVDLIYTQFER 248


>gi|78047542|ref|YP_363717.1| flagellar biosynthesis pathway component FliR [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325925987|ref|ZP_08187353.1| flagellar biosynthetic protein FliR [Xanthomonas perforans 91-118]
 gi|78035972|emb|CAJ23663.1| flagellar biosynthesis pathway component FliR [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325543583|gb|EGD15000.1| flagellar biosynthetic protein FliR [Xanthomonas perforans 91-118]
          Length = 263

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +A  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQAVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 85  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 135 FYLGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|312876515|ref|ZP_07736498.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796726|gb|EFR13072.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 260

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 98/218 (44%), Gaps = 2/218 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL++ R+    +  P      IP   ++ FA   S++++     +  +    N   Y  +
Sbjct: 16  FLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSLLVVTTYRFSYSVP--ANLLEYIFV 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + +  
Sbjct: 74  VIKEFIVGLLIGYISYMIFSAILLAGQIIDNAIGFGMANVIDPMSEIQVPLLGNFLYLYM 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L+  +  D HH +  A+V SY  +P+G E        SF+      F+I + +S P L  
Sbjct: 134 LVVFFGTDAHHLLIRAVVYSYKLVPLGYESVKKEAALSFLKFFSELFLIGVEISLPILMS 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            ++ +I + +L++ VPQ+ ++ +  P  I +G L L +
Sbjct: 194 MLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVI 231


>gi|260893862|ref|YP_003239959.1| type III secretion system inner membrane R protein [Ammonifex
           degensii KC4]
 gi|260866003|gb|ACX53109.1| type III secretion system inner membrane R protein [Ammonifex
           degensii KC4]
          Length = 255

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 91/196 (46%), Gaps = 5/196 (2%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-ELFLGCVHGL 85
           P L++  +P+  RL  AM+ S+ + P L    D + F   A+   L    E  LG   G 
Sbjct: 27  PPLALPGLPVLWRLGVAMSLSLFVTPLL--PPD-RPFSGGAWEWALTWAGEFTLGLGMGF 83

Query: 86  LIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQV 145
           +  +    L+  G ++   +G  +   + +   + ET L     ++G +  +  D +  +
Sbjct: 84  VAGLVFQALRVAGQLMGLQMGFGMAELLTLG-GVPETMLAEFFFLLGTVLFFTTDAYQYL 142

Query: 146 FYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNK 205
             ALV+SY  +P+G     G      V ++       L+L++P L   ++ + S+GLL +
Sbjct: 143 IEALVRSYEVLPLGGAAVKGGAIWLTVKLVGGMLATALQLAAPVLAVTVLIDASLGLLVR 202

Query: 206 LVPQIPIYFISTPYLI 221
           +VPQI ++ +  P  I
Sbjct: 203 MVPQINVFMLGFPLKI 218


>gi|251779901|ref|ZP_04822821.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243084216|gb|EES50106.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 613

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 105/215 (48%), Gaps = 13/215 (6%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRAY 68
           ++LF I  R+ S  +++     +  P  ++   ++  SI ++  + + T+   N +N  Y
Sbjct: 8   LALFFIFLRLTSYFVIVNAFFQTGTPHILKGVLSLIISIAVIAGVDYSTV---NEINNVY 64

Query: 69  YS-----KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
           Y        VM  L LG +  ++  V    ++F GS +    G ++ + +  +     T 
Sbjct: 65  YLIIYGLNEVMTGLVLGFITNMIFEV----VKFAGSWMDIHAGFSMVSVLDPTSHTQSTL 120

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           + +   +I  +  +++D HH V   L++S+  +PIG+ L +     + ++ +   F++ +
Sbjct: 121 IGNFAYMIATVIFFIVDGHHIVIKLLIESFRIVPIGETLVYQETMMAVISTITDYFVLGV 180

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +++ P +   ++ ++ +GL+++ VP IPI     P
Sbjct: 181 KIAIPIVLIIVITDLCLGLISRTVPTIPIMIFGLP 215


>gi|294668047|ref|ZP_06733172.1| flagellar biosynthesis pathway component FliR [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292601886|gb|EFF45708.1| flagellar biosynthesis pathway component FliR [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 263

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +A  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRTVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQAVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 85  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 135 FYLGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 ALALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|308273531|emb|CBX30133.1| hypothetical protein N47_D29420 [uncultured Desulfobacterium sp.]
          Length = 260

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/223 (18%), Positives = 107/223 (47%), Gaps = 1/223 (0%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           I+ RVG  + L+P  +   IP+ V+    +  +++L P       +        +  L++
Sbjct: 17  ILIRVGVILFLMPFFNSRIIPVPVKAGLTIILAMILFPVSGPYTGVYPDTTWGMFG-LII 75

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            EL  G + GL+ + +  G++  G +    IG ++   +        + L+++  ++ ++
Sbjct: 76  GELITGMILGLMTQFFFEGIRMMGQIAGMEIGFSIANVLDPQSGFQTSILSNIAYLLAIV 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
              +++ H+ +  A+ +S+  I  G       +F   ++     F+I +++ +P +   +
Sbjct: 136 LFLILNGHYIILNAIRESFAIIQPGSVHLTQQVFKEMLHRSGEMFVIAIQIGAPVISAIL 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
              ++ GL+ +L+PQ+ +  ++ P  I  G +F  +S+ ++++
Sbjct: 196 FIQLAFGLITRLLPQMNVMVVAFPLQIVTGLIFFGISLWVMLH 238


>gi|89069812|ref|ZP_01157147.1| flagellar biosynthetic protein FliR [Oceanicola granulosus
           HTCC2516]
 gi|89044613|gb|EAR50729.1| flagellar biosynthetic protein FliR [Oceanicola granulosus
           HTCC2516]
          Length = 254

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 104/228 (45%), Gaps = 10/228 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV +   + P      +P+++RL  A+A ++V+LP +            A     ++ E 
Sbjct: 25  RVAAMAGVFPVFGEQSVPLRLRLAIALALTLVVLPAV-------PLAGGAPGLAALVGEP 77

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIGLLAL 136
            +G   GL +R+  + LQ  G++ + +   +L    G S  +   P +   + + GL   
Sbjct: 78  LVGLFFGLFLRLIVMALQIAGTIAAQST--SLSQIFGASAGIEPLPAMGHFLVVAGLALA 135

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            ++D H +    ++ +Y   P+        +    V  +   F     L++PFL   +++
Sbjct: 136 ALLDLHVRAAAYILLTYELAPVSTVPAAALVAEVGVAEVGRAFRFGFALAAPFLVASLLY 195

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           NI++G++N+ +PQ+ + F+  P +   G   L +S  I++  +S   L
Sbjct: 196 NITLGVINRAMPQLMVAFVGAPAITAGGLALLAISAPIMLAAWSDRLL 243


>gi|261344132|ref|ZP_05971776.1| flagellar biosynthetic protein FliR [Providencia rustigianii DSM
           4541]
 gi|282567724|gb|EFB73259.1| flagellar biosynthetic protein FliR [Providencia rustigianii DSM
           4541]
          Length = 259

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 80/164 (48%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +++ ++ +G   GL +++    ++  G VI   +GL+  T    +       L  +  +I
Sbjct: 73  VIVQQVVIGTAMGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRIFNLI 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            LL     D H  + Y L  S+  IPI       + F  F+    T F+  L L+ PF+ 
Sbjct: 133 TLLLFLSFDGHLWLIYILTNSFELIPIQTTPLNRDGFWIFLQFANTIFINGLMLALPFIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            +++ N+++G+LN++ PQ+ ++ +  P  + +G   L L I I+
Sbjct: 193 LFLILNLALGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISIL 236


>gi|224372500|ref|YP_002606872.1| flagellar biosynthesis protein FliR [Nautilia profundicola AmH]
 gi|223589960|gb|ACM93696.1| flagellar biosynthetic protein FliR [Nautilia profundicola AmH]
          Length = 255

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ S +  +P  + + IPM V+  FA   SI+L P    T      +N A     V
Sbjct: 17  LLFVRISSFLAFMPFFNYTAIPMNVKAAFAFWLSILLFPI---TPKFAYEINIATVLLSV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+      G+ +++    L++ G  IS  +G  L   M  +  +  T ++     + +
Sbjct: 74  LNEVAFAFFVGMALQMVFDVLKYAGEQISFVMGFTLANVMDPNAGVQTTIISQFFTWVAV 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           +        H     L K++  +P G+  ++ N++  F+  +   F++ + ++ P +   
Sbjct: 134 MMFLSFGGDHLEIMFLDKTFAMLPFGEFFSYHNVYEYFITYMSKYFLLGIAMAFPIIAIS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ +I  G++ K +PQ  +  +  P  I +  + L   I  ++  FS+  L
Sbjct: 194 LMGDIIFGMIMKTMPQFNLLVVGFPIKITISFMVLIAIIASLMQLFSNEIL 244


>gi|222530121|ref|YP_002574003.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312621586|ref|YP_004023199.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|222456968|gb|ACM61230.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312202053|gb|ADQ45380.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 260

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 101/219 (46%), Gaps = 4/219 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL++ R+    ++ P      IP   ++ FA   S++++     +    +  N   Y  +
Sbjct: 16  FLVLARMSGLFIVSPIFGRRNIPAYFKIGFAFFLSLLVVSTYRFSYSAPS--NLLEYIFV 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + +  
Sbjct: 74  VIKEFIVGLLIGYISYMIFSAILLAGQIIDNAIGFGMANVIDPMSEVQVPLLGNFLYLYM 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS-SFVNMLQTTFMIMLRLSSPFLF 191
           L+  +  D HH +  A++ SY  +PIG E  F   F+ +F       F+I + +S P L 
Sbjct: 134 LVVFFGTDAHHLLIRAVIYSYKLVPIGYE-GFRREFTWNFFRFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L +
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVI 231


>gi|160939624|ref|ZP_02086972.1| hypothetical protein CLOBOL_04516 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437415|gb|EDP15179.1| hypothetical protein CLOBOL_04516 [Clostridium bolteae ATCC
           BAA-613]
          Length = 259

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 99/227 (43%), Gaps = 19/227 (8%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLP---------FLWDTIDLQNFV 64
           L++ R+G  + + P  S   +P  VR    +A S+++ P           + T D+   +
Sbjct: 14  LVLARMGGLVFINPVFSRRGVPPMVRTGLVLALSLLIAPGVRSGAGQVMAFSTFDMVESL 73

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
            R         E+ LG V G +  ++   L   G  + T  GL +   M  +  +  + L
Sbjct: 74  IR---------EVILGLVIGCVFHIFFYMLYVAGDFLDTVFGLAMGKVMDPAGGVQTSIL 124

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIML 183
              + +   L  +    H  +      SY  +P+G   +  G I    + +  + F++++
Sbjct: 125 GQFVNVFFYLYFFATGCHLTMVRLFAYSYQVVPVGAGAILGGRILWYIITLFGSVFLMVI 184

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           +L  PF+    +  +++G+L KL+PQI ++ I+    I LG + + L
Sbjct: 185 KLVLPFVAAEFILEMTMGVLMKLIPQIHVFVINIQCKILLGIMLMML 231


>gi|89098626|ref|ZP_01171508.1| flagellar biosynthesis protein R [Bacillus sp. NRRL B-14911]
 gi|89086588|gb|EAR65707.1| flagellar biosynthesis protein R [Bacillus sp. NRRL B-14911]
          Length = 260

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 114/240 (47%), Gaps = 15/240 (6%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIP--MQVRLCFAMAFSIVLLPFLWDTIDLQNF-VNRA 67
           +  LI  RV S  +L+P  S   IP   ++ L F +A+ I      +   D   F +N A
Sbjct: 10  AFLLIFVRVTSFFLLMPLFSYRSIPNTHKIGLGFFLAWII------FYAADAPAFEINGA 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NS 126
           YY  L+M E  +G V G +  +    +Q  G +I   +G  +   +    + A++PL   
Sbjct: 64  YY-LLIMKEALVGLVIGFISYLILSAIQIAGGLIDFQMGFAIANVID-PQTGAQSPLMGQ 121

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGN--IFSSFVNMLQTTFMIML 183
            +  I L  L +++ HH +   +  SY  IP+ Q  + FG+  +    +    + F+   
Sbjct: 122 YLYTISLFFLLMVNGHHLLIDGIFYSYQAIPLDQPWIPFGDEGMAEYMLRAFNSMFISAF 181

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++S P +    + ++++G++ + VPQ+ ++ +  P  IG+  + L   + +++Y  S  F
Sbjct: 182 QMSVPVVGCLFLVDVALGIVARTVPQLNVFVVGIPLKIGVSFIVLVAVMSVLLYVVSQLF 241


>gi|323527704|ref|YP_004229857.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1001]
 gi|323384706|gb|ADX56797.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1001]
          Length = 260

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 95/202 (47%), Gaps = 2/202 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L    +P++V++  +   +I++ P L     +  F     +  +++ +
Sbjct: 21  VRILALVATAPVLGNRSLPLRVKIGLSAFVTIIVAPTLGALPQVTVFSAEGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  +   +GL   T      S +   L+S +  I +L  
Sbjct: 79  FLIGIALGVTMQIVFQAISATGDFVGLGMGLGFATFFDAQASSSSQVLSSYMYTIAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            VID H Q+  AL+ S+ ++P+   +     + +  N   T F   L LS P +   ++ 
Sbjct: 139 LVIDGHLQMISALLASFNSLPVSANILGSPGWRTLANFGSTIFSAGLLLSLPVVAALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTP 218
           N+++G+LN+  PQI ++ I  P
Sbjct: 199 NLALGILNRAAPQIGVFQIGFP 220


>gi|307731354|ref|YP_003908578.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1003]
 gi|307585889|gb|ADN59287.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1003]
          Length = 260

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 94/202 (46%), Gaps = 2/202 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L    +P++V++  A   +I++ P L     +  F     +  +++ +
Sbjct: 21  VRILALVATAPVLGNRSLPLRVKIGLAAFVTIIVAPTLGALPQVTVFSAEGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G+ +++    +  TG  +   +GL   T      S +   L+S +  I +L  
Sbjct: 79  FLIGVALGMTMQIVFQAISATGDFVGLGMGLGFATFFNAQASSSSQVLSSYMYTIAMLVF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            VID H Q+  AL+ S+ ++P+   +     + +      T F   L LS P +   ++ 
Sbjct: 139 LVIDGHLQMISALLASFSSLPVSANILGAPGWRTLAGFGSTIFSAGLLLSLPVVAALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTP 218
           N+++G+LN+  PQI ++ I  P
Sbjct: 199 NLALGILNRAAPQIGVFQIGFP 220


>gi|163781851|ref|ZP_02176851.1| flagellar biosynthetic protein FliR [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883071|gb|EDP76575.1| flagellar biosynthetic protein FliR [Hydrogenivirga sp. 128-5-R1-1]
          Length = 254

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 111/229 (48%), Gaps = 7/229 (3%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIP--MQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           ++++ L+  RV + + ++P     ++P  ++V L FA+A SI++    +  ++     + 
Sbjct: 9   LLTILLLFFRVFAFMFMVPMFGTFFLPNIIRVYLAFAVAASILM----FSDLEPLQISSA 64

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +SKL + E+  G + G  +R+    +   G VI+   GL     M +      T L  
Sbjct: 65  LEFSKLALQEVIFGFLSGFFLRLLFDTVFVAGEVIAVNTGLGFLM-MFLPQQPQTTVLAG 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++       +     V+  L +S+ ++PIG    +     +F+++   +F + ++L+
Sbjct: 124 FSTLMASTLFLAVGGAEAVYVGLAQSFNSVPIGSFDIYSMNGKAFLSLFYKSFSLGVKLA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            P L   ++ NI + ++N+ +PQI ++ +  P  + +G   L LS+ +I
Sbjct: 184 LPVLIAAMLTNIILAVINRFIPQINVFMVGLPLQVMVGLTVLLLSLPVI 232


>gi|257871303|ref|ZP_05650956.1| flagellar biosynthetic protein fliR [Enterococcus gallinarum EG2]
 gi|257805467|gb|EEV34289.1| flagellar biosynthetic protein fliR [Enterococcus gallinarum EG2]
          Length = 249

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI CR+ + ++L P  S    P   ++   MA +++ LP      +L  F+   +  K  
Sbjct: 9   LIFCRILAFVVLCPIFSQQNFPSLAKIVIGMALTVLCLPTAPAIPELSLFMMTVFVIK-- 66

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E+  G   G L ++   G++  G +I   +G ++  +   +  +A +        + +
Sbjct: 67  --EVLFGMAMGYLSQLVFTGVEIAGQLIDFQVGFSMAQAYDPTLQIASSQYGKTYYWLTI 124

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
              + +D HH++  AL+ S+  +P+G  +  G      V +     ++ + L++P +   
Sbjct: 125 AVFFGLDLHHRLITALLLSFRIVPLGSVVIQGTTVEGIVKLFSQMMVMAVNLAAPMIIAL 184

Query: 194 IVFNISIGLLNKLVPQIPIYFIS 216
           ++ ++ +G++++ +PQI I  +S
Sbjct: 185 LLVDLVLGVISRSIPQINILMMS 207


>gi|254499124|ref|ZP_05111814.1| putative flagellar biosynthesis pathway, component FliR [Legionella
           drancourtii LLAP12]
 gi|254351663|gb|EET10508.1| putative flagellar biosynthesis pathway, component FliR [Legionella
           drancourtii LLAP12]
          Length = 249

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 98/225 (43%), Gaps = 7/225 (3%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + SLF I  R+G+ ++  P  ++  +P+  RL      S++L  ++    +L N  N   
Sbjct: 8   LTSLFFITIRLGTVLLFTPIQAIRQLPIHARLILIFTLSMLLANYVPQKSELSN--NAIL 65

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +  L   E   G +    +       Q  G +I +  G N       S+   E   + L+
Sbjct: 66  FGGLA--EFANGLILATSLYAAFAIFQIAGQLIDSETGYNATAVFNPSEHSQEPLTSHLL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ +L  + +D H  +F  L  S+  IP G    F   F+  +      F +   ++SP
Sbjct: 124 SMLAVLFFFSLDGHQWLFKGLAYSFIIIPPGTLSLFAG-FTPVIKQFSFMFSMAFMIASP 182

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
            +   +  ++   L+ + +PQ+  YF++ P   L GL  LF+ L+
Sbjct: 183 IIIALLALDLCGALITRNMPQVSTYFLTLPIKILFGLFLLFMMLN 227


>gi|284041539|ref|YP_003391879.1| flagellar biosynthetic protein FliR [Conexibacter woesei DSM 14684]
 gi|283945760|gb|ADB48504.1| flagellar biosynthetic protein FliR [Conexibacter woesei DSM 14684]
          Length = 266

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 93/207 (44%), Gaps = 4/207 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY-SK 71
           FL++ RV    ++ P  +   +P + R   A+AF++ L P     +  Q     A+    
Sbjct: 24  FLVLARVSPLFLVAPMFNSRQVPARARTIVALAFALGLYPL---AVAGQTLPTEAFAIVG 80

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ E+ +G    L + V    +   G+++   +G     S+          L  +  ++
Sbjct: 81  LIVKEMLVGLAFALCVSVMFAAVDAAGTLLDFMVGFAFGGSLDPITGNQSAVLARVYSLV 140

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +     I+    +   + +++  +P+    +F +I    V +  T F   L +++P L 
Sbjct: 141 AVAIFIAINGDAWLIQGMSRTFDIVPLSASPDFASISQGVVAVFTTIFASALAVAAPVLI 200

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTP 218
             ++ +++ GL++++VPQ+ ++ +  P
Sbjct: 201 ACVLTDVAFGLVSRVVPQMNVFAVGFP 227


>gi|53717671|ref|YP_106657.1| flagellar biosynthetic protein [Burkholderia pseudomallei K96243]
 gi|76810974|ref|YP_331662.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710b]
 gi|167908875|ref|ZP_02495966.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 112]
 gi|254258615|ref|ZP_04949669.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710a]
 gi|52208085|emb|CAH34015.1| flagellar biosynthetic protein [Burkholderia pseudomallei K96243]
 gi|76580427|gb|ABA49902.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710b]
 gi|254217304|gb|EET06688.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710a]
          Length = 260

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 96/209 (45%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPIPVATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +P+   L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPVSANLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|167822059|ref|ZP_02453530.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 9]
 gi|226193326|ref|ZP_03788936.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           Pakistan 9]
 gi|225934926|gb|EEH30903.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           Pakistan 9]
          Length = 260

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 96/209 (45%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +P+   L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHVQVFAALVDSFRLVPVSANLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|330443948|ref|YP_004376934.1| YopT tranlocation T [Chlamydophila pecorum E58]
 gi|328807058|gb|AEB41231.1| YopT tranlocation T [Chlamydophila pecorum E58]
          Length = 289

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 104/227 (45%), Gaps = 13/227 (5%)

Query: 25  LLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           ++P L     P  +++   +++  ++ P +     + N+ N   +  L++ E+ +G V G
Sbjct: 45  IVPFLGAKLFPSPIKIGIGLSWLAIIFPKVLMDTRIANYTNEDLFYILLIKEMIIGIVIG 104

Query: 85  LLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            ++       Q  GS I+   G+  L+ S         +P          +A W +  H 
Sbjct: 105 FILAFPFYAAQSAGSFITNQQGIQGLEGSTSPISIEQTSPHGIFYHYFVTIAFWSLGGHR 164

Query: 144 QVFYALVKSYGTIPIGQELNF---------GNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            +F  L++S   IPI    NF           I+S+ + + Q + ++ ++LS+P     +
Sbjct: 165 IIFSLLLQSLEVIPIH---NFFPPQLMSLHAPIWSTLIKICQLSLIMTIQLSAPAALAML 221

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + ++ +G++N++ PQ+ + ++ +     +G LFL L+   I+ Q  +
Sbjct: 222 MSDLFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIIKQIDY 268


>gi|323490156|ref|ZP_08095376.1| flagellar biosynthesis protein FliR [Planococcus donghaensis
           MPA1U2]
 gi|323396204|gb|EGA89030.1| flagellar biosynthesis protein FliR [Planococcus donghaensis
           MPA1U2]
          Length = 259

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 115/234 (49%), Gaps = 20/234 (8%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFA--MAF-SIVLLPFLWDTIDLQNFVNRAYYS 70
           L++ R+ S  +L P  SM  +P Q ++  A  +AF ++  LP + +TI L +      Y 
Sbjct: 13  LMLVRLTSFFLLAPVFSMRGVPTQFKVGIAAFLAFVAVSTLP-IGETILLDS-----SYI 66

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG- 129
            L++ EL  G   G    +    +Q  G+ I   +G ++   +    + A+ P+   IG 
Sbjct: 67  LLIIKELATGLALGFTAALVLYTVQIAGAFIDFQMGFSMANVLD-PQTGAQVPI---IGH 122

Query: 130 ---IIGLLALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIML 183
              ++ LL L  ++ HH +   +++S    P+ +    +  G+I     ++    FMI L
Sbjct: 123 FKYMMALLFLLTVNGHHLMLDGVMQSLRVFPVERLAISVEAGDIAQFMTSLFVEMFMIAL 182

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
           +++ P +    + +I++G+L K VPQ+ I+ +  P  I +G + L L++ +  Y
Sbjct: 183 QIALPIVGALFLVDIALGILAKTVPQLNIFAVGLPLKIFVGFIMLFLTMPVFFY 236


>gi|311030113|ref|ZP_07708203.1| flagellar biosynthesis protein FliR [Bacillus sp. m3-13]
          Length = 258

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 104/236 (44%), Gaps = 7/236 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ RV +  + LP  S   +P   ++     F++V+      ++DL        Y 
Sbjct: 10  AFLLVLTRVTAFFVTLPLFSYRNVPSTFKVGLGFFFALVM----SFSLDLPIIGIDGTYI 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            LV+ EL +G + GL+  +    +Q  G  I   +G  +   +     +    +      
Sbjct: 66  LLVIKELMVGLLIGLVAYMVLSAIQIAGGFIDFQMGFAIANVIDPQTGIQSPIMGQFFYT 125

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQE---LNFGNIFSSFVNMLQTTFMIMLRLSS 187
             LL L  ++ HH +   +  SY  I + Q    L    +F   +  + T F+I L+L+ 
Sbjct: 126 FALLLLLAVNGHHLMMDGIFYSYEMIAVTQAWIPLGEAQVFEFVLKTINTMFVIALQLAI 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +    + ++++G++ + VPQ+ ++ +  P  IG+  + +  S+ I+   F   F
Sbjct: 186 PIVGVLFLVDVALGIVARTVPQLNVFVVGLPLKIGVSFITIIFSLTILFTLFYKLF 241


>gi|167560943|ref|ZP_02353859.1| flagellar biosynthetic protein FliR [Burkholderia oklahomensis
           EO147]
 gi|167568202|ref|ZP_02361076.1| flagellar biosynthetic protein FliR [Burkholderia oklahomensis
           C6786]
          Length = 260

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 96/209 (45%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P       P++V++  A   ++V+ P L     +  F  +  +  +++ +
Sbjct: 21  VRMLALVATAPVTGHRATPVRVKIGLAGFMALVVAPTLGPMPVVTVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  I +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHASGATPVMGRFLNAIAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +PI   L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPISAGLLRAPGWQTIVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|325917836|ref|ZP_08180015.1| flagellar biosynthetic protein FliR [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535947|gb|EGD07764.1| flagellar biosynthetic protein FliR [Xanthomonas vesicatoria ATCC
           35937]
          Length = 263

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   S+VL P L    +   F  +A  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLAGTLSMVLAPILPPVPEWDGFTAQAVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 85  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  +       +F  +  T F+ ++R   
Sbjct: 135 FYIGFGLLFFAANGHLAVISLLVDSYKALPIGTAIPDAR---AFAEVAPTLFLQIMRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|188496134|ref|ZP_03003404.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
 gi|188491333|gb|EDU66436.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
          Length = 261

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 99/212 (46%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  +  + P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTQNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|53724241|ref|YP_104208.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           23344]
 gi|67641566|ref|ZP_00440342.1| flagellar biosynthetic protein FliR [Burkholderia mallei GB8 horse
           4]
 gi|121598912|ref|YP_994548.1| flagellar biosynthetic protein FliR [Burkholderia mallei SAVP1]
 gi|124384712|ref|YP_001027836.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10229]
 gi|126448436|ref|YP_001082216.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10247]
 gi|167001621|ref|ZP_02267415.1| flagellar biosynthetic protein FliR [Burkholderia mallei PRL-20]
 gi|254175309|ref|ZP_04881970.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           10399]
 gi|254206623|ref|ZP_04912974.1| flagellar biosynthetic protein FliR [Burkholderia mallei JHU]
 gi|254357356|ref|ZP_04973630.1| flagellar biosynthetic protein FliR [Burkholderia mallei
           2002721280]
 gi|52427664|gb|AAU48257.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           23344]
 gi|121227722|gb|ABM50240.1| flagellar biosynthetic protein FliR [Burkholderia mallei SAVP1]
 gi|124292732|gb|ABN02001.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10229]
 gi|126241306|gb|ABO04399.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10247]
 gi|147752165|gb|EDK59231.1| flagellar biosynthetic protein FliR [Burkholderia mallei JHU]
 gi|148026420|gb|EDK84505.1| flagellar biosynthetic protein FliR [Burkholderia mallei
           2002721280]
 gi|160696354|gb|EDP86324.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           10399]
 gi|238522519|gb|EEP85963.1| flagellar biosynthetic protein FliR [Burkholderia mallei GB8 horse
           4]
 gi|243062631|gb|EES44817.1| flagellar biosynthetic protein FliR [Burkholderia mallei PRL-20]
          Length = 260

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 96/209 (45%), Gaps = 4/209 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P       P++V++  A   ++V+ P L        F  +  +  +++ +
Sbjct: 21  VRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQGVW--IIVNQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QVF ALV S+  +P+   L     + + V      F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVFAALVDSFRLVPVSANLLRAAGWQTLVAFGAAIFEMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPY--LIGL 223
           N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 NLALGILNRAAPQIGIFQVGFPVTMLVGL 227


>gi|24374728|ref|NP_718771.1| flagellar biosynthesis protein FliR [Shewanella oneidensis MR-1]
 gi|24349388|gb|AAN56215.1|AE015759_7 flagellar biosynthetic protein FliR [Shewanella oneidensis MR-1]
          Length = 265

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 112/235 (47%), Gaps = 24/235 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  A+A ++ + P L    D Q F   A +  ++ +++
Sbjct: 21  RVASMLMVMVVFGAATTPTRVRLLLAIAITLAIAPVLPPVKDAQLFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTQMVMQTFVL----TGQII------GMQTSLGFASMVDPSSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  L    +D H  +   LV S+ T+PI    N G   +S+ ++ +     F   L +S
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFDTLPIS---NVGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F  
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFDE 242


>gi|187478198|ref|YP_786222.1| flagellar biosynthetic protein [Bordetella avium 197N]
 gi|115422784|emb|CAJ49312.1| flagellar biosynthetic protein [Bordetella avium 197N]
          Length = 264

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 105/236 (44%), Gaps = 15/236 (6%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           I+  VGS     P  S S IP++V++  A   +  + P L         V+ + Y  L++
Sbjct: 23  ILALVGSA----PLFSESTIPVKVKIGLAFMLAAAIAPGL----PPMPSVSPSSYEGLLL 74

Query: 75  V--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  ++ +G   G  +RV    +Q  G  I   +GL+  +            L+  + I+ 
Sbjct: 75  LAQQVLIGVALGFTMRVVFSAVQTAGEYIGLQMGLSFASFFDPGTGANTAVLSRFMNILA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L    +D H  +  ALV+S+  +P+   +   N     V    T F+  L L+ P +  
Sbjct: 135 MLIFLALDGHLLMLAALVRSFDILPLTPAVLDRNGLGVLVQWGGTVFISGLLLALPLVCA 194

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
            +  N+++G+LN+  PQ+ ++ +  P ++ +G L L      +V   S  FL   F
Sbjct: 195 LLTINLAMGILNRAAPQLTVFAVGFPIMLTIGLLVLS-----VVLPHSGPFLEQLF 245


>gi|255305289|ref|ZP_05349461.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile ATCC 43255]
          Length = 604

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 85/167 (50%), Gaps = 3/167 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLL 134
           E   G + G +  +    ++  GS++   +GL++  +M   +S+ +T L N+L+    L+
Sbjct: 64  ETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSM-INMFDPNSMTQTTLINNLMNWTALM 122

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
             + +D HH +   +  S+  IPIG+     NI    +N+    F+   +++ P +   +
Sbjct: 123 IFFSMDGHHVLIRGIRYSFELIPIGKSFVDNNI-DYIINIFVQCFLTGFKIAIPIVLCLL 181

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  +GL+++ VPQ+ +  I  P  I +G     +SI +IV Q SH
Sbjct: 182 MADFILGLISRSVPQLNVMIIGMPLKILVGIALFIISIPLIVNQISH 228


>gi|167736441|ref|ZP_02409215.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 14]
          Length = 263

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 97/212 (45%), Gaps = 7/212 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV- 75
            R+ + + + P       P++V++  A   ++V+ P L         V   + ++ V + 
Sbjct: 21  VRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTL--PPMPPMPVATVFSAQGVWII 78

Query: 76  --ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             +  +G   G  +++    ++  G +I  ++GL   T      S A   +   +  + +
Sbjct: 79  VNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGRFLNAVAI 138

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           LA    D H QVF ALV S+  +P+  +L     + + V      F + L L+ P +   
Sbjct: 139 LAFLAFDGHLQVFAALVDSFRLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLALPVVAAL 198

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPY--LIGL 223
           ++ N+++G+LN+  PQI I+ +  P   L+GL
Sbjct: 199 LIANLALGILNRAAPQIGIFQVGFPVTMLVGL 230


>gi|306820133|ref|ZP_07453781.1| flagellar biosynthetic protein FliR [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551911|gb|EFM39854.1| flagellar biosynthetic protein FliR [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 260

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 102/223 (45%), Gaps = 3/223 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ RV   +++ P  S + IP  +++   M  S V+LPF+    ++   V+ + +  LV
Sbjct: 18  LILSRVLGIVIIAPMFSRNNIPAMLKVGLGMILSYVILPFVVPNTNID--VSSSEFIFLV 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + ELF G   GL + +        G+     IGL++      S     T    L  +   
Sbjct: 76  VKELFTGFCIGLCMALIFNIFMAAGANADINIGLSMSQIFDSSIGGNTTISGQLFNVFAF 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI-MLRLSSPFLFF 192
           L    +D HH +  A+V S+  +PI     +   F  F+  L    ++  + L  P +  
Sbjct: 136 LLFLSLDIHHLMIRAIVNSFEILPINTIDFYKEGFLDFLIRLNAYILVSSILLVVPIIIT 195

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
             + NI +  + K++PQ+ ++ +  P+ I +G +   LS+ ++
Sbjct: 196 LFLGNILLAFMAKVMPQMNVFIVGMPFKIIVGFVIFYLSLPMV 238


>gi|94314222|ref|YP_587431.1| flagellar biosynthetic protein FliR [Cupriavidus metallidurans
           CH34]
 gi|93358074|gb|ABF12162.1| flagellar biosynthetic protein FliR [Cupriavidus metallidurans
           CH34]
          Length = 261

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 92/208 (44%), Gaps = 10/208 (4%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK----LVMVELFLGCV 82
           P LS S IP ++++  A A SI++ P       + N      YS     +V+ E+ +G  
Sbjct: 31  PLLSESTIPRRLKILLAAALSIIISP------TIGNIPTVPVYSLDGLLIVLNEVGIGLS 84

Query: 83  HGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFH 142
            G  +R+    +Q  G VI   +GL+  +    +       L+  + ++ +L    +D H
Sbjct: 85  MGFAMRLVFAAVQMAGEVIGLQMGLSFASFYDRAAGGQTMVLSRFLNMVAMLLFLALDGH 144

Query: 143 HQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGL 202
             +  AL+ S+  +PI      G+ +          F     LS P +   +  N+++G+
Sbjct: 145 LMMLAALIDSFQGLPISGVPLSGHGWGVLARAGSMIFSAGTLLSLPMIAALLTMNLAMGI 204

Query: 203 LNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           LN+  PQ+ I+ +  P  +  G L L L
Sbjct: 205 LNRASPQLSIFAVGFPVTLLGGMLVLAL 232


>gi|257866392|ref|ZP_05646045.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC30]
 gi|257873092|ref|ZP_05652745.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC10]
 gi|257800350|gb|EEV29378.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC30]
 gi|257807256|gb|EEV36078.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC10]
          Length = 249

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 97/203 (47%), Gaps = 4/203 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI CR+ + ++L P  S    P   ++   MA +++ LP      +L  F+   +    V
Sbjct: 9   LIFCRILAFVVLCPIFSQKNFPSLAKIVIGMALTVLCLPTTPAIPELSLFMLTVF----V 64

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G   G L ++   G++  G +I   +G ++  +   +  +A +        + +
Sbjct: 65  IKEVLFGMAMGYLSQLVFTGVEIAGQLIDFQVGFSMAQAYDPTLQIASSQYGKTYYWLTI 124

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
              + +D HH++  AL+ S+  +P+G  +  G      V +     ++ + L++P +   
Sbjct: 125 AVFFGLDLHHRLITALLLSFRIVPLGSVVIQGTTVEGIVKLFSQMMVMAVNLAAPMIIAL 184

Query: 194 IVFNISIGLLNKLVPQIPIYFIS 216
           ++ ++ +G++++ +PQI I  +S
Sbjct: 185 LLVDLVLGVISRSIPQINILMMS 207


>gi|91792696|ref|YP_562347.1| flagellar biosynthesis protein FliR [Shewanella denitrificans
           OS217]
 gi|91714698|gb|ABE54624.1| flagellar biosynthetic protein FliR [Shewanella denitrificans
           OS217]
          Length = 267

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 109/233 (46%), Gaps = 20/233 (8%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ S +M++     +  P +VRL  A+AF+  + P L +  +++ F   A +  + + ++
Sbjct: 21  RISSMLMIMAVFGANTTPSRVRLMLAVAFTFAIAPVLPEIKNVELFAFSAVF--ITLQQI 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETPL-NSLIGII 131
            +G V G +  +       TG +I       +QTS+G +      S  +TP+  +   ++
Sbjct: 79  LIGAVMGFVTLMLMQTFVLTGQII------GMQTSLGFASMVDPGSGEQTPVVGNFFLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI---GQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             L    ID H  +F  +V S+ +IP+   G E+    I + +   +   F   L +S  
Sbjct: 133 ATLIFLSIDGHLLMFRMIVASFESIPVSNQGIEIANYKILAEWGGYM---FGAALTMSMS 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  I+  F  
Sbjct: 190 AIVALLLINLSFGVMTRAAPQLNIFSIGFPVTMVSGLLILWLTLGPIMAHFDE 242


>gi|166712020|ref|ZP_02243227.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 263

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +A  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQAVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 85  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 135 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTVLPDAG---AFAEVAPTLFLQILRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|58039958|ref|YP_191922.1| flagellar biosynthetic protein FliR [Gluconobacter oxydans 621H]
 gi|58002372|gb|AAW61266.1| Flagellar biosynthetic protein FliR [Gluconobacter oxydans 621H]
          Length = 284

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 111/224 (49%), Gaps = 18/224 (8%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY- 68
           ++  L++ R G+ +M++PGL    +PM +R   A+  +++LLP +   + +Q+ ++    
Sbjct: 29  LAFVLVLSRTGAVVMVMPGLGEQSMPMMIRAGCAITLTVLLLPLV-APLLMQDHLDALAP 87

Query: 69  --YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN--LQTSMGISDSLAETPL 124
                ++ VELF G + G + R+  + L   G +I+  +G++  LQ    +  S +  P 
Sbjct: 88  LGLCGMIAVELFAGILIGWMARLICMALPIAGQIIAVCMGISSVLQPDPDLG-SGSSAPA 146

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN----------FGNIFSSFVNM 174
              + ++  L L V   +     A++ SY  IP G  L            G+     + +
Sbjct: 147 R-FLNLLAPLVLLVTGAYILPVRAILGSYSIIPPGGALLAAASHAHWNLLGDSAQGIIQL 205

Query: 175 LQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            + +F + L LS+PFL   +V+   +G++ +L+P + IY  ++P
Sbjct: 206 TERSFALGLELSAPFLILSLVWQGMLGIMTRLLPTLQIYNAASP 249


>gi|257876005|ref|ZP_05655658.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC20]
 gi|325567517|ref|ZP_08144184.1| flagellar biosynthetic protein [Enterococcus casseliflavus ATCC
           12755]
 gi|257810171|gb|EEV38991.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC20]
 gi|325158950|gb|EGC71096.1| flagellar biosynthetic protein [Enterococcus casseliflavus ATCC
           12755]
          Length = 249

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 96/203 (47%), Gaps = 4/203 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI CR+ + ++L P  S    P   ++   MA +++ LP      +L  F+   +  K  
Sbjct: 9   LIFCRILAFVVLCPIFSQQNFPSLAKIVIGMALTVLCLPTAPAIPELSLFMLTVFVIK-- 66

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E+  G   G L ++   G++  G +I   +G ++  +   +  +A +        + +
Sbjct: 67  --EVLFGMAMGYLSQLVFTGVEIAGQLIDFQVGFSMAQAYDPTLQIASSQYGKTYYWLTI 124

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
              + +D HH++  AL+ S+  +P+G  +  G      V +     ++ + L++P +   
Sbjct: 125 AVFFGLDLHHRLITALLLSFRIVPLGSVVIQGTTVEGIVKLFSQMMVMAVNLAAPMIIAL 184

Query: 194 IVFNISIGLLNKLVPQIPIYFIS 216
           ++ ++ +G++++ +PQI I  +S
Sbjct: 185 LLVDLVLGVISRSIPQINILMMS 207


>gi|289578416|ref|YP_003477043.1| flagellar biosynthetic protein FliR [Thermoanaerobacter italicus
           Ab9]
 gi|297544692|ref|YP_003676994.1| flagellar biosynthetic protein FliR [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528129|gb|ADD02481.1| flagellar biosynthetic protein FliR [Thermoanaerobacter italicus
           Ab9]
 gi|296842467|gb|ADH60983.1| flagellar biosynthetic protein FliR [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 260

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 87/171 (50%), Gaps = 6/171 (3%)

Query: 57  TIDLQNFVNRAY-YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGI 115
           ++DLQ   N  + Y  +V+ E  +G V GL   +    +   G +I   +G  +   + I
Sbjct: 58  SVDLQT--NNVFDYFIVVISEFTVGLVIGLASMISFSAIHLAGQLIDYQLGFGIVNILDI 115

Query: 116 SDSLAETPL-NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVN 173
             S A+ PL  + I I+ +L   +++ H+ +F  L KS   IPIG+   N   +      
Sbjct: 116 H-SEAQVPLMGNFIYILTILIFMLMNGHYILFTMLAKSVDIIPIGEVAFNLSGMSQVMTK 174

Query: 174 MLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           M+   F++  R+S+P +   ++ ++ +G++++ +PQ+ ++ I  P  I +G
Sbjct: 175 MVSDMFILGFRISAPIILTTLLSDLVLGIISRTIPQLNVFMIGMPAKIFVG 225


>gi|82702486|ref|YP_412052.1| flagellar biosynthetic protein FliR [Nitrosospira multiformis ATCC
           25196]
 gi|82410551|gb|ABB74660.1| flagellar biosynthetic protein FliR [Nitrosospira multiformis ATCC
           25196]
          Length = 260

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 106/227 (46%), Gaps = 10/227 (4%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++S F    R+ + + + P L    +P++V++   +  ++V+ P    T++    +  A 
Sbjct: 13  LISFFWPAARILALLSVAPVLGNLAVPVRVKVGLGVLVALVVAP----TLESVPKIELAS 68

Query: 69  YSKLVMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
              L+++  ++ +G   G  +R+    ++  G +    +GL   T        +   L  
Sbjct: 69  APGLLVLGQQIMIGLAMGFAMRIIFSAIELAGEIAGLQMGLGFATFFTPHSDGSSLVLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNI-FSSFVNMLQTTFMIMLRL 185
            +G++G LA    + H  +  AL+ S+   PI  E  F N+ +          F + L+L
Sbjct: 129 FLGLLGTLAFLSFNGHLLMLSALIDSFNAFPISTE-PFSNMGWKRLAEWGSVIFSVGLQL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
           + P +   ++ N+++G+L +  PQ+ I+ +  P   +IG+ +L L L
Sbjct: 188 ALPVVAALLIVNLALGILTRASPQLNIFAVGFPITLMIGMSALMLSL 234


>gi|289670561|ref|ZP_06491636.1| flagellar biosynthetic protein FliR [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 257

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  ++  S  +  EL
Sbjct: 21  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQSVLS--IAREL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 79  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 128

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 129 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 185

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 186 TLALPMMVAMLAVNLAFGALAKAAPAL 212


>gi|87119471|ref|ZP_01075368.1| flagellar biosynthesis protein [Marinomonas sp. MED121]
 gi|86164947|gb|EAQ66215.1| flagellar biosynthesis protein [Marinomonas sp. MED121]
          Length = 260

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 97/217 (44%), Gaps = 6/217 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-RAYYSKLVMVE 76
           R+G+ ++ LP      +  ++R+ FA   +I++ P    ++ + ++     Y+  L+  +
Sbjct: 22  RIGAFLLALPLFGTQLVSTRIRIAFAFVIAIIVTP----SVPVPSYDPVSPYFVLLIAEQ 77

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G V G ++ V        G + +   GL    S   ++ ++   L      +  LA 
Sbjct: 78  IIIGIVLGFVVSVLFQVFSLAGQLAAMKAGLGFAMSNDPANGISVATLGQYYLTMVGLAF 137

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            + D HH +F  LV+S+   PIG+  N    +   V +    F   L +  P     +V 
Sbjct: 138 LLTDGHHVMFEYLVESFDYWPIGEGFN-SEYYYDIVLLGGWMFEKALLMVLPLAIAVLVM 196

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
           N+S G++ K  PQ+ I+ +  P ++     F  + +E
Sbjct: 197 NLSFGVVAKASPQLNIFALGFPVIMLFSLFFFWIMLE 233


>gi|125973004|ref|YP_001036914.1| flagellar biosynthesis protein FliR [Clostridium thermocellum ATCC
           27405]
 gi|256004801|ref|ZP_05429776.1| flagellar biosynthetic protein FliR [Clostridium thermocellum DSM
           2360]
 gi|281417215|ref|ZP_06248235.1| flagellar biosynthetic protein FliR [Clostridium thermocellum JW20]
 gi|125713229|gb|ABN51721.1| type III secretion system inner membrane R protein [Clostridium
           thermocellum ATCC 27405]
 gi|255991251|gb|EEU01358.1| flagellar biosynthetic protein FliR [Clostridium thermocellum DSM
           2360]
 gi|281408617|gb|EFB38875.1| flagellar biosynthetic protein FliR [Clostridium thermocellum JW20]
 gi|316940760|gb|ADU74794.1| flagellar biosynthetic protein FliR [Clostridium thermocellum DSM
           1313]
          Length = 261

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 102/221 (46%), Gaps = 6/221 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN--FVNRAYYSK 71
           LI  R+    ++ P      IP   ++ F+   +++L+    +TI +Q   F N   Y  
Sbjct: 17  LIFVRMTGLFVIAPIFGSRNIPTYCKIGFSFMTALILV----NTIKVQELYFSNIYEYFI 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E  +G   G +  +    +   G  I   IG  +   +   +S   +  ++   ++
Sbjct: 73  LVLKEFLVGITLGYVAYMIFTAIYVAGQFIDMQIGFGVVNVIDPLNSTQVSITSNFYFLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L   +   H+ +  AL  SY  IP+G  +   ++ +  V +    F+I  ++S+P   
Sbjct: 133 CMLVFLICRGHYILIRALFASYNYIPVGTGVFGEDMVNDIVRVFGNIFLIAFKISAPITI 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
             ++  +++G+++K VPQ+ ++ +  P  I LG   + ++I
Sbjct: 193 SIMISEVALGIVSKTVPQLNVFMVGMPLKIILGLAVMVITI 233


>gi|254433171|ref|ZP_05046679.1| flagellar biosynthetic protein FliR [Nitrosococcus oceani AFC27]
 gi|207089504|gb|EDZ66775.1| flagellar biosynthetic protein FliR [Nitrosococcus oceani AFC27]
          Length = 262

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 100/212 (47%), Gaps = 11/212 (5%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
           CR+G+ +M +P      +P+++RL  A+A ++V+ P +  T      V       LVM +
Sbjct: 20  CRIGALLMAMPLFGSKVVPVRIRLVLALALTVVIAPVIPATSVAALSVEGGL---LVMQQ 76

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G    L++++        G +++T +GL   + M   + +A + ++ L  ++  L  
Sbjct: 77  FLIGFAMALVLQMVFQAFAIGGQIVATQMGLGFASLMDPQNGVAVSMVSQLYTVLITLVF 136

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQEL----NFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
             ++ H  V   L +S+  +P+G E      F  +  +   ML  + +I L    P +  
Sbjct: 137 LGLNGHLVVIQVLAESFYVLPLGVERASLGGFWQLAGAGSWMLAGSVLIAL----PAIGA 192

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             + N++ G++++  PQ+  + I  P  + LG
Sbjct: 193 LSLVNLTFGVMSRAAPQLNPFSIGFPLTLILG 224


>gi|254457578|ref|ZP_05071006.1| flagellar biosynthetic protein FliR [Campylobacterales bacterium GD
           1]
 gi|207086370|gb|EDZ63654.1| flagellar biosynthetic protein FliR [Campylobacterales bacterium GD
           1]
          Length = 255

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 92/205 (44%), Gaps = 3/205 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R  +  M  P  S   IPM ++   A  F+IV   F      LQ  +N       +
Sbjct: 18  LLFFRFAALFMAAPIFSHKNIPMTIKTSMAFFFTIV---FYSSMPPLQIDINVPTVVLAI 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + EL  G   G+++ +    + F G  IS  +G ++ +++     ++   ++  + ++GL
Sbjct: 75  LSELLFGLAIGVVLLLAYNVITFAGGQISFMMGFSMASAIDPQTGVSMPIISQFLSLMGL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + L  ID HH +   +  S   IP+G  L   ++F+  +      F++   ++ P +   
Sbjct: 135 MILLAIDLHHWLLLFIDGSLSAIPLGGFLLTEDLFNYMIKATSNMFIVGFMIAFPIIALS 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTP 218
            + ++  G+L K +PQ  +  I  P
Sbjct: 195 WLADVIFGMLMKTMPQFNLLVIGFP 219


>gi|289666113|ref|ZP_06487694.1| flagellar biosynthetic protein FliR [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 263

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  ++  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQSVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++++        G ++S + GL+      +SD     P+  +    G++A W
Sbjct: 85  AVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQ---MSD-----PMRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  L       +F  +  T F+ +LR   
Sbjct: 135 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAG---AFAEVAPTLFLQILRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|317048611|ref|YP_004116259.1| flagellar biosynthetic protein FliR [Pantoea sp. At-9b]
 gi|316950228|gb|ADU69703.1| flagellar biosynthetic protein FliR [Pantoea sp. At-9b]
          Length = 262

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 102/217 (47%), Gaps = 3/217 (1%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P LS   IP +V++  A+  + +L+P L   ++   F    ++  L++ ++ +G   GL 
Sbjct: 31  PVLSEKSIPNRVKIGLAVLTTWILMPLL-PPVETTLFTAAGFW--LLLQQILIGVGLGLT 87

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           ++     ++  G VI   +GL+  T       L    L  ++ ++ +L     + H  + 
Sbjct: 88  MQFAFGAVRMAGEVIGLQMGLSFATFFDPGSRLNMPVLARILDMLAMLLFLTFNGHLWLI 147

Query: 147 YALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKL 206
             LV S+ T+PI       N F + V      F+  + L+ P +   +  N+++GLLN++
Sbjct: 148 SMLVDSFHTMPISDHPLNANAFMALVKAAGLIFLNGMMLALPLIVLLLTLNMALGLLNRV 207

Query: 207 VPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            PQ+ ++ +  P  + +G L L L + ++     H F
Sbjct: 208 TPQLSVFVVGFPITLTVGILSLGLMMPLLAPFCEHLF 244


>gi|114332027|ref|YP_748249.1| flagellar biosynthetic protein FliR [Nitrosomonas eutropha C91]
 gi|114309041|gb|ABI60284.1| flagellar biosynthetic protein FliR [Nitrosomonas eutropha C91]
          Length = 266

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 104/231 (45%), Gaps = 6/231 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P L  S IP+QV+L  A+  +I++ P L     +           +++ +
Sbjct: 21  ARILALMTATPLLGSSSIPIQVKLGLAVLLTILIAPLLPPLPQIDP--GSGVGPIVLLQQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G   G  IR+    ++  G +    +GL   T      S     +    G++  L  
Sbjct: 79  IIIGLAMGFSIRIVFTAVEMAGEITGLQMGLGFATFFDPQQSGQVQLVGRFYGLLATLLF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             ID H QV   L +S+  +PIG +      F++ VN     F + L L+ P L   ++ 
Sbjct: 139 LAIDGHLQVIAVLAQSFTILPIGADGMNVTSFTTLVNWGAEIFTLGLHLALPVLAALLIT 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI----EIIVYQFSHSF 243
           N+++G+L +  PQ+ I+ +  P  +G+G L +  ++     ++   F  SF
Sbjct: 199 NLALGILTRAAPQLNIFAVGFPLTLGIGLLVMSWALPYFTPVLTQMFQESF 249


>gi|117923328|ref|YP_863945.1| flagellar biosynthetic protein FliR [Magnetococcus sp. MC-1]
 gi|117607084|gb|ABK42539.1| flagellar biosynthetic protein FliR [Magnetococcus sp. MC-1]
          Length = 266

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 114/239 (47%), Gaps = 14/239 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAY 68
            + LI+ R+    +  P  S +  P ++R+   +  +IV+ P +  W   +    V R  
Sbjct: 19  RMVLIMSRLSGLFLAAPFFSRNVGPKRIRVILLLWITIVIYPIVPPWPG-EGNGEVIRMV 77

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           ++ +V  E  +G + G++     + +Q  G++I   +GL++   M  +  + E  L +L+
Sbjct: 78  FTGVV--EFSMGIMIGMIAHWVLVSVQIAGTMIGFEMGLSMAMVMDPTSGVQEGVLANLL 135

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN-----IFSSFVNMLQTTFMIML 183
            + GL+   +++ HH +   L +S+ ++P+G  L  G      +    V+M +   ++  
Sbjct: 136 YLFGLMLFLLLNGHHWLLEGLARSFVSMPLGSPLPHGEPMITIVLQGIVHMFELALLLAA 195

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            + +     Y    + +GL+N+  PQI ++F++ P    +G L + L++ I   + +  
Sbjct: 196 PVVAAAKLLY----LGMGLINRASPQIQVFFLAMPVAQLMGFLIMGLTLSIFGQRLTRE 250


>gi|220932507|ref|YP_002509415.1| flagellar biosynthetic protein FliR [Halothermothrix orenii H 168]
 gi|219993817|gb|ACL70420.1| flagellar biosynthetic protein FliR [Halothermothrix orenii H 168]
          Length = 259

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 100/232 (43%), Gaps = 5/232 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-DTIDLQNFVNRAYYSKL 72
           LI+ R     ++ P       P++V++  A+  + + LP +   T++L            
Sbjct: 16  LIMFRYLGLFLIAPVFGSRVYPVRVKVSLALMLTFITLPLIGGQTVELPQQTVGILLD-- 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G +  +    +Q  G  I   +G  +   M     +    +     I+ 
Sbjct: 74  VIRESLIGFIIGYIFYLVFASIQLAGQFIDVRMGFAIANVMDPISGVTAPVVGQFKNIMA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTTFMIMLRLSSPFLF 191
           +L    I+ HH +   L +S+  IP+ + L  G  +F+         F+I  +++ P + 
Sbjct: 134 ILVFLAINGHHLLLEGLYRSFQIIPL-RGLTLGSEVFNLLFRTTGNMFIIAFKIALPVMG 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              + ++  G L + VPQ+ I+ I  P  I +G + L LS+ + VY F   F
Sbjct: 193 TLFIADVVFGFLARTVPQMNIFIIGLPMKILIGFIMLILSLGVAVYFFQDLF 244


>gi|15596645|ref|NP_250139.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa PAO1]
 gi|9947399|gb|AAG04837.1|AE004574_8 flagellar biosynthetic protein FliR [Pseudomonas aeruginosa PAO1]
          Length = 258

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 105/223 (47%), Gaps = 3/223 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + +M +P +    +P++VRL  A+   +VL+P L     +     +A    L+  ++
Sbjct: 22  RVAALLMTMPVIGTQLVPVRVRLYLALGVCVVLVPNLPSMPQVDALSMKAML--LIGEQI 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + G  +++        G +IS  +GL   + +  ++ ++   L     ++  L   
Sbjct: 80  LVGALLGFSLQLLFHAFVIAGQIISMQMGLGFASMVDPANGVSVPVLGQFFTMLVTLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  VF  + +S+ T+P+G+ L+ GN F      L       L L+ P +   +V N
Sbjct: 140 AMNGHLVVFEVIAESFVTLPVGEGLS-GNHFWIIAGKLGWVMGAALLLALPAITALLVVN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           ++ G + +  PQ+ I+ I  P  + LG + L +    ++ Q+ 
Sbjct: 199 LAFGAMTRAAPQLNIFSIGFPLTLVLGLVILWIGTADLLSQYQ 241


>gi|239628944|ref|ZP_04671975.1| bifunctional flagellar biosynthesis protein FliR/FlhB
           [Clostridiales bacterium 1_7_47_FAA]
 gi|239519090|gb|EEQ58956.1| bifunctional flagellar biosynthesis protein FliR/FlhB
           [Clostridiales bacterium 1_7_47FAA]
          Length = 261

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 97/213 (45%), Gaps = 19/213 (8%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPF---------LWDTIDLQNFV 64
           L+  R+G  I + P  +   +P+ VR   A+A S+++ P          L+ T D+   +
Sbjct: 14  LVFARMGGMIFINPVFARKGVPLMVRTGLALALSLLIAPAARAGGQAVVLYSTFDMAEAL 73

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
            R         EL LG   G + +++   L   G ++ TA GL +   M   + +    L
Sbjct: 74  VR---------ELILGLGIGCVFQLFFYMLYVAGDLLDTAFGLAMGKVMDPMNGVQTAIL 124

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF-GNIFSSFVNMLQTTFMIML 183
              + I   L  +    H         +Y  IP+G  + F  N+    + M  T F++++
Sbjct: 125 GQFVNIFFFLYFFATGCHLLTVRLFAYTYEVIPVGAGVFFVRNVLWYIITMSATVFLMVI 184

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFIS 216
           +L+ PF+    V  +++G+L KL+PQI ++ I+
Sbjct: 185 KLALPFVAAEFVLEMTMGVLMKLIPQIHVFVIN 217


>gi|217033997|ref|ZP_03439419.1| hypothetical protein HP9810_891g1 [Helicobacter pylori 98-10]
 gi|216943505|gb|EEC22956.1| hypothetical protein HP9810_891g1 [Helicobacter pylori 98-10]
          Length = 255

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 93/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV S +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSSVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|217077043|ref|YP_002334759.1| flagellar biosynthetic protein FliR [Thermosipho africanus TCF52B]
 gi|217036896|gb|ACJ75418.1| flagellar biosynthetic protein FliR [Thermosipho africanus TCF52B]
          Length = 254

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 101/211 (47%), Gaps = 16/211 (7%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           +++ R+    ++ P LS +++P  VR    +A S + LP + + I L   V     S  +
Sbjct: 16  MLISRLTGMFLITPLLSAAFVPTTVRAFLVLALSYMSLPQV-NPIPLDTPVITIVLS--L 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIG 132
           +    +G   GLL           G ++    G  L T+M    ++ ETP+   LI ++ 
Sbjct: 73  LNNFLIGFAIGLLAYFIFGAFSIAGELLGIESGFGLATAM--DPTMEETPIVGQLIFLLS 130

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFM----IMLRLSS 187
           +     ++ H  V+  +V S  T P+   +L+F     S V  ++T F+    I L++  
Sbjct: 131 IFVFISLNGHMVVYQGVVDSIKTFPLYLDKLDF-----SLVKFIETKFIEMFFIALKIGL 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           P + +  + N+ +G+L++LVPQ+ ++ +  P
Sbjct: 186 PVIGYMFIINVLLGILSRLVPQMNVFMVGIP 216


>gi|107100882|ref|ZP_01364800.1| hypothetical protein PaerPA_01001912 [Pseudomonas aeruginosa PACS2]
 gi|116049393|ref|YP_791804.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892679|ref|YP_002441548.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa LESB58]
 gi|254234547|ref|ZP_04927870.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa C3719]
 gi|254239798|ref|ZP_04933120.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 2192]
 gi|296390185|ref|ZP_06879660.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa PAb1]
 gi|313106447|ref|ZP_07792678.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 39016]
 gi|115584614|gb|ABJ10629.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166478|gb|EAZ51989.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa C3719]
 gi|126193176|gb|EAZ57239.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 2192]
 gi|218772907|emb|CAW28719.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa LESB58]
 gi|310879180|gb|EFQ37774.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 39016]
          Length = 258

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 105/223 (47%), Gaps = 3/223 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + +M +P +    +P++VRL  A+   +VL+P L     +     +A    L+  ++
Sbjct: 22  RVAALLMTMPVIGTQLVPVRVRLYLALGVCVVLVPNLPPMPQVDALSMKAML--LIGEQI 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + G  +++        G +IS  +GL   + +  ++ ++   L     ++  L   
Sbjct: 80  LVGALLGFSLQLLFHAFVIAGQIISMQMGLGFASMVDPANGVSVPVLGQFFTMLVTLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  VF  + +S+ T+P+G+ L+ GN F      L       L L+ P +   +V N
Sbjct: 140 AMNGHLVVFEVIAESFVTLPVGEGLS-GNHFWIIAGKLGWVMGAALLLALPAITALLVVN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           ++ G + +  PQ+ I+ I  P  + LG + L +    ++ Q+ 
Sbjct: 199 LAFGAMTRAAPQLNIFSIGFPLTLVLGLVILWIGTADLLSQYQ 241


>gi|291278827|ref|YP_003495662.1| flagellar biosynthetic protein FliR [Deferribacter desulfuricans
           SSM1]
 gi|290753529|dbj|BAI79906.1| flagellar biosynthetic protein FliR [Deferribacter desulfuricans
           SSM1]
          Length = 261

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 100/216 (46%), Gaps = 2/216 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++ FLIV RV   +   P      + +++RL F++  SI+++  +   I  QN V+   
Sbjct: 13  LLTFFLIVIRVSGILFTAPVFGSGVVDVRLRLFFSIIVSILIINNV-SIISFQN-VSTLL 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV+ EL +G   G+L R    G+QF G +I   +G  +   +    +   + +    
Sbjct: 71  LILLVIKELLIGIATGVLARFIFAGVQFGGQLIGFQMGFGVVNILDPQTNTQVSIIAQFQ 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+ +L    I  H  V  A+  S+  +P+ +       +   V    + F+  +++ +P
Sbjct: 131 NILMILIFLAIGGHLFVIKAISYSFTNVPLAKFTFSSEGYIFLVEKFGSIFLTAIKIIAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
                ++ ++ +G++ +LVPQ+ +  +  P  I  G
Sbjct: 191 VFVTLLLLHVVMGIMARLVPQMNVLIVGFPVQIAFG 226


>gi|188526977|ref|YP_001909664.1| flagellar biosynthesis protein FliR [Helicobacter pylori Shi470]
 gi|188143217|gb|ACD47634.1| flagellar biosynthesis protein FliR [Helicobacter pylori Shi470]
          Length = 255

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 100/236 (42%), Gaps = 11/236 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P L   ++ +I  G++ K  PQ  +  I  P  I +G + + L I  I+ +F   
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIISAIMGRFKEE 243


>gi|146296298|ref|YP_001180069.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409874|gb|ABP66878.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 260

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 66/138 (47%)

Query: 97  TGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTI 156
            G +I  AIG  +   +     +    L + + +  L+  +  D HH +  A+V SY  +
Sbjct: 98  AGQIIDNAIGFGIANVIDPMSEIQVPLLGNFLYLYMLVIFFATDAHHTLIRAVVYSYKVV 157

Query: 157 PIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFIS 216
           P+G       +   F+      F+I + +S P L   ++ +I +G+L++ VPQ+ ++ + 
Sbjct: 158 PLGYSNILPKLSQKFITFFIELFVIGIEISLPILMSMLIVDIILGILSRAVPQMNVFMVG 217

Query: 217 TPYLIGLGSLFLCLSIEI 234
            P  I +G + L + + I
Sbjct: 218 IPIKIAIGFVVLVIVLPI 235


>gi|300113615|ref|YP_003760190.1| flagellar biosynthetic protein FliR [Nitrosococcus watsonii C-113]
 gi|299539552|gb|ADJ27869.1| flagellar biosynthetic protein FliR [Nitrosococcus watsonii C-113]
          Length = 262

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 100/215 (46%), Gaps = 17/215 (7%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
           CR+G+ +M +P      +P+++RL  A+A ++V+ P +  T      V       LVM +
Sbjct: 20  CRIGALLMAMPLFGSKVVPVRIRLMLALALTVVIAPVIPATSVAALSVEGGL---LVMQQ 76

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G    L++++        G +++T +GL   + M   + +A + ++ L  I+  L  
Sbjct: 77  FLIGLAMTLVLQMVFQAFAIGGQIVATQMGLGFASLMDPQNGVAVSMISQLYTILITLVF 136

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVN-------MLQTTFMIMLRLSSPF 189
             ++ H  V   L +S+  +P+G E   G    SF         ML  + +I L    P 
Sbjct: 137 LGLNGHLVVIQVLAESFYILPLGVE---GASLGSFWQLAGGGSWMLAGSVLIAL----PA 189

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +    + N++ G++++  PQ+  + I  P  + LG
Sbjct: 190 IGALSLVNLTFGVMSRAAPQLNPFSIGFPLTLLLG 224


>gi|326796453|ref|YP_004314273.1| flagellar biosynthetic protein FliR [Marinomonas mediterranea
           MMB-1]
 gi|326547217|gb|ADZ92437.1| flagellar biosynthetic protein FliR [Marinomonas mediterranea
           MMB-1]
          Length = 260

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 95/216 (43%), Gaps = 8/216 (3%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-R 66
           I +S  L   RVG+ +M LP      + +QVR+ FA   SI + P     +D+ +F    
Sbjct: 12  ITISFLLPFFRVGAFLMALPLFGSRLVSVQVRILFAFVISIAITP----IVDIPSFDPIS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  +L  G V G +I +        G + +   GL    S   ++ +    +  
Sbjct: 68  VAFIPLIAEQLLAGFVMGFVITILFQAFSLAGQLAAMKAGLGFAMSNDPANGVTVATMGQ 127

Query: 127 -LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++G LA    + HH +F  +V+S+   PIG       ++   V +    F   L +
Sbjct: 128 YFLSMVG-LAFVGTNGHHVMFEFIVESFDYWPIGSGFALERLWDV-VQLGGWMFEKALLI 185

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
             P     ++ N+S G++ K  PQ+ I+ +  P ++
Sbjct: 186 VLPLTVAVLIMNVSFGVVAKASPQLNIFALGFPVIL 221


>gi|225569960|ref|ZP_03778985.1| hypothetical protein CLOHYLEM_06055 [Clostridium hylemonae DSM
           15053]
 gi|225161430|gb|EEG74049.1| hypothetical protein CLOHYLEM_06055 [Clostridium hylemonae DSM
           15053]
          Length = 257

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 104/214 (48%), Gaps = 6/214 (2%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF 63
           +PE ++ +L L+  R+   + L P L    IP   +   A+  ++V+ P        +  
Sbjct: 6   TPEFLVFTLVLM--RMSGFVFLNPILGRKNIPAVFKTGLALVLALVVYP--QAEPAGEEV 61

Query: 64  VNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
            +   Y+ L++ E  LG + G +++++ + + F GSVI   +GL++ T     +      
Sbjct: 62  TSAVVYAVLLLKEFALGYLLGFVMQLFDMVVSFAGSVIDFQMGLSMATVYDAQNGTQIAL 121

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIM 182
             +++ I  LL  + +D H  +   L+ S   +P    +L  G+   + + +     ++ 
Sbjct: 122 TGNILQIYYLLLFFAVDGHLALLKILMTSQDIVPYAALKLGTGSA-QAVLQIFTECVVLA 180

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFIS 216
           ++L+ P + F  +  ++ GLL +++PQI ++ +S
Sbjct: 181 VKLAFPIIAFEFLVEVATGLLMRIIPQINLFVMS 214


>gi|291613056|ref|YP_003523213.1| flagellar biosynthetic protein FliR [Sideroxydans lithotrophicus
           ES-1]
 gi|291583168|gb|ADE10826.1| flagellar biosynthetic protein FliR [Sideroxydans lithotrophicus
           ES-1]
          Length = 262

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 103/218 (47%), Gaps = 6/218 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV- 75
            R+ + I   P   +  +P ++++ FA+A +I++ P    T+D+   ++ A    L ++ 
Sbjct: 21  ARILALIASSPLYGIKEVPARIKVGFAIAITIIIAP----TLDIPANLDPASAQGLFVLV 76

Query: 76  -ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            ++  G + G  IR+  + ++  G +    +GL   +     ++     +   +GI+  L
Sbjct: 77  QQIVAGVIIGFSIRLIFVAVEMAGDLTGMQMGLGFASFYDPVNATFTPIVAQFLGILASL 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
           A    + H  +  AL  S+   PIG  +   + F +      + F   L+ S P +   +
Sbjct: 137 AFLAANGHLYLLVALADSFRDFPIGATVPSAHAFRTMAEWGGSLFSHALQFSLPLIGALL 196

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           + NI++G+L +  PQ+ I+ +  P  I +G + L L++
Sbjct: 197 ITNIALGILARSAPQLNIFAVGFPITIAVGFVTLWLTL 234


>gi|258514017|ref|YP_003190239.1| flagellar biosynthesis protein FliR [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777722|gb|ACV61616.1| flagellar biosynthetic protein FliR [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 255

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 105/226 (46%), Gaps = 7/226 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  R+ + +M  P      IP  +++ F++  + ++ P +  T           Y   
Sbjct: 11  FLVFIRITAFMMTAPFFEYRNIPNLLKIGFSLLLAGIVFPVI-KTSGFSVPGGVLGYILA 69

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           VM E  +G + GL+      G++  G +I   IG  +     + D L+E     +   + 
Sbjct: 70  VMAEAGVGLMLGLIASFIFHGIRMAGQLIDLQIGFAMAM---VFDPLSEMQTTIIARFLN 126

Query: 133 LLALWV---IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           LLAL     ++ H+ +  +LVKSY  +P+        +  + V      F +  ++S+P 
Sbjct: 127 LLALIFFLNVNGHYYLIESLVKSYDLVPLTAMAIKSGVVLTVVKFFSGMFALAFQISAPI 186

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           +   ++ ++S+G +++ VPQ+ ++ +  P  I +G L L + + ++
Sbjct: 187 IAVLVIIDLSLGFVSRTVPQLNVFMLGFPVKIVVGILTLSVVVPVL 232


>gi|193071154|ref|ZP_03052078.1| flagellar biosynthetic protein FliR [Escherichia coli E110019]
 gi|192955549|gb|EDV86028.1| flagellar biosynthetic protein FliR [Escherichia coli E110019]
          Length = 261

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 101/213 (47%), Gaps = 5/213 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS-K 71
           F  + RV + I   P LS   +P +V+L  AM  +  + P L    D+  F   ++++  
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSL-PANDVPVF---SFFTLW 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++
Sbjct: 73  LAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDML 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P + 
Sbjct: 133 ALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 193 LLLTQNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|154175030|ref|YP_001407663.1| flagellar biosynthesis protein FliR [Campylobacter curvus 525.92]
 gi|112803591|gb|EAU00935.1| flagellar biosynthetic protein FliR [Campylobacter curvus 525.92]
          Length = 253

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 84/211 (39%), Gaps = 5/211 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+   I+  P  S + IP+  R        IV  P         NF+        +
Sbjct: 17  LLFARLSGLIVFFPFYSYNQIPLTARTLLVFMLCIVFFPMSHAHEHAINFLFVE-----I 71

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E  LG   GL++ +    LQ  G  IS  +G ++ T +      +   + ++I  + L
Sbjct: 72  LSEAMLGLCAGLMLTIVFATLQMAGEQISMVMGFSMATVLDPQTGASSPVIANMINFLAL 131

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L   + D HH +      S   +P+G       + S  + +    FM    LS P +   
Sbjct: 132 LTFLMFDGHHLLLQFYAASLAHVPLGDFYPSAGVMSYALKIFANLFMFGFILSFPIIALS 191

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++ +   G+L K +PQ  +  +  P  I +G
Sbjct: 192 LLSDSIFGMLMKTMPQFNLLVVGYPIKITIG 222


>gi|224417781|ref|ZP_03655787.1| flagellar biosynthesis protein FliR [Helicobacter canadensis MIT
           98-5491]
 gi|253827123|ref|ZP_04870008.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313141324|ref|ZP_07803517.1| flagellar biosynthesis protein FliR [Helicobacter canadensis MIT
           98-5491]
 gi|253510529|gb|EES89188.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130355|gb|EFR47972.1| flagellar biosynthesis protein FliR [Helicobacter canadensis MIT
           98-5491]
          Length = 256

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 98/231 (42%), Gaps = 2/231 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R    I   P      I  Q++  F    +I+ LP L  T+   N     +    +
Sbjct: 17  LLLLRFAGIIAFFPFFENQLINTQIKGIFIFWLTILFLP-LVTTMPPSNLTILEFIIAGI 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E+ LG +    +++    + F G VIS A+GL +  +        +  +  L+ ++ L
Sbjct: 76  -TEIMLGFLASFALQIVFGMISFGGEVISFAMGLTIANAYDPVTGAQKPIVGQLLTLLAL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + +  +D+HH   Y + +S   IP+G  L   N     +      F+I L +S P +   
Sbjct: 135 MIVLALDYHHLFLYFVGESIKEIPLGGFLYSHNYIIYTIKAFSNLFLIGLTMSFPIIALI 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ +I  G++ K  PQ  +  I  P  I +    L + I  I+  F   FL
Sbjct: 195 LLSDIIFGMIMKAHPQFNLLAIGFPVKIAVAFAVLIVIIPAIMIHFKREFL 245


>gi|395392|emb|CAA52219.1| flagellar biosynthetic protein [Bacillus subtilis]
          Length = 259

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 111/235 (47%), Gaps = 12/235 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-RAYY 69
           +  L+  R+ +  + +P      +P   R+ FA   +++     + TID    +    +Y
Sbjct: 10  AFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVIC----FSTIDKPPSLEIDEHY 65

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLI 128
             L   E  +G   GL+  +    +Q  GS I   +G ++   +    + A++PL    I
Sbjct: 66  MLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVID-PQTGAQSPLIGQFI 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNI-FSSFV-NMLQTTFMIMLRL 185
             + LL +  ++ HH +   +  S+  I + Q   NFG+  F+ F+   L   F+I  ++
Sbjct: 125 YTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEQFAYFIAKSLNAMFIIAFQM 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
           S+P +    + ++++G++ + VPQ+ ++ +  P  I +    L +C+S+  +V +
Sbjct: 185 SAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVR 239


>gi|87307410|ref|ZP_01089555.1| probable flagellar biosynthetic protein fliR [Blastopirellula
           marina DSM 3645]
 gi|87290150|gb|EAQ82039.1| probable flagellar biosynthetic protein fliR [Blastopirellula
           marina DSM 3645]
          Length = 267

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 94/199 (47%), Gaps = 7/199 (3%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
           ++ RV   +   P    +Y P +V+   A+  S+++    W     + F    ++   ++
Sbjct: 20  VLTRVSGMLATAPMFGSNYAPAKVKAFLAVTISMMITGLFWG----EKFPQPDHWMSYLV 75

Query: 75  V---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           V   ELF+G   GL +R+   G+Q TG ++    GL++  +   +   +   L  L  ++
Sbjct: 76  VLGGELFIGISFGLGVRILFAGVQITGQMLGQIGGLSVADAFNPAFDESVPMLAVLFDMV 135

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +   + +  H  +  AL+ ++  +P G  L    +    V+ L  +FM+ ++ ++P   
Sbjct: 136 VVAMFFCLGGHRFMIGALLSTFADVPPGVGLASPEVVHVLVSTLSISFMLGVQAAAPGTV 195

Query: 192 FYIVFNISIGLLNKLVPQI 210
             ++  + +GL+++ +PQ+
Sbjct: 196 ALLIGVLVMGLISRTLPQL 214


>gi|170722842|ref|YP_001750530.1| flagellar biosynthesis protein FliR [Pseudomonas putida W619]
 gi|169760845|gb|ACA74161.1| flagellar biosynthetic protein FliR [Pseudomonas putida W619]
          Length = 258

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 109/228 (47%), Gaps = 15/228 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           RV + +M +P      +P ++RL  A+A ++V++P L     +D + L+  +       L
Sbjct: 22  RVTAVLMTMPIFGTRMLPARIRLYAAVAITVVIVPALPPLPEFDPLSLRGLL-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G + G  +++        G +I+  +G+   + +  ++ +    ++  + ++ 
Sbjct: 75  CGEQIIVGALFGFSLQLLFQAFVIAGQIIAIQMGMAFASMVDPANGVNVAVVSQFMTMLV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +   V++ H  VF  L +S+ T+P+G  L   N F      L   F   L L  P +  
Sbjct: 135 SVLFLVMNGHLVVFEVLTESFTTLPVGNALVV-NHFWEMAGRLSWVFGAGLLLILPAIAA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQ 238
            +V NI+ G++ +  PQ+ I+ I  P   ++G+G  ++ L+  +  YQ
Sbjct: 194 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIFWVGLADVLSHYQ 241


>gi|294339802|emb|CAZ88165.1| Flagellar biosynthetic protein FliR [Thiomonas sp. 3As]
          Length = 264

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 105/228 (46%), Gaps = 10/228 (4%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            RV + + L P  SM  +P  VR+  A+  ++ + P L     +Q     A+   L  + 
Sbjct: 21  VRVLAMLSLAPVFSMGSLPTMVRVGLAVLIAVAIAPALPAMPPVQFGTATAWMLLLQQLL 80

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +  G   GL + +    + F GSVI   +G+   T       +  T L S + ++ +L  
Sbjct: 81  V--GGAIGLSMTLILSAVMFAGSVIGLQMGMGFATLFDPVQGVQVTSLASFLNMVTMLLF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ----TTFMIMLRLSSPFLFF 192
             ++ H  +   + +S+  +P+    N G    ++  + Q      F + L L++P +  
Sbjct: 139 LAVNGHLILLAVIARSFTLLPVAP--NLGLAAQTWFTLAQQGGSAIFSLGLALAAPVIGV 196

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQ 238
            ++ N+ +G+L KL PQ+ ++ +  P  +++G  +L+L + +   V Q
Sbjct: 197 LLIANLGLGVLTKLAPQLNLFAVGFPMFFIMGFLALYLVMPVMQNVVQ 244


>gi|152987229|ref|YP_001349233.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa PA7]
 gi|150962387|gb|ABR84412.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa PA7]
          Length = 258

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 107/225 (47%), Gaps = 9/225 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           RV + +M +P +    +P++VRL  A+   +VL+P L     +D  +  +     + ++V
Sbjct: 22  RVAALLMTMPVIGTQLVPVRVRLYLALGICVVLVPNLPPMPQVDALSVKSMLLIGEQILV 81

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
              LG    LL   + +     G +IS  +GL   + +  ++ ++   L     ++  L 
Sbjct: 82  GALLGFSLQLLFHAFVI----AGQIISMQMGLGFASMVDPANGVSVPVLGQFFTMLVTLL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H  VF  + +S+ T+P+G+ L+ GN F      L       L L+ P +   +V
Sbjct: 138 FLAMNGHLVVFEVIAESFVTLPVGEGLS-GNHFWVIAGKLGWVMGAALLLALPAITALLV 196

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQ 238
            N++ G + +  PQ+ I+ I  P   ++GLG L++  +  +  YQ
Sbjct: 197 VNLAFGAMTRAAPQLNIFSIGFPLTLVLGLGILWIGTADLLGQYQ 241


>gi|149908780|ref|ZP_01897440.1| putative flagellar biosynthetic protein FliR [Moritella sp. PE36]
 gi|149808054|gb|EDM67995.1| putative flagellar biosynthetic protein FliR [Moritella sp. PE36]
          Length = 260

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 107/225 (47%), Gaps = 9/225 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R+ S + LLP    + I   VR+ FA+  +I++ P     + + + +N      +++   
Sbjct: 22  RIISALWLLPIFGDTRITPSVRILFALTLAILISP----VVPVVDNINPFSLGSIILALE 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS-LIGIIGLL 134
           ++  G   GL + +    ++  G ++S  +GL++   M    S   + +NS L+ I   L
Sbjct: 78  QILFGLFFGLSLTMLFTMMKLIGEILSMQMGLSMAV-MNDPSSGGSSHVNSHLLTIFATL 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
                + H  V   LV+S+ T PIG  +   NI    + ++   FM  L L+ P +   +
Sbjct: 137 LFLSFNGHLIVLDILVESFVTWPIGSSIYLLNI-DIILKLVSWMFMAALMLAMPAIVAML 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           + NI+ G++N+  P + +Y +  P  + LG + L L   +I  +F
Sbjct: 196 LVNITFGVMNRSAPSLNVYSLGFPMGMLLGIICLGLVFRVIPNRF 240


>gi|308063034|gb|ADO04921.1| flagellar biosynthesis protein FliR [Helicobacter pylori Sat464]
          Length = 255

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 100/236 (42%), Gaps = 11/236 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P L   ++ +I  G++ K  PQ  +  I  P  I +G + + L I  I+ +F   
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIISAIMGRFKEE 243


>gi|121592128|gb|ABD36818.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens]
          Length = 261

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 108/235 (45%), Gaps = 13/235 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVN 65
           S  L + RV S +M++P    + +P +VRL FA+A ++V+ P L        +DL   + 
Sbjct: 18  SFMLPLFRVASMLMVMPVFGTTLVPRRVRLYFALAITVVITPNLPPMPAVSPLDLSGLL- 76

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G V G  ++++       G +++  +G+   + +  ++ ++   + 
Sbjct: 77  ------LIGEQILVGAVLGFSLQLFFQAFAVAGQIVAIQMGMGFASMVDPANGVSVAVIG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  VF  L +S+ T+P+G  L     +      L       L L
Sbjct: 131 QFFTMLVTLLFLSMNGHLVVFEVLTESFTTLPVGGGLMTAQ-YWELAGKLGWVLGAALLL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG   + + +  I+ Q+ 
Sbjct: 190 VLPAVTALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGLFIVWVGLADILNQYQ 244


>gi|304438442|ref|ZP_07398382.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304368525|gb|EFM22210.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 260

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 95/206 (46%), Gaps = 2/206 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV    ++ P      I +  R+  A+A +I+L P +          N   +    
Sbjct: 16  LMLVRVSGIFLISPFFGSMNISIYFRVGTALAITILLFPVVDGLGTPYVPENVIMFGVTA 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + ELF+G + G +  +    +   G V+   +G  +   +  +       + S +  + +
Sbjct: 76  LGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAIVNVVDPTSGQQIPLIGSFLYNLAV 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           + L   + HH +  ALV+S+  +PI G E N  ++     N   T F+  ++++ P  F 
Sbjct: 136 IVLLATNGHHMILAALVESFRVVPIAGMEGNL-SLAMLIANFTGTIFLTGMKIAMPITFA 194

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP 218
            ++ N+ +G+L++ +PQ+ I+ +  P
Sbjct: 195 ILLTNVGLGILSRTMPQMNIFVVGIP 220


>gi|238916766|ref|YP_002930283.1| flagellar biosynthetic protein FliR [Eubacterium eligens ATCC
           27750]
 gi|238872126|gb|ACR71836.1| flagellar biosynthetic protein FliR [Eubacterium eligens ATCC
           27750]
          Length = 257

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 105/220 (47%), Gaps = 20/220 (9%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVNRAYYSKL 72
           LI+ R+ S +   P  +M+ +P +V++ F+   +I++     D +++    +    Y+ +
Sbjct: 15  LILIRLASFVFAAPFFNMANVPNRVKIGFSFCLTIMVYSLFPDMSVEYNGMIE---YAII 71

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E+ +G + G +       + F G +I   IG+++         L +      +GI+G
Sbjct: 72  VVEEIIVGILLGAVSSFCVQIIMFAGKIIDMDIGISMA-------QLYDPTTRMQVGIMG 124

Query: 133 -------LLALWVIDFHHQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTTFMIMLR 184
                  +L L +   H  +  A+V++Y  IPIG  + FG  I++  +  +   F+I  R
Sbjct: 125 NFYYYMMMLLLIISGMHQYLVSAIVETYRVIPIGG-VKFGAGIYTGIIGFVSDFFVIGFR 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++ P     ++ N  + +L K+ PQ+ ++ +     I +G
Sbjct: 184 IALPVFAAILMLNCVLAILAKVSPQMNMFVVGMQLKIFVG 223


>gi|157959921|ref|YP_001499955.1| flagellar biosynthetic protein FliR [Shewanella pealeana ATCC
           700345]
 gi|157844921|gb|ABV85420.1| flagellar biosynthetic protein FliR [Shewanella pealeana ATCC
           700345]
          Length = 259

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 104/242 (42%), Gaps = 27/242 (11%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSK 71
           CR+    M++P LS +YIP+ VR+  A+  S ++ P L      D I +Q  +       
Sbjct: 21  CRIMGAFMVMPFLSSTYIPVTVRILLALTLSALIAPMLPPLPEVDAISIQALL------- 73

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L + +L +G +  L + +    +   G ++S  +GL +      S   +   L     + 
Sbjct: 74  LAIEQLLVGFMMALFLTIMLYVMTQLGEMLSMQMGLAMAVMNDPSSGGSHPILGQWFLLY 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           G L   V+D H      LV S+   P+G  + F       +  +   F +   L+ P + 
Sbjct: 134 GTLVFLVLDGHLVAIGVLVDSFRLWPVGMGV-FDLPLMGLIGRISWLFAVSFMLAIPSIL 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLF------------LCLSIEIIVY 237
             ++ NI+ G+L++  P + ++ +  P   L+GL  +F            LCL     +Y
Sbjct: 193 AMLMVNITFGVLSRSAPSLNVFALGFPMSMLMGLLCVFFSFSGLPSRYSDLCLDALSAMY 252

Query: 238 QF 239
           QF
Sbjct: 253 QF 254


>gi|323178516|gb|EFZ64094.1| flagellar biosynthetic protein FliR [Escherichia coli 1180]
          Length = 251

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D I L + +       L
Sbjct: 13  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNSLI-------L 65

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 66  TMEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 125

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 126 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 181

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 182 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 210


>gi|304412526|ref|ZP_07394132.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|307307185|ref|ZP_07586923.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
 gi|304349168|gb|EFM13580.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|306910424|gb|EFN40855.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
          Length = 259

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 103/223 (46%), Gaps = 5/223 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           SL+   CR+    M++P L  SY+P  VR+  A++ + ++ P L     +      + + 
Sbjct: 15  SLWWPFCRIMGAFMIIPLLGNSYVPATVRIFLALSIAALIAPMLPPVPPVDALSLGSLF- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L + +L +G +  L + +    +   G+++S  +GL +      ++      L+  + I
Sbjct: 74  -LAVEQLLIGFMLALFLTILIHVMTMLGTIMSMQMGLAMAVMNDPANGDTNPILSEWLQI 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            G L    +D H      +V S+   PIG  + F       ++ +   F   L L+ P +
Sbjct: 133 FGTLIFLALDGHLVGLNIIVDSFRLWPIGNGI-FDLPLMGLISRMGWLFAASLMLAIPAV 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLS 231
              ++ NI+ G+L++  P + I+ +  P   L+GL  +FL LS
Sbjct: 192 LAMLMVNITFGVLSRAAPSLNIFSLGFPMTLLMGLICVFLSLS 234


>gi|312879605|ref|ZP_07739405.1| flagellar biosynthetic protein FliR [Aminomonas paucivorans DSM
           12260]
 gi|310782896|gb|EFQ23294.1| flagellar biosynthetic protein FliR [Aminomonas paucivorans DSM
           12260]
          Length = 259

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 99/212 (46%), Gaps = 9/212 (4%)

Query: 35  PMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGL 94
           P+ VR   AM  ++V+ P +  +     F +  +       E  +G   GL   +    L
Sbjct: 36  PLPVRFWTAMLLAVVVTPGVGLSYPGPLFAHWGFLFVAAGREFLIGVTLGLFAGLPLYAL 95

Query: 95  QFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG-LLALWVI---DFHHQVFYALV 150
           Q +G    T +GL + T     D ++ET + +LIG +  LL +W     + H  +  AL 
Sbjct: 96  QMSGFFEGTQMGLGIAT---FFDPMSETQV-ALIGQMKYLLGVWFFFHWNGHLLLIEALT 151

Query: 151 KSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQI 210
           +S   IP+ +    G     +   LQ  F++ L+++ P     ++ ++ +G + + VPQ+
Sbjct: 152 ESLRLIPLAKGTWGGGAAIPWGIWLQKLFVLSLQMALPLFGALLLADVGMGFVARTVPQM 211

Query: 211 PIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            ++ +  P  IGLG LF+ L++  +     HS
Sbjct: 212 NLFVLGIPLKIGLG-LFILLAVLPLTVDLFHS 242


>gi|146282914|ref|YP_001173067.1| flagellar biosynthesis protein FliR [Pseudomonas stutzeri A1501]
 gi|145571119|gb|ABP80225.1| flagellar biosynthetic protein FliR [Pseudomonas stutzeri A1501]
 gi|327481254|gb|AEA84564.1| flagellar biosynthesis protein FliR [Pseudomonas stutzeri DSM 4166]
          Length = 258

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 108/225 (48%), Gaps = 7/225 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+ + +M +P +    +P++VRL  A+A ++VL+P L     ++  +  +    ++ +++
Sbjct: 22  RIAALLMSMPLIGTQLVPVRVRLYLALAIALVLVPTLPPMPVVESLSLASLLLIAEQLLI 81

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            +  G V  L   V+ +    +G +++  +GL   + +  ++ ++   L     ++ +L 
Sbjct: 82  GVMFGFVLQLFFHVFIV----SGQLLAMQMGLGFASMVDPANGISVPVLGQFFNMLVILL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H  V   L +S+ T+P+G  L+  N F      L       L L  P +   +V
Sbjct: 138 FLSVNGHLVVLEILAESFVTLPVGGGLS-TNHFWEVAGKLGWVLGAGLLLVLPAITALLV 196

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            N++ GL+ +  PQ+ I+ I  P  + LG + + + +  I  Q+ 
Sbjct: 197 VNLAFGLMTRAAPQLNIFSIGFPLTLVLGLIIVWIGMADIFAQYQ 241


>gi|77463636|ref|YP_353140.1| flagellar protein FliR [Rhodobacter sphaeroides 2.4.1]
 gi|126462468|ref|YP_001043582.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17029]
 gi|332558492|ref|ZP_08412814.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides WS8N]
 gi|3435111|gb|AAC32324.1| flagellar protein FliR [Rhodobacter sphaeroides]
 gi|77388054|gb|ABA79239.1| Flagellar protein FliR [Rhodobacter sphaeroides 2.4.1]
 gi|126104132|gb|ABN76810.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17029]
 gi|332276204|gb|EGJ21519.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides WS8N]
          Length = 269

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 96/204 (47%), Gaps = 8/204 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK- 71
           F+   R+G+ ++  P     ++P+ VR+   +A  I+ LP L   ++L      A  +  
Sbjct: 23  FVASLRIGAFLIASPAFGGRFVPLPVRI---VATVILTLPVLGR-VELPPPEELASLAAI 78

Query: 72  -LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+M E+ +G   GL++ +        G  I++  GL     +  S    +TP+ + I  
Sbjct: 79  PLMMQEIAVGLSAGLVLTILFSAAALAGDRIASTAGLGFAAQIDPSAG-GQTPVVAQIFG 137

Query: 131 IGLLALW-VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + L  ++  +D H      L++SY ++P G     G    + +      F++ L++  P 
Sbjct: 138 LALTTVFLALDGHLTALDILLRSYESLPPGAPFAPGRFLEAGIGAGGRMFLLGLQIMMPV 197

Query: 190 LFFYIVFNISIGLLNKLVPQIPIY 213
           +   I+ N++IG++ +  PQ+ ++
Sbjct: 198 VAALILINVTIGIVTRSAPQLNVF 221


>gi|308068670|ref|YP_003870275.1| flagellar biosynthetic protein fliR [Paenibacillus polymyxa E681]
 gi|305857949|gb|ADM69737.1| Flagellar biosynthetic protein fliR [Paenibacillus polymyxa E681]
          Length = 261

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 103/237 (43%), Gaps = 13/237 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI CR+ S  ++ P  S   +P   ++  +  F  +++   + T   Q       Y  LV
Sbjct: 13  LIFCRITSFFVVAPIFSTRGVPNIFKVGIS-GFLALVVYLTYGT--HQQVPTDVAYVLLV 69

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL--AETPLNSLIGI- 130
             E+ +G + G    ++   +Q  GS I   +G  + +   + D +  A TPL       
Sbjct: 70  GREVLIGLLLGFTAYLFMTAIQTAGSFIDLQVGFGMAS---VFDPMTGASTPLTGNFKFA 126

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQE----LNFGNIFSSFVNMLQTTFMIMLRLS 186
           I +L    I+ HH +  A++ SY  +P+  +    L  G++    V     +FM+  +++
Sbjct: 127 IAVLFFLSINGHHHLLNAILYSYDWVPLTNDFFVKLYGGSVTEFLVRSFAESFMLAFQIA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +P +    + ++ +G L K  PQ  I+ I  P  I +G   L L +    + F   F
Sbjct: 187 APIVVATFLTDVGLGFLAKTAPQFNIFVIGVPLKIIVGLFMLLLLMPSFAFIFERLF 243


>gi|260866392|ref|YP_003232794.1| putative lateral flagellar export pore protein [Escherichia coli
           O111:H- str. 11128]
 gi|257762748|dbj|BAI34243.1| predicted lateral flagellar export pore protein [Escherichia coli
           O111:H- str. 11128]
          Length = 260

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D I L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TMEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|126176174|ref|YP_001052323.1| flagellar biosynthetic protein FliR [Shewanella baltica OS155]
 gi|125999379|gb|ABN63454.1| flagellar biosynthetic protein FliR [Shewanella baltica OS155]
          Length = 259

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 103/223 (46%), Gaps = 5/223 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           SL+   CR+    M++P L  SY+P  VR+  A++ + ++ P L     +      + + 
Sbjct: 15  SLWWPFCRIMGAFMIMPLLGNSYVPATVRIFLALSIAALIAPMLPPVPPVDALSLGSLF- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L + +L +G +  L + +    +   G+++S  +GL +      ++      L+  + I
Sbjct: 74  -LAVEQLLIGFMLALFLTILIHVMTMLGTIMSMQMGLAMAVMNDPANGDTNPILSEWLQI 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            G L    +D H      +V S+   PIG  + F       ++ +   F   L L+ P +
Sbjct: 133 FGTLIFLALDGHLVGLNIIVDSFRLWPIGNGI-FDLPLMGLISRMGWLFAASLMLAIPAV 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLS 231
              ++ NI+ G+L++  P + I+ +  P   L+GL  +FL LS
Sbjct: 192 LAMLMVNITFGVLSRAAPSLNIFSLGFPMTLLMGLICVFLSLS 234


>gi|302878287|ref|YP_003846851.1| flagellar biosynthetic protein FliR [Gallionella capsiferriformans
           ES-2]
 gi|302581076|gb|ADL55087.1| flagellar biosynthetic protein FliR [Gallionella capsiferriformans
           ES-2]
          Length = 260

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 107/229 (46%), Gaps = 5/229 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +I + +L   + R+ + I   P L    +P +V++  ++  +IV+ P L    D+     
Sbjct: 10  DIWLSTLLYPMVRLLAMISSAPILGNKQVPARVKIGLSVLMAIVIAPTLAPMPDIPL--- 66

Query: 66  RAYYSKLVMVE-LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
            +  S L+MV+ + +G   G  +R+    ++  G      +GL   +      + + T  
Sbjct: 67  GSPQSLLIMVQQIIIGVSMGFTMRIVFTAVEMAGEFSGLQMGLGFASFYNPQSASSSTVT 126

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
              +GII  LA   ++ H  +   + +S+ T+P+GQ +   + +++      T F   L+
Sbjct: 127 AQFMGIIATLAFLSMNGHLMLLALVTESFHTLPVGQMMATKSFYTA-AQWGATIFAYGLQ 185

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
           LS P L   ++ N+++G++ +   Q+  + I  P  + +G   L LS+ 
Sbjct: 186 LSMPLLAALLITNLALGIMTRAAQQLNPFAIGFPITLTVGFFVLSLSLP 234


>gi|238927447|ref|ZP_04659207.1| flagellar biosynthesis protein FliR [Selenomonas flueggei ATCC
           43531]
 gi|238884729|gb|EEQ48367.1| flagellar biosynthesis protein FliR [Selenomonas flueggei ATCC
           43531]
          Length = 260

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 97/208 (46%), Gaps = 6/208 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R     ++ P      IP+  R+  A++ ++VL P +          N   ++   
Sbjct: 16  LMLVRTSGIFLISPFFGSMNIPIFFRVGTALSMTVVLFPVVDGLGTPYVPENLIMFALTA 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + ELF+G + G +  +    +   G V+   +G  +   +  +       + S +  +  
Sbjct: 76  VGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAIVNVVDPTSGQQIPLIGSFLYNLAA 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFV--NMLQTTFMIMLRLSSPFL 190
           + L   + HH +  ALV+S+  +PI G E   GN+  + +  N   T F+  ++++ P  
Sbjct: 136 IILLATNGHHMILAALVESFRAVPIAGME---GNVSLALLIANFTGTIFLTGMKIAMPIT 192

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
           F  ++ N+ +G+L++ +PQ+ I+ +  P
Sbjct: 193 FAILLTNVGLGILSRTMPQMNIFVVGIP 220


>gi|308183969|ref|YP_003928102.1| flagellar biosynthesis protein FliR [Helicobacter pylori SJM180]
 gi|308059889|gb|ADO01785.1| flagellar biosynthesis protein FliR [Helicobacter pylori SJM180]
          Length = 255

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 100/236 (42%), Gaps = 11/236 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P L   ++ +I  G++ K  PQ  +  I  P  I +G + + L I  I+ +F   
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGVILIISAIMGRFKEE 243


>gi|254488003|ref|ZP_05101208.1| flagellar biosynthetic protein FliR [Roseobacter sp. GAI101]
 gi|214044872|gb|EEB85510.1| flagellar biosynthetic protein FliR [Roseobacter sp. GAI101]
          Length = 162

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 75/143 (52%), Gaps = 8/143 (5%)

Query: 92  LGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVI-DFHHQVFYALV 150
           + LQ TGS+ + +  L+ Q   G +  +   P    I +   LAL V    H +    L+
Sbjct: 1   MALQTTGSIAAQSTSLS-QILGGAA--VEPIPAMGYILVFAALALAVTAGLHVKAASLLI 57

Query: 151 KSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--LSSPFLFFYIVFNISIGLLNKLVP 208
            SY T+P+GQ  N  ++  S   + QT+  + L   L++PF+   +++N+++G +NK +P
Sbjct: 58  YSYDTLPMGQFPNPSDL--SEWGLAQTSHAMSLAFTLAAPFVILSLLYNLALGAINKAMP 115

Query: 209 QIPIYFISTPYLIGLGSLFLCLS 231
           Q+ + F+  P +   G   LC++
Sbjct: 116 QLMVAFVGAPVITAGGLFILCIA 138


>gi|296135633|ref|YP_003642875.1| flagellar biosynthetic protein FliR [Thiomonas intermedia K12]
 gi|295795755|gb|ADG30545.1| flagellar biosynthetic protein FliR [Thiomonas intermedia K12]
          Length = 266

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 105/227 (46%), Gaps = 10/227 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + + L P  SM  +P  VR+  A+  ++ + P L     +Q     A+   L  + +
Sbjct: 22  RVLAMLSLAPVFSMGSLPTMVRVGLAVLIAVAIAPALPAMPPVQFGTATAWMLLLQQLLV 81

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G   GL + +    + F GSVI   +G+   T       +  T L S + ++ +L   
Sbjct: 82  --GGAIGLSMTLILSAVMFAGSVIGLQMGMGFATLFDPVQGVQVTSLASFLNMVTMLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ----TTFMIMLRLSSPFLFFY 193
            ++ H  +   + +S+  +P+    N G    ++  + Q      F + L L++P +   
Sbjct: 140 AVNGHLILLAVIARSFTLLPVAP--NLGLAAQTWFTLAQQGGSAIFSLGLALAAPVIGVL 197

Query: 194 IVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQ 238
           ++ N+ +G+L KL PQ+ ++ +  P  +++G  +L+L + +   V Q
Sbjct: 198 LIANLGLGVLTKLAPQLNLFAVGFPMFFIMGFLALYLVMPVMQNVVQ 244


>gi|157165085|ref|YP_001467383.1| flagellar biosynthesis protein FliR [Campylobacter concisus 13826]
 gi|112801903|gb|EAT99247.1| flagellar biosynthetic protein FliR [Campylobacter concisus 13826]
          Length = 253

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 89/211 (42%), Gaps = 5/211 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+   I+  P  S + IP+ V+        +VL P    +   +N +N  +    +
Sbjct: 17  LLFARLSGLIVFFPFYSHNQIPLSVKTLLVFVLCVVLFPL---SKAHENSIN--FLVGEI 71

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ LG   GL++ +    LQ  G  IS  +G ++ + +          + +LI  I L
Sbjct: 72  LGEVMLGLSAGLMLTIIFATLQMAGEQISMVMGFSMASVLDPQTGTNSPVIANLINFIAL 131

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L     D HH +      S   +P+G       I S  +N+    FM    +S P +   
Sbjct: 132 LTFLAFDGHHLLLQFYASSLAVVPLGDFYPRPGIMSYAINLFTNLFMFGFIMSFPIIALS 191

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++ +   G+L K +PQ  +  I  P  + +G
Sbjct: 192 LLSDSIFGMLMKTMPQFNLLVIGYPIKVTIG 222


>gi|126697834|ref|YP_001086731.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile 630]
 gi|115249271|emb|CAJ67084.1| Bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile]
          Length = 604

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 85/167 (50%), Gaps = 3/167 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLL 134
           E   G + G +  +    ++  GS++   +GL++  +M   +S+ +T L ++L+    L+
Sbjct: 64  ETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSM-INMFDPNSMTQTTLIDNLMNWTALM 122

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
             + +D HH +   +  S+  IPIG+     NI    +N+    F+   +++ P +   +
Sbjct: 123 IFFSMDGHHVLIRGIRYSFELIPIGKPFVDNNI-DYIINIFVQCFLTGFKIAIPIVLCLL 181

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  +GL+++ VPQ+ +  +  P  I +G     +SI +IV Q SH
Sbjct: 182 MADFILGLISRSVPQLNVMIVGMPLKILVGIALFIISIPLIVNQISH 228


>gi|167585024|ref|ZP_02377412.1| flagellar biosynthetic protein FliR [Burkholderia ubonensis Bu]
          Length = 260

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 103/230 (44%), Gaps = 2/230 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + + + P    + +P +V++  A   ++V+ P L     +  F  +  +  +V+ +
Sbjct: 21  VRMLALVAVAPVTGHASVPGRVKIGVAAFMALVVAPTLGAMPAVTVFSAQGIW--IVVTQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G   G  +++     Q  G  I  ++GL   T      S A   +   +  + +LA 
Sbjct: 79  FLIGVAMGFTMQIVFAAAQAAGDAIGLSMGLGFATFFDPHASGATPVMGRFLNAVAILAF 138

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
              D H QV  AL  S+  +P+  EL     + +      T F + L L+ P +   ++ 
Sbjct: 139 LAFDGHLQVLAALAASFQALPVSAELLHAPGWRTLAAFGATVFQMGLLLALPVVAALLIA 198

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           N+++G+LN+  PQ+ I+ +  P  + +G L + L +  +V  F   F  G
Sbjct: 199 NLALGILNRAAPQVGIFQVGFPVTMLVGLLLVQLMVPNMVPFFGRLFDMG 248


>gi|294500922|ref|YP_003564622.1| flagellar biosynthetic protein FliR [Bacillus megaterium QM B1551]
 gi|294350859|gb|ADE71188.1| flagellar biosynthetic protein FliR [Bacillus megaterium QM B1551]
          Length = 258

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 102/216 (47%), Gaps = 17/216 (7%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ RV S  + +P  S   IP   ++  + + S+++      TIDL      A + 
Sbjct: 10  AFLLVLVRVTSFFITVPLFSYKTIPAVHKVGLSASLSVII----ATTIDLPVVSLDAQFV 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIG 129
            LV+ E  +G   GL   V+ + +Q  G +I   IG  +   +    + A++P L   + 
Sbjct: 66  LLVVKECAVGLFIGLTAYVFIMAIQIAGGLIDFQIGFAIANVID-PQTGAQSPILGQYLY 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTI-------PIGQELNFGNIFSSFVNMLQTTFMIM 182
           +  LL L   + HH +   +  SY  I       P+G +    +I + F +M    F++ 
Sbjct: 125 VFALLFLLSTNGHHLLIDGIYNSYLIIPLDKTAFPVGSQAFATHIITVFSSM----FLVA 180

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +++S P +    + +I++G++ + VPQ+ I+ +  P
Sbjct: 181 VQMSLPLVGSLFLVDIALGIVARTVPQLNIFVVGFP 216


>gi|308061462|gb|ADO03350.1| flagellar biosynthesis protein FliR [Helicobacter pylori Cuz20]
          Length = 255

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 93/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 VLLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFESALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|239997096|ref|ZP_04717620.1| flagellar biosynthesis protein FliR [Alteromonas macleodii ATCC
           27126]
          Length = 259

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 97/226 (42%), Gaps = 2/226 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+    + + GLS   IP QVR    +  +++++P +     ++N V+   +  +V+ +L
Sbjct: 21  RISGLFVAMIGLSAKSIPPQVRALLGIMLTLIIMPVV-PPSPIENLVDVGTF-LIVVQQL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G +  +        G VI+   GL   + +   + +    +     I+  L  W
Sbjct: 79  LIGIAIGFISMMVLNTFVLAGQVIAMQTGLGFASIVDPVNGINVPAVGQFYLILATLLFW 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            +D H  +   +V S+   PIG+    G  F    +     F+  + LS   +   ++ N
Sbjct: 139 TLDGHLSMIQMIVMSFEAFPIGEAWWTGEQFRDIAHWAGWMFISAVTLSLAPIVSLLIVN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++ G++ K  PQ+ I+ I       +G L + ++++     F   +
Sbjct: 199 LAFGVMTKAAPQLNIFSIGFSIAQVMGLLIIWITLDNFTAHFETQW 244


>gi|212637761|ref|YP_002314286.1| flagellar biosynthesis protein FliR [Shewanella piezotolerans WP3]
 gi|212559245|gb|ACJ31699.1| Flagellar biosynthesis protein FliR [Shewanella piezotolerans WP3]
          Length = 259

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 109/241 (45%), Gaps = 25/241 (10%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
           CR+    M++P L  SY+P+ VR+  A++ S+++ P L    ++     +A +  L + +
Sbjct: 21  CRIMGAFMVMPFLGSSYVPVMVRILLAISISVLIAPILPPFPEVDAISLQALF--LGIEQ 78

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG----IIG 132
           L +G +  L + +    +   G+++S  +GL    +M I +  A    N ++G    + G
Sbjct: 79  LLVGFMLALFLTIMIHVMSLVGAMMSMQMGL----AMAIMNDPANGGSNPILGQWFLLYG 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            L    +D H      LV S+   PIG  + F       +  +   F     L+ P +  
Sbjct: 135 TLLFLALDGHLVALGILVDSFRLWPIGMGV-FDLPLMGLIGRISWIFAASFMLALPAVLA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLF------------LCLSIEIIVYQ 238
            ++ N++ G+L++  P + ++ +  P   L+GL  +F            LCL     +YQ
Sbjct: 194 MLMVNVTFGVLSRAAPSLNVFALGFPMSMLMGLLCVFFSFSGLPSRYSDLCLDALSAMYQ 253

Query: 239 F 239
           F
Sbjct: 254 F 254


>gi|88800469|ref|ZP_01116033.1| flagellar biosynthesis protein [Reinekea sp. MED297]
 gi|88776799|gb|EAR08010.1| flagellar biosynthesis protein [Reinekea sp. MED297]
          Length = 263

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 96/209 (45%), Gaps = 18/209 (8%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-----TIDLQNFVNRAYYSKL 72
           R+G+  +++P L    IP++VRL  A   +  + P L D      +D+Q F+       +
Sbjct: 27  RLGAFFVIVPVLGARLIPVRVRLGLAFVITYTIYPLLPDMPIIEAVDVQTFM-------I 79

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ ++ +G   G L+ V        G  IS  +GL   + +  ++ ++   L+    ++ 
Sbjct: 80  ILEQILIGTTLGFLVFVILQIFILAGQTISMQMGLGFASMVDPANGVSVAVLSQWYQVLV 139

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQEL---NFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            L    I+ H      +V S+ T+P+GQ L       + S F   L   F   L L+ P 
Sbjct: 140 TLVYLAINGHLLTLEVVVDSFYTLPVGQGLFTVESWRLLSEFGAWL---FRASLMLALPA 196

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +   ++ N++ G++ +  PQ+ ++ +  P
Sbjct: 197 VTALLLVNLTFGVMTRAAPQLNVFALGFP 225


>gi|56964017|ref|YP_175748.1| flagellar biosynthesis protein FliR [Bacillus clausii KSM-K16]
 gi|56910260|dbj|BAD64787.1| flagellar biosynthetic protein FliR [Bacillus clausii KSM-K16]
          Length = 260

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 97/212 (45%), Gaps = 9/212 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  LI  RV S  ++LP  +   +P  ++L      S  L   L  ++D+        + 
Sbjct: 10  AFLLIFIRVSSFFVVLPLFNHRTVPAPLKL----GLSAFLAATLAVSLDVPELALDLPFL 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN-SLIG 129
            L + E  +G   GL+  +    +Q  G VI   +G  L   +    + A++PL  S + 
Sbjct: 66  LLALKEFAIGIAAGLMASMILYAVQVAGGVIDFHLGFMLANVVD-PQTGAQSPLTGSYLY 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  +L L +ID HH +   ++ SY  +P+ Q       G++      ++   F + + ++
Sbjct: 125 LFAMLYLLIIDGHHLLLDGVIYSYQFVPLDQLVLPFGSGHVMEHVTQVMVMLFAMAVSMA 184

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            P      + ++++G++++ VPQ+ ++ +  P
Sbjct: 185 MPVAGALFLVDVALGIISRTVPQMNVFVVGIP 216


>gi|15615003|ref|NP_243306.1| flagellar biosynthesis protein FliR [Bacillus halodurans C-125]
 gi|10175060|dbj|BAB06159.1| flagellar protein required for flagellar formation [Bacillus
           halodurans C-125]
          Length = 258

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 103/215 (47%), Gaps = 9/215 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ + +M +P  S   IP   ++  A+  + +L   L   I L +      Y  L+
Sbjct: 13  LVFVRMLAFLMTMPLFSYRNIPAMFKVGIALFLAWILTFSLEPEIILFD----GTYVILI 68

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIG 132
           M E+ +G + GL+  V    +Q  G+ I   IG  L  ++    + A++PL  S +    
Sbjct: 69  MKEVLVGLMVGLIAMVLLYAIQAAGAFIDVKIGF-LIANIVDPQTGAQSPLIGSYLYTFA 127

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           LL +   + HH +   +  SY  IP+ Q    ++  N+       L T F+I  +++ P 
Sbjct: 128 LLFMLATNGHHLLIDGMYYSYQFIPLNQPFLNVSDENMIELIATTLNTMFIIAFQMAFPL 187

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +    + ++++G++++ VPQ+ ++ +  P  I +G
Sbjct: 188 VGSLFLVDVALGMVSRAVPQMNVFVVGMPLKILVG 222


>gi|326389465|ref|ZP_08211032.1| flagellar biosynthetic protein FliR [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325994470|gb|EGD52895.1| flagellar biosynthetic protein FliR [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 260

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 102/215 (47%), Gaps = 9/215 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT---IDLQNFVNRAYYS 70
           L+  R+    +L P      +P   ++      ++++    +DT   +DLQ   N   Y 
Sbjct: 16  LLFVRMLGIFILTPFFGTKNVPTTFKIGLGFFAAVIV----FDTMGPVDLQ-INNVLDYF 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +V+ E  +G V GL   +    +   G +I   +G  L   + I        + + I I
Sbjct: 71  IVVISEFIVGLVIGLASMISFSAIHLAGQLIDYQLGFGLVNILDIHSETQVPLMGNFIYI 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + +L   +++ H+ +F  L KS   IP+G+ + N  ++      M+   F++  R+S+P 
Sbjct: 131 LTILIFMLMNGHYTLFTMLAKSVDIIPVGKVVFNLPDMSQVLTKMVSDMFILGFRISAPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +   ++ ++++G++++ +PQ+ ++ I  P  I +G
Sbjct: 191 ILTTLLTDLTLGIISRTIPQLNVFMIGMPAKIFVG 225


>gi|291277528|ref|YP_003517300.1| flagellar biosynthetic protein [Helicobacter mustelae 12198]
 gi|290964722|emb|CBG40577.1| flagellar biosynthetic protein [Helicobacter mustelae 12198]
          Length = 254

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 89/210 (42%), Gaps = 9/210 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT---IDLQNFVNRAYYSKLVM 74
           R G      P      IP+ +R   A    +V  P L  T   +D  +F+          
Sbjct: 21  RFGGIFAFFPFFDSGLIPVSLRGALAFFMCLVFFPILPHTPLQLDTVSFLIAGS------ 74

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
           +EL  G +  L++++    L F G  IS ++GL + ++   +    +  +  ++ ++ +L
Sbjct: 75  LELLFGFLASLVLQIIFSTLAFAGDSISFSMGLTMASAYDPATGSQKPIVGQVLMMLAML 134

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
                DFHH +F  + +S   IP+G  +   NI  + +      F +   ++ P L   +
Sbjct: 135 IALQSDFHHVIFSFVAQSLEQIPLGHFVTKQNILETIIYDFSLLFSVGFAMAFPILGLIL 194

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           + +I  G++ K  PQ  +  I  P  I L 
Sbjct: 195 LSDIVFGMIMKTHPQFNLLAIGFPVKIALA 224


>gi|317179977|dbj|BAJ57763.1| flagellar biosynthesis protein FliR [Helicobacter pylori F32]
          Length = 255

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|297379398|gb|ADI34285.1| flagellar biosynthetic protein FliR [Helicobacter pylori v225d]
          Length = 255

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 93/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY +
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTT 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|297584053|ref|YP_003699833.1| flagellar biosynthetic protein FliR [Bacillus selenitireducens
           MLS10]
 gi|297142510|gb|ADH99267.1| flagellar biosynthetic protein FliR [Bacillus selenitireducens
           MLS10]
          Length = 259

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 105/229 (45%), Gaps = 11/229 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQ-NFVNRAY 68
           +  L++ RV + ++ LP  S   IP + ++ FA   S I++    W  I+L   FV  A 
Sbjct: 11  AFLLVLVRVSAFMVTLPFFSYQTIPNRFKIGFAAFLSWIMIFSGDWPIIELNYEFVLLAI 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV      G   GL+  +    +Q  G +I   +G  +   +          + S +
Sbjct: 71  KEALV------GLTVGLIALLLLYAIQVAGGLIDLKLGFLIANVVDPQTGTQAPLIGSYL 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFG-NIFSSFVNM-LQTTFMIMLRL 185
               LL L   + HH +   +  SY  IP+ Q  L  G   +  F+ + + T F+I  ++
Sbjct: 125 YTFALLFLLATNAHHLLLDGVYYSYEFIPLDQTFLPLGSEDYVEFIGVTMNTMFIIAFQM 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEI 234
           S P +    + ++++G + + VPQ+ ++ I  P  I LG +F+ +++ +
Sbjct: 185 SMPIMGSIFLVDVALGFIARTVPQVNVFVIGFPVKIFLGFVFMIVTMPV 233


>gi|308182347|ref|YP_003926474.1| flagellar biosynthesis protein FliR [Helicobacter pylori PeCan4]
 gi|308064532|gb|ADO06424.1| flagellar biosynthesis protein FliR [Helicobacter pylori PeCan4]
          Length = 255

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPKLAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|317181482|dbj|BAJ59266.1| flagellar biosynthesis protein FliR [Helicobacter pylori F57]
          Length = 255

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 93/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  KLVMV----ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +  +V    ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIVACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|237751819|ref|ZP_04582299.1| flagellar biosynthetic protein FliR [Helicobacter bilis ATCC 43879]
 gi|229373185|gb|EEO23576.1| flagellar biosynthetic protein FliR [Helicobacter bilis ATCC 43879]
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/237 (18%), Positives = 104/237 (43%), Gaps = 3/237 (1%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           M+  +++ R G  +   P      +P+ VR   A   ++V +P +   I   ++ +   +
Sbjct: 14  MAFLMLLLRFGGILAFFPFFDNQILPVSVRAALAFVLAVVFMPMVTHII---SYPSLTAF 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
               + E+ LG   GL++++    + F G + S ++GL + ++        +  ++ ++ 
Sbjct: 71  MIGGLFEILLGFTCGLVLQIIFSSIVFAGDLASFSMGLTMASAYDPMSGTTKPIVSQVVV 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            + +L     +FH+ +   + ++    P+G  +   NI + F        +I   ++ P 
Sbjct: 131 FLSILMALHFNFHYLLLDIIARTLNDTPLGGFMLSDNIVAYFTKSFANMILIGFSMAFPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           +   ++ +I  G++ K  PQ  +  I  P  IG+  + L + +  I+  F +    G
Sbjct: 191 IAVLLLTDIIFGMIMKTHPQFNLLVIGFPVKIGVALVILAIIVPSIMQHFRYDLSEG 247


>gi|225871938|ref|YP_002753392.1| flagellar biosynthetic protein FliR [Acidobacterium capsulatum ATCC
           51196]
 gi|225793704|gb|ACO33794.1| flagellar biosynthetic protein FliR [Acidobacterium capsulatum ATCC
           51196]
          Length = 260

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 99/214 (46%), Gaps = 4/214 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +L L++ RV   ++  P  S + IP QV+  F +A ++ L P +     L +   R    
Sbjct: 14  ALVLVMLRVSGLMLFAPVFSSTAIPPQVKAVFTLAVTVCLAPVV---AGLPHADAR-LGP 69

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           + ++ EL +G + G+ +R+    L F G ++  A   +L   +  +  +    +     +
Sbjct: 70  QEILSELAVGLLFGICLRMLMEMLTFAGDLLGIAFSFSLVNLLDPNAPVQVPLMGQFFSL 129

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +G L L        +  AL++++  +P+G  +       +   M    F+  L+L++P +
Sbjct: 130 LGTLVLLSTGLDRTMIAALMRTFAVVPVGSFVLSAKTAWAVAEMGTGLFLAALQLAAPVM 189

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
              ++ + ++GL  +L PQ+P   ++ P    LG
Sbjct: 190 VATMLVDFAVGLAARLSPQLPALSLTVPVKTMLG 223


>gi|260438788|ref|ZP_05792604.1| flagellar biosynthetic protein FliR [Butyrivibrio crossotus DSM
           2876]
 gi|292808777|gb|EFF67982.1| flagellar biosynthetic protein FliR [Butyrivibrio crossotus DSM
           2876]
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 99/202 (49%), Gaps = 6/202 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVNRAYYSKL 72
           LI+ R+ S +   P  +M+  P + +L  A   S+++   + D T++  + +    Y+ L
Sbjct: 16  LILVRIASFVYTAPFFNMANTPQRTKLGLAFFISLIVFTLVPDRTLEYSSILE---YAIL 72

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G    V    + F G++I + IGL++ +    +     T   +L     
Sbjct: 73  VIKESVVGLLLGFSCMVCVQTITFAGNIIDSNIGLSMASEYDPTLRDQTTVSGTLYYYTV 132

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L L V   +  +  A+V +Y  IPI G  +N  +++SS V ++   F+I  R++ P   
Sbjct: 133 FLLLMVSGLYQFLISAIVDTYTIIPINGLSVN-PSLYSSVVTLVSDYFIIGFRIALPVFV 191

Query: 192 FYIVFNISIGLLNKLVPQIPIY 213
             ++ N  +G+L K+  Q+ ++
Sbjct: 192 SLLIVNCVLGILAKVASQLNMF 213


>gi|238924152|ref|YP_002937668.1| flagellar biosynthesis protein FliR [Eubacterium rectale ATCC
           33656]
 gi|238875827|gb|ACR75534.1| flagellar biosynthesis protein FliR [Eubacterium rectale ATCC
           33656]
 gi|291524885|emb|CBK90472.1| flagellar biosynthetic protein FliR [Eubacterium rectale DSM 17629]
 gi|291529026|emb|CBK94612.1| flagellar biosynthetic protein FliR [Eubacterium rectale M104/1]
          Length = 259

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 96/203 (47%), Gaps = 7/203 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ--NFVNRAYYSK 71
           LI+ R+ S + + P    + +P +V+       S  +  F+++ I+    ++V+   ++ 
Sbjct: 16  LILVRIASFVYIAPFFGDNAVPARVK----TGLSAFVALFMYNIIERPQLSYVSAVGFAV 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E   G + G    +    + F G++I   IGL++ T    S +   T   +    +
Sbjct: 72  LVVKEGITGLLIGFAANICNSIVIFAGNLIDMDIGLSMATEFNPSMNSETTVTGNFYYYV 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            L+ L V D H  +  A+  S+  +P+ G +  F N+ S+    +   F+I  R+  P  
Sbjct: 132 VLVLLLVSDMHTYLIRAVCDSFSVVPLGGAQFQFDNMLSTMTKYMGDMFVIGFRIFLPVF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIY 213
              ++ N  +G++ K+ PQ+ ++
Sbjct: 192 ACMMIMNCILGIMAKVAPQMNMF 214


>gi|209522298|ref|ZP_03270925.1| flagellar biosynthetic protein FliR [Burkholderia sp. H160]
 gi|209497274|gb|EDZ97502.1| flagellar biosynthetic protein FliR [Burkholderia sp. H160]
          Length = 260

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 95/210 (45%), Gaps = 6/210 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + I   P      +P +V++  A   +I++ P +     +  F     +   ++V 
Sbjct: 21  ARIAALIATAPIFGNMSLPSRVKIGLAAFATIIVAPTIGALPQVTVFSAAGVW---ILVN 77

Query: 77  LFL-GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            FL G   G+ +++    +  TG  I   +GL   T      + +   ++  +  I  L 
Sbjct: 78  QFLIGIALGVTMQIVFQAIDATGYFIGLGMGLGFATFFDQQATGSGVVISRYMTTIATLV 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H Q+  ALV ++ ++P+   L   + + +  N   + F   L L+ P +   ++
Sbjct: 138 FLAVDGHLQMIAALVTTFQSVPVSANLLAPHGWQTLANWGGSIFSAGLLLALPVVVALLI 197

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGL 223
            N+++G+LN+  PQI ++ I  P   L+GL
Sbjct: 198 ANLALGILNRAAPQIGVFQIGFPLTMLVGL 227


>gi|217031933|ref|ZP_03437435.1| hypothetical protein HPB128_3g52 [Helicobacter pylori B128]
 gi|298736884|ref|YP_003729414.1| flagellar biosynthetic protein FliR [Helicobacter pylori B8]
 gi|216946402|gb|EEC25007.1| hypothetical protein HPB128_3g52 [Helicobacter pylori B128]
 gi|298356078|emb|CBI66950.1| flagellar biosynthetic protein FliR [Helicobacter pylori B8]
          Length = 255

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|221639479|ref|YP_002525741.1| Flagellar biosynthetic protein FliR [Rhodobacter sphaeroides KD131]
 gi|221160260|gb|ACM01240.1| Flagellar biosynthetic protein FliR [Rhodobacter sphaeroides KD131]
          Length = 269

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 96/204 (47%), Gaps = 8/204 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK- 71
           F+   R+G+ ++  P     ++P+ VR+   +A  I+ LP L   ++L      A  +  
Sbjct: 23  FVASLRIGAFLIASPAFGGRFVPLPVRI---VATVILTLPVLGR-VELPPPEALASLAAI 78

Query: 72  -LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L+M E+ +G   GL++ +        G  I++  GL     +  S    +TP+ + I  
Sbjct: 79  PLMMQEIAVGLSAGLVLTILFSAAALAGDRIASTAGLGFAAQIDPSAG-GQTPVVAQIFG 137

Query: 131 IGLLALW-VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + L  ++  +D H      L++SY ++P G     G    + +      F++ L++  P 
Sbjct: 138 LALTTVFLALDGHLTALDILLRSYESLPPGAPFAPGRFLEAGIGAGGRMFLLGLQIMMPV 197

Query: 190 LFFYIVFNISIGLLNKLVPQIPIY 213
           +   I+ N++IG++ +  PQ+ ++
Sbjct: 198 VAALILINVTIGIVTRSAPQLNVF 221


>gi|282891199|ref|ZP_06299702.1| putative type III secretion inner membrane protein SctT
           [Parachlamydia acanthamoebae str. Hall's coccus]
 gi|281498892|gb|EFB41208.1| putative type III secretion inner membrane protein SctT
           [Parachlamydia acanthamoebae str. Hall's coccus]
          Length = 285

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 108/231 (46%), Gaps = 17/231 (7%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLP-FLWDTIDLQNFV 64
           E ++    L + R+   I   P L    +P  V++  A++  ++  P  L  T     F 
Sbjct: 24  EGVLTIFLLFLARMFPIIAQSPFLGARVLPHPVKVSLAISLFVIFFPQMLLLTTTPIGFN 83

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE--- 121
             A    L+  E+ +G + G +I +    +Q  G +I    G     S+ ++D   +   
Sbjct: 84  FNALL--LLFKEILIGFILGFIISIPFSIVQNAGMIIDHQRG---GASLMVNDPTIQNQS 138

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ--ELNFGNIFSSF----VNML 175
           +P+ +L+ ++ +   WV+D       A+  SY  +P  Q    NF +  S F    + +L
Sbjct: 139 SPVGTLLNMVLIFLFWVVDIPFLFIDAIFTSYEIVPPDQFINPNFFDAASPFRKTQIELL 198

Query: 176 QTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLG 224
               ++ ++L++P L   ++ ++ +G++N+L PQ+ I F+  P   L+GLG
Sbjct: 199 NKVMVVSIQLATPALLAILMTDVFLGIVNRLAPQVQITFLGMPLKSLLGLG 249


>gi|146277692|ref|YP_001167851.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555933|gb|ABP70546.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17025]
          Length = 266

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 8/208 (3%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + SLF    R+G+ ++  P     ++P+ VR+   MA  ++ LP L    DL      A 
Sbjct: 16  LTSLFFATLRIGAFLLASPAFGGRFVPLPVRI---MATVVLTLPVLGRA-DLPGPEALAS 71

Query: 69  YSK--LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            S   ++M E+ +G   GL++ V        G  I+   GL     +  S    +TP+ +
Sbjct: 72  LSAVPMMMQEIAIGLSAGLVLTVLFSAAALAGDRIAATAGLGFAAQIDPSAG-GQTPVVA 130

Query: 127 LIGIIGLLALW-VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            I  + L  ++  +D H   F  L++SY ++P G     G    + +      F++ L++
Sbjct: 131 QIFGLALTTVFLALDGHLSAFEILLRSYESLPPGAPFAPGPFLEAGIGAGGRMFLVGLQI 190

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIY 213
             P +   ++ NI+IG++ +  PQ+ ++
Sbjct: 191 MMPVVAALVLINITIGVITRSAPQLNVF 218


>gi|29840695|ref|NP_829801.1| type III secretion inner membrane protein SctT [Chlamydophila
           caviae GPIC]
 gi|29835045|gb|AAP05679.1| type III secretion inner membrane protein SctT [Chlamydophila
           caviae GPIC]
          Length = 289

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 103/224 (45%), Gaps = 7/224 (3%)

Query: 25  LLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           ++P L     P  +++  A+++  ++ P +     + N+++   +  L++ EL +G + G
Sbjct: 45  IVPFLGGKLFPAPIKIGIALSWVAIIFPKVLMNTHIANYLDDDMFYILIVKELCIGTLIG 104

Query: 85  LLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            ++       Q  GS I+   G+  L+ +  +      +P          +  W+   H 
Sbjct: 105 FILSFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGIFYHYFVTIVFWLSGGHR 164

Query: 144 QVFYALVKSYGTIPIGQELNF------GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            V   L++S   IPI + L          I+ + + M Q   ++ ++LS+P     ++ +
Sbjct: 165 IVLTILLQSLEIIPIHKFLPMEMMSLDAPIWITLIKMCQLCLIMTIQLSAPAAVAMLMSD 224

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +G++N++ PQ+ + ++ +     +G LFL LS   IV Q  +
Sbjct: 225 LFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLSWWFIVKQIDY 268


>gi|221309515|ref|ZP_03591362.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313839|ref|ZP_03595644.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318762|ref|ZP_03600056.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323034|ref|ZP_03604328.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767371|ref|NP_389519.2| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321315404|ref|YP_004207691.1| flagellar biosynthesis protein FliR [Bacillus subtilis BSn5]
 gi|239938629|sp|P35537|FLIR_BACSU RecName: Full=Flagellar biosynthetic protein fliR
 gi|225184998|emb|CAB13510.2| component of the flagellar export machinery [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320021678|gb|ADV96664.1| flagellar biosynthesis protein FliR [Bacillus subtilis BSn5]
          Length = 259

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 110/235 (46%), Gaps = 12/235 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-RAYY 69
           +  L+  R+ +  + +P      +P   R+ FA   +++     + TID    +    +Y
Sbjct: 10  AFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVIC----FSTIDKPPSLEIDEHY 65

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLI 128
             L   E  +G   GL+  +    +Q  GS I   +G ++   +    + A++PL    I
Sbjct: 66  MLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVID-PQTGAQSPLIGQFI 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGN-IFSSFV-NMLQTTFMIMLRL 185
             + LL +  ++ HH +   +  S+  I + Q   NFG+  F+ F+       F+I  ++
Sbjct: 125 YTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFIIAFQM 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
           S+P +    + ++++G++ + VPQ+ ++ +  P  I +    L +C+S+  +V +
Sbjct: 185 SAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVR 239


>gi|83647844|ref|YP_436279.1| flagellar biosynthesis protein FliR [Hahella chejuensis KCTC 2396]
 gi|83635887|gb|ABC31854.1| Flagellar biosynthesis pathway, component FliR [Hahella chejuensis
           KCTC 2396]
          Length = 261

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 113/229 (49%), Gaps = 14/229 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD--TIDLQNFVNRAYYSKLVMV 75
           R+ S +M  P L    +P +VRL  ++  +I+++P L     +D  +  + A   + V++
Sbjct: 22  RISSFMMTTPILGTQIVPARVRLALSLLMTILIVPSLPPVPEVDPLSVNSVAIIIQQVLI 81

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            L +G    LL +++ +    TG +++  +GL   + +  ++ +  T L+    ++  L 
Sbjct: 82  GLAMGFAVLLLFQLFVV----TGQIVAMNMGLGFASMVDPTNGITVTALSQFYLMLVTLL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIF---SSFVNMLQTTFMIMLRLSSPFLF 191
              +  H  +F A+V+S+  +PI  QE++  + +   S    M  +  MI L    P + 
Sbjct: 138 FLSMGGHLVMFEAVVESFRFLPISAQEVDVWSWWYLASRISWMFASALMIAL----PAVT 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             ++ NIS G++ +  PQ+ I+ I  P  +  G +   +SI  I+ QF+
Sbjct: 194 ALLIVNISFGVMTRAAPQMNIFSIGFPMTVLFGLVVFWISIGGILPQFT 242


>gi|332981451|ref|YP_004462892.1| flagellar biosynthetic protein FliR [Mahella australiensis 50-1
           BON]
 gi|332699129|gb|AEE96070.1| flagellar biosynthetic protein FliR [Mahella australiensis 50-1
           BON]
          Length = 259

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 100/211 (47%), Gaps = 7/211 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ--NFVNRAY 68
           +  L+  R+    +L P      +P  +++  +   ++VLL    +TI LQ  + VN  +
Sbjct: 12  TFLLVFMRMTGLFVLSPVFGRRNVPAYLKIGMSFMMAMVLL----NTIPLQSIDIVNNIW 67

Query: 69  -YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  ++  E+ +G   G +  +    +   G ++   IG  +  +    + +A   + +L
Sbjct: 68  LYVWILFKEMLIGLAMGYITTLAFSAILIAGQIMDFQIGFGMVNAFDPVNEVAVPIVGNL 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I ++ LL  + ++ HH +   L  SY  +PIG      +I    + +   TF+  ++L+ 
Sbjct: 128 INMMALLLFFGMNGHHVLISLLFDSYTVLPIGDFSIKPDILWYILEIFVQTFVWAIKLAI 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           P +   ++  + +G+L++ +PQ+ ++ +  P
Sbjct: 188 PLMAVLLLTEVMLGVLSRALPQMNVFVMGMP 218


>gi|268679050|ref|YP_003303481.1| flagellar biosynthetic protein FliR [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268617081|gb|ACZ11446.1| flagellar biosynthetic protein FliR [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 257

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 103/236 (43%), Gaps = 11/236 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL+  R+       P  S + IP+ ++        + L P L         +N    +  
Sbjct: 17  FLLFARLSGVFAFFPFFSHANIPLSIKTSITFFMVVFLFPLLSPLHVTPTLLN---LTLA 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ EL +G + GL + +    LQ  G  IS  +G  + + +    S +   L+ +  +IG
Sbjct: 74  IVSELLIGFIAGLFLTIALSILQMAGMQISFVMGFTMASVVDPQTSTSIPVLSQIFSLIG 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQ---ELN-FGNIFSSFVNMLQTTFMIMLRLSSP 188
           L+ +   + HHQ+   +V S   +P+G    E++  G I  +   M    F+    LS P
Sbjct: 134 LMIVLAFNGHHQMLLFIVDSLSLLPLGTFYPEMSVVGYILKATTGMFVYGFI----LSFP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
            L F ++ ++  G+L K +PQ  +  +  P  I +  + + +++   +  F   F+
Sbjct: 190 VLAFSLLMDVVFGMLMKTMPQFNLLVVGFPIRIAVSLVVIIVTLASTMLLFKREFM 245


>gi|68164508|gb|AAY87237.1| predicted flagellar biosynthetic protein [uncultured bacterium
           BAC17H8]
          Length = 270

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 103/210 (49%), Gaps = 10/210 (4%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVR--LCFAMAFSIVLLPFLWDTIDL-QNFV 64
           +++  FL   R+G+ ++  P     ++P++VR  + F +A +IV      D  D+  + +
Sbjct: 20  VLLQYFLASLRIGAFLLSAPIFGARWLPLKVRIIMAFTLAAAIV-----GDVPDVGTDLL 74

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
             +    ++ +E+ +G   GL + ++   +   G  I+++ GL     +  +    +TP+
Sbjct: 75  TSSVGVSMMFIEIAIGLTAGLTLTIWFAAVLLAGEKIASSAGLGYAAQVDPATG-GQTPV 133

Query: 125 NSLIGIIGLLALWV-IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
            S I  + LL +++ ID H      +++SY  +P+G  +    + +S +    + F+   
Sbjct: 134 VSQILYLFLLVIFLSIDGHLLAIGTMLESYRILPVGASVAPEVLIASGITAAGSMFLAAT 193

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIY 213
            +  P     ++ N++IG++ +  PQ+ ++
Sbjct: 194 IIMLPITTVLLMINVAIGIITRSAPQLNLF 223


>gi|323975951|gb|EGB71045.1| flagellar biosynthetic protein FliR [Escherichia coli TW10509]
          Length = 260

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + M+VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTMRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|15644802|ref|NP_206972.1| flagellar biosynthesis protein FliR [Helicobacter pylori 26695]
 gi|2313256|gb|AAD07238.1| flagellar biosynthetic protein (fliR) [Helicobacter pylori 26695]
          Length = 255

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|205373391|ref|ZP_03226195.1| flagellar biosynthesis protein FliR [Bacillus coahuilensis m4-4]
          Length = 258

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 103/238 (43%), Gaps = 10/238 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ RV S  + +P  S   IP Q RL      S +L   ++ +++    V    Y  L+
Sbjct: 13  LILMRVASFFVTMPLFSYRTIPAQHRL----GLSAILAFLMYYSVEADPLVIDGLYFLLI 68

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E  +G + G    +    +Q  G  I   +G  +   +     +        +    L
Sbjct: 69  LKEAMVGLLIGFAAYMIISAIQIAGGFIDFQMGFAIANVVDPQTGMQSPITGQYLYTFAL 128

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF----MIMLRLSSPF 189
           L L  ++ HH +   +  SY  IPI   L F N   S V  + T F    +I  ++S+P 
Sbjct: 129 LLLLSVNGHHIMLDGIFHSYQFIPIDSMLPFEN--ESIVLFITTAFSRVFVIAFQISAPV 186

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           +    + +I++G++ + VPQ+ I+ +  P  I +  + L L +  ++     +F Y F
Sbjct: 187 VATLFLVDIALGIVARTVPQLNIFVVGFPIKIAVSFIILILVMGSMMIVIQQTFEYMF 244


>gi|317008844|gb|ADU79424.1| flagellar biosynthesis protein FliR [Helicobacter pylori India7]
          Length = 255

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSTIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCTSVFLQIVFASLVFATDSISFSMGLTMASTYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|332140594|ref|YP_004426332.1| flagellar biosynthesis protein FliR [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550616|gb|AEA97334.1| flagellar biosynthesis protein FliR [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 259

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 92/208 (44%), Gaps = 4/208 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+    + + GLS   IP QVR    +  ++V++P +     ++N V+   +  +V+ +L
Sbjct: 21  RISGLFVAMIGLSAKSIPPQVRALLGIMLTLVIMPVV-PPSPIENLVSVGTF-LIVIQQL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G +  +        G +I+   GL   + +   + +    +     I+  L  W
Sbjct: 79  LIGIAIGFISMMVLNTFVLAGQIIAMQTGLGFASIVDPVNGINVPAVGQFYLILATLLFW 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            +D H  +   +V S+   PIG+    G  F    +     F+  + LS   +   ++ N
Sbjct: 139 TLDGHLSMIQMIVMSFEAFPIGEAWWTGEQFRDIAHWGGWMFVSAITLSLAPIVSLLIVN 198

Query: 198 ISIGLLNKLVPQIPIYFI--STPYLIGL 223
           ++ G++ K  PQ+ I+ I  S   L+GL
Sbjct: 199 LAFGVMTKAAPQLNIFSIGFSIAQLMGL 226


>gi|207092537|ref|ZP_03240324.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 255

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|114046867|ref|YP_737417.1| flagellar biosynthesis protein FliR [Shewanella sp. MR-7]
 gi|113888309|gb|ABI42360.1| flagellar biosynthetic protein FliR [Shewanella sp. MR-7]
          Length = 265

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 112/235 (47%), Gaps = 24/235 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  A+A ++ + P L    D + F   A +  ++ +++
Sbjct: 21  RVTSMLMVMVVFGATTTPTRVRLLLAVAITLAIAPVLPPVKDAELFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTQMVMQTFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  L    +D H  +   LV S+ T+PI    N G   +S+ ++ +     F   L +S
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETLPIS---NQGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F  
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFEE 242


>gi|317176989|dbj|BAJ54778.1| flagellar biosynthesis protein FliR [Helicobacter pylori F16]
          Length = 255

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|297620335|ref|YP_003708472.1| putative type III secretion inner membrane protein SctT [Waddlia
           chondrophila WSU 86-1044]
 gi|297375636|gb|ADI37466.1| putative type III secretion inner membrane protein SctT [Waddlia
           chondrophila WSU 86-1044]
          Length = 281

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 115/251 (45%), Gaps = 19/251 (7%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ-- 61
            P  + + LFL + R+   I L P      +P  V+L FA++   + +P L      +  
Sbjct: 18  DPGAVFILLFLFLARILPIIALSPFFGARVLPHPVKLAFAISLFAIFVPHLLVVTQSKLS 77

Query: 62  -NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
              ++ A ++K    ELF+G + G LI +    +Q  G +I    G     S+ ++D   
Sbjct: 78  FTPLSLALFAK----ELFVGYLIGFLISIPFTIVQTAGMLIDHQRG---GASLMVNDPTI 130

Query: 121 E---TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN--FGNIFSSFVN-- 173
           +   +PL ++  ++ +   ++ID       A+  SY  IP  +  N  F +  S+F    
Sbjct: 131 QNQSSPLGTMFNMVLIYIFFMIDGPFYFIDAINTSYSAIPPDRFFNPQFFDKSSAFSEIA 190

Query: 174 --MLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLS 231
             +L    ++ ++ +SP L   ++ ++ +G+ N+L  Q+ I F+  P    LG   + + 
Sbjct: 191 FQLLNNAMVLAIQFASPALIAILMTDVFLGIANRLATQVQITFLGLPLKSLLGLTLITIG 250

Query: 232 IEIIVYQFSHS 242
            ++++ Q +  
Sbjct: 251 WKVLINQMAED 261


>gi|332673015|gb|AEE69832.1| flagellar biosynthetic protein FliR [Helicobacter pylori 83]
          Length = 255

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSTIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|108562594|ref|YP_626910.1| flagellar biosynthesis protein FliR [Helicobacter pylori HPAG1]
 gi|107836367|gb|ABF84236.1| flagellar biosynthetic protein [Helicobacter pylori HPAG1]
          Length = 255

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|319787088|ref|YP_004146563.1| flagellar biosynthetic protein FliR [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465600|gb|ADV27332.1| flagellar biosynthetic protein FliR [Pseudoxanthomonas suwonensis
           11-1]
          Length = 264

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 84/204 (41%), Gaps = 23/204 (11%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +M +P +    +P+++R+  A A ++ L P L    +             V  EL
Sbjct: 27  RTGALLMAMPLIGTRAVPLRLRVLVAGALAMALAPMLPKPPEFAGLDAATVLG--VAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G  +R+      + G +IS  +GL+      ++D L  T         G++A W
Sbjct: 85  AVGVTMGFCLRLVFEAGAYAGELISHGMGLSFAQ---MNDPLRGT-------SSGVVAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLS 186
                       D H  V   LV+SY  +PIG   ++     ++ V +        L L+
Sbjct: 135 FYIAFGLLFFTSDGHLAVITMLVRSYQALPIGAAWVDAAAGLATPVELFSAVLRGGLGLA 194

Query: 187 SPFLFFYIVFNISIGLLNKLVPQI 210
            P +   +  N++ G+L K  P +
Sbjct: 195 LPLMVAMLATNLTFGVLAKAAPSL 218


>gi|261837621|gb|ACX97387.1| flagellar biosynthetic protein [Helicobacter pylori 51]
          Length = 255

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYAP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|302872553|ref|YP_003841189.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575412|gb|ADL43203.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 260

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 99/224 (44%), Gaps = 14/224 (6%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF-----VNRA 67
           FL++ R+    +  P      IP   ++ FA   S+++       +   NF      N  
Sbjct: 16  FLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSMIV-------VTTYNFSYSVPTNVE 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  +V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + 
Sbjct: 69  EYIFVVIKEFIVGLLIGYISYMIFSAILLGGQIIDNAIGFGMANVIDPMSEIQVPLLGNF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS-SFVNMLQTTFMIMLRLS 186
           + +  L+  +  D HH +  A+  SY  +PIG    F   F+ +F+      F+I + +S
Sbjct: 129 LYLYMLVMFFGTDAHHLLIRAIFYSYKLVPIGYG-GFKTEFTWNFLRFFSELFLIGVEIS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            P L   ++ +I + +L++ VPQ+ ++ +  P  I +G L L +
Sbjct: 188 LPILMSMLIVDIILAVLSRAVPQMNVFMVGIPIKITIGFLVLVI 231


>gi|95929866|ref|ZP_01312607.1| flagellar biosynthetic protein FliR [Desulfuromonas acetoxidans DSM
           684]
 gi|95134162|gb|EAT15820.1| flagellar biosynthetic protein FliR [Desulfuromonas acetoxidans DSM
           684]
          Length = 260

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/229 (19%), Positives = 106/229 (46%), Gaps = 3/229 (1%)

Query: 16  VCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV 75
           + RV + +  +P      +P + ++  A+  + ++ P +   +   +F        L+  
Sbjct: 18  LARVAAILGSMPVFGSGQVPARAKVILALFMTFLIFPGVEPLLPSYSF-EPLPLMLLIAN 76

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E  LG + G + R+    ++F G+++   +G          +    + ++    +  +L 
Sbjct: 77  EALLGIMMGFIARLIFTAVEFGGTIVGYQMGFAAANVYDPQNQRQVSLISQFQNVFAILV 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRLSSPFLFFYI 194
              +D HH    A+V SY  +P G  L+F +    F+  +    F++ +R S+P L   +
Sbjct: 137 FLALDVHHLFIEAMVDSYRQLPPGL-LDFSSEAVPFIMELTGHMFVLAIRFSAPILAVLL 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +  + +G+L ++ PQ+ ++ +S P  IG+  + + L++ ++V   +  F
Sbjct: 196 LSGLVLGILARVFPQLNVFLLSFPINIGMAFIIIGLTMNMVVAMLNREF 244


>gi|317012018|gb|ADU82626.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           Lithuania75]
          Length = 255

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|292669765|ref|ZP_06603191.1| flagellar protein required for flagellar formation [Selenomonas
           noxia ATCC 43541]
 gi|292648562|gb|EFF66534.1| flagellar protein required for flagellar formation [Selenomonas
           noxia ATCC 43541]
          Length = 260

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 94/199 (47%), Gaps = 10/199 (5%)

Query: 39  RLCFAMAFSIVLLPFLWDTIDLQNFVNRAY----YSKLVMVELFLGCVHGLLIRVYTLGL 94
           R+  A+A ++VL P     ID    V        ++   + ELF+G + G +  +    +
Sbjct: 41  RVGIALAMTVVLFP----VIDRLGVVTAPETIIMFAVAAVGELFIGWLIGFVAYISFAAI 96

Query: 95  QFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYG 154
              G V+   +G  +   +  +       + S +  + ++ L V + HH +  ALV+S+ 
Sbjct: 97  TMAGKVMDMQVGFAIVNVVDPTSGQQIPLIGSFLYNLAVIILLVTNGHHMIIAALVESFR 156

Query: 155 TIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIY 213
            +P+ G E N  +I     N     F+  ++++ P  F  ++ N+ +G+L++ +PQ+ I+
Sbjct: 157 AVPLAGMEPNL-SIALLLANFTGGIFVTGMKIAMPITFAILLTNVGLGILSRTMPQMNIF 215

Query: 214 FISTPYLIGLGSLFLCLSI 232
            +  P  + +G + L + I
Sbjct: 216 VVGIPMQLMIGIVVLSMII 234


>gi|254973928|ref|ZP_05270400.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-66c26]
 gi|255091314|ref|ZP_05320792.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile CIP 107932]
 gi|255312972|ref|ZP_05354555.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-76w55]
 gi|255515731|ref|ZP_05383407.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-97b34]
 gi|255648825|ref|ZP_05395727.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-37x79]
 gi|260682043|ref|YP_003213328.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile CD196]
 gi|260685641|ref|YP_003216774.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile R20291]
 gi|306518939|ref|ZP_07405286.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-32g58]
 gi|260208206|emb|CBA60557.1| flagellar export protein [Clostridium difficile CD196]
 gi|260211657|emb|CBE01921.1| flagellar export protein [Clostridium difficile R20291]
          Length = 604

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 84/167 (50%), Gaps = 3/167 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLL 134
           E   G + G +  +    ++  GS++   +GL++  +M   +S+ +T L ++L+     +
Sbjct: 64  ETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSM-INMFDPNSMTQTTLIDNLMNWTARM 122

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
             + +D HH +   +  S+  IPIG+     NI    +N+    F+   +++ P +   +
Sbjct: 123 IFFSMDGHHVLIRGIRYSFELIPIGKSFVDNNI-DYIINIFVQCFLTGFKIAIPIVLCLL 181

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  +GL+++ VPQ+ +  I  P  I +G     +SI +IV Q SH
Sbjct: 182 MADFILGLISRSVPQLNVMIIGMPLKILVGIALFIISIPLIVNQISH 228


>gi|288553047|ref|YP_003424982.1| flagellar biosynthesis protein FliR [Bacillus pseudofirmus OF4]
 gi|288544207|gb|ADC48090.1| flagellar biosynthesis protein FliR [Bacillus pseudofirmus OF4]
          Length = 258

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 110/234 (47%), Gaps = 11/234 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L+  RV +   +LP      IP   ++  A+  S +++     T+D    +  A + 
Sbjct: 10  AFLLVFVRVLAFFSVLPIYGHRSIPTTHKIGLALMLSWIMI----FTLDTPEVLIDAVFF 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
            LV+ E+ +G   GL+  +    +Q  G  I   +G  +   +    + A++PL    + 
Sbjct: 66  LLVIKEILVGLSVGLIAMILLYAVQVAGGFIDFNMGFMIANVVD-PQTGAQSPLIGGYLY 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFG--NIFSSFVNMLQTTFMIMLRLS 186
              LL L  ++ HH +   +  SY  +P+ Q  L FG  NI           F+I  +++
Sbjct: 125 TFALLFLLAVNGHHLLLDGIFYSYQFVPMDQVFLPFGQENIVHYIATTFNAMFIIAFQMA 184

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLSIEIIVYQ 238
            P +    + ++++G++++ VPQ+ ++ +  P   L+GL  L + +S+ I+V Q
Sbjct: 185 FPIVGSLFLVDVALGMVSRAVPQMNVFVVGMPLKILVGLPLLIVYMSVFIMVVQ 238


>gi|261839034|gb|ACX98799.1| flagellar biosynthesis protein FliR [Helicobacter pylori 52]
 gi|315586173|gb|ADU40554.1| flagellar biosynthetic protein FliR [Helicobacter pylori 35A]
          Length = 255

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|254778887|ref|YP_003056992.1| flagellar biosynthesis protein FliR [Helicobacter pylori B38]
 gi|254000798|emb|CAX28722.1| Flagellar biosynthetic protein FliR; putative membrane protein
           [Helicobacter pylori B38]
          Length = 255

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|317010452|gb|ADU84199.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           SouthAfrica7]
          Length = 255

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L       +F N  Y  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------DFSNATYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  ESFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGAQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|295706268|ref|YP_003599343.1| flagellar biosynthetic protein FliR [Bacillus megaterium DSM 319]
 gi|294803927|gb|ADF40993.1| flagellar biosynthetic protein FliR [Bacillus megaterium DSM 319]
          Length = 258

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 102/216 (47%), Gaps = 17/216 (7%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ RV S  + +P  S   IP   ++  + + S+++      TIDL      A + 
Sbjct: 10  AFLLVLVRVTSFFITVPLFSYKTIPAVHKVGLSASLSVII----ATTIDLPVVSLDAQFL 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIG 129
            LV+ E  +G   GL   V+ + +Q  G +I   +G  +   +    + A++P L   + 
Sbjct: 66  LLVVKECAVGLFIGLTAYVFIMAIQIAGGLIDFQVGFAIANVID-PQTGAQSPILGQYLY 124

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTI-------PIGQELNFGNIFSSFVNMLQTTFMIM 182
           +  LL L   + HH +   +  SY  I       P+G +    +I + F +M    F++ 
Sbjct: 125 VFALLFLLSTNGHHLLIDGIYNSYLIIPLDKVAFPVGSQAFATHIITVFSSM----FLVA 180

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           +++S P +    + +I++G++ + VPQ+ I+ +  P
Sbjct: 181 VQMSLPLVGSLFLVDIALGIVARTVPQLNIFVVGFP 216


>gi|51246525|ref|YP_066409.1| flagellar biosynthetic protein (FliR) [Desulfotalea psychrophila
           LSv54]
 gi|50877562|emb|CAG37402.1| related to flagellar biosynthetic protein (FliR) [Desulfotalea
           psychrophila LSv54]
          Length = 260

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 96/215 (44%), Gaps = 2/215 (0%)

Query: 11  SLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            LFL+V  RV   +  +P +S    P Q+++  A + ++VL P +   I ++  +    +
Sbjct: 12  QLFLVVLSRVAGFVGAIPVISSVQSPKQIKIALACSVALVLFPIMSPVIHIKE-LTMPSF 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           + L++ E+ +G   G   ++    ++F  +VI   +G                 ++    
Sbjct: 71  ALLIVAEVLVGTTIGFAAKLIFTSIEFGATVIGYQMGFAAANVFDPQTKGQVALISQFQN 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
              +L    ID HH   +    SY  +P GQ    G      + +    F + ++ S+P 
Sbjct: 131 SFAILIFLAIDGHHIFIHTASISYQFLPPGQFNYSGGAVPYLIELTAHMFQMGIQFSAPV 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           L   ++  + +G+L+++ PQ+ ++ +S P  IGL 
Sbjct: 191 LAVLLLSGLILGILSRVFPQLNVFMLSFPINIGLA 225


>gi|27904583|ref|NP_777709.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|46395828|sp|Q89AZ0|FLIR_BUCBP RecName: Full=Flagellar biosynthetic protein fliR
 gi|27903980|gb|AAO26814.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 257

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 95/206 (46%), Gaps = 11/206 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +LF    R+ +     P  +  +I  +++L  A   S +   FL         VN A +S
Sbjct: 15  NLFFPAVRILALFSTAPLFNSKFIEKKIKLIMAFVISWIFSSFLPK-------VNIAIFS 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ ++ +G + GL +++    +  +G +IS  +GL+  +    +     + L+ 
Sbjct: 68  VDGILIIIEQMLIGILLGLTMQLIFSSIFMSGEIISLQMGLSFSSLFDFNSRSNLSALSH 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I  LL     + H  +  AL  ++ TIPI +     NIF   VN  +  F   + L 
Sbjct: 128 FVHIFLLLLFLEWNGHIWMLSALFDTFITIPIQKIYLDPNIFLKVVNFSKYIFFDSIMLL 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPI 212
            P +   ++ N+SIG+LN++ PQI I
Sbjct: 188 FPIIIVQLLLNLSIGILNRVAPQISI 213


>gi|269792926|ref|YP_003317830.1| flagellar biosynthetic protein FliR [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100561|gb|ACZ19548.1| flagellar biosynthetic protein FliR [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 259

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 98/207 (47%), Gaps = 12/207 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV   +M  P   +   P+ VR+  A+  S++++P +   + +         +   + E 
Sbjct: 19  RVLGLLMSSPVFMLPSWPIPVRMWLALMLSLLMVPSVDPQVPMVLLATWTGMAIFAVREF 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + GLL  +    LQ +G +  + +GL + T   + D   E  +  L  +  LL +W
Sbjct: 79  LVGAMVGLLSGLPLYALQLSGYLEGSQMGLAMAT---LFDPTQEGNVALLGQVKYLLGIW 135

Query: 138 VI---DFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +   + H  +  A+ +S+  IP+G+   +L  G  F  ++  L   F++ +R S P + 
Sbjct: 136 FLLHWNGHLVLIEAINRSFSLIPLGKGVLDLPPGQPFGRWITDL---FLLAIRFSLPIMG 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTP 218
             ++ ++ +G + + VPQI ++ +  P
Sbjct: 193 ALLLADVGLGFVARTVPQINVFILGIP 219


>gi|323493114|ref|ZP_08098245.1| putative flagellar biosynthetic protein FliR [Vibrio brasiliensis
           LMG 20546]
 gi|323312585|gb|EGA65718.1| putative flagellar biosynthetic protein FliR [Vibrio brasiliensis
           LMG 20546]
          Length = 258

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 102/218 (46%), Gaps = 9/218 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           RVG+  + +P    S IP+ VR   A++  +V  P +     +DL +  +     +  + 
Sbjct: 21  RVGAVFISMPFFGDSLIPVWVRSLLALSIVVVAAPLMPAMPAVDLFSLTSLFLAFEQAIW 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            LF G +  +L  ++T      G +IS  +GL +       + ++   L  +  I   L 
Sbjct: 81  GLFFGLILHMLFAIFTT----LGQIISMQMGLGMAMMNDPVNGMSVAILGRIFLIFSTLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H  +   L++S+   P+G  L+F + F   VN+    F   L L+ P +   ++
Sbjct: 137 FLSLEGHLVILDILIQSFRVWPVGSGLSFAS-FQGVVNLFSWMFASALALALPAIVSMLL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
            NIS G++N+  P + +Y +  P   L+GL S+ + +S
Sbjct: 196 ANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISIS 233


>gi|329943278|ref|ZP_08292052.1| bacterial export s, 1 family protein [Chlamydophila psittaci Cal10]
 gi|332287856|ref|YP_004422757.1| putative type III secretion inner membrane protein [Chlamydophila
           psittaci 6BC]
 gi|313848428|emb|CBY17432.1| putative type III export protein [Chlamydophila psittaci RD1]
 gi|325507239|gb|ADZ18877.1| putative type III secretion inner membrane protein [Chlamydophila
           psittaci 6BC]
 gi|328814825|gb|EGF84815.1| bacterial export s, 1 family protein [Chlamydophila psittaci Cal10]
 gi|328915118|gb|AEB55951.1| flagellar biosynthetic protein FliR, putative [Chlamydophila
           psittaci 6BC]
          Length = 289

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/224 (19%), Positives = 104/224 (46%), Gaps = 7/224 (3%)

Query: 25  LLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           ++P L     P  +++  A+++  ++ P +  +  + N+++   +  L++ E+ +G + G
Sbjct: 45  IVPFLGGKLFPAPIKIGIALSWVAIIFPKVLMSTHIANYLDDDMFYILIVKEICIGTLIG 104

Query: 85  LLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            ++       Q  GS I+   G+  L+ +  +      +P          +  W+   H 
Sbjct: 105 FILSFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGIFYHYFVTIVFWLSGGHR 164

Query: 144 QVFYALVKSYGTIPIGQELNF------GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            V   L++S   IPI + L          I+ + + M Q   ++ ++LS+P     ++ +
Sbjct: 165 IVLTILLQSLEVIPIHKFLPMEMMSLDAPIWVALIKMCQLCLIMTIQLSAPAAVAMLMSD 224

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +G++N++ PQ+ + ++ +     +G LFL L+   IV Q  +
Sbjct: 225 LFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIVKQIDY 268


>gi|296330852|ref|ZP_06873327.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674370|ref|YP_003866042.1| flagellar export machinery protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151857|gb|EFG92731.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412614|gb|ADM37733.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 259

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 109/235 (46%), Gaps = 12/235 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-RAYY 69
           +  L+  R+ +  + +P      +P   R+ FA   +++     + TID    +     Y
Sbjct: 10  AFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVIC----FSTIDKPPSLEIDGQY 65

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLI 128
             L   E  +G   GL+  +    +Q  GS I   +G ++   +    + A++PL    I
Sbjct: 66  MLLTFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVID-PQTGAQSPLIGQFI 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGN-IFSSFV-NMLQTTFMIMLRL 185
             + LL +  ++ HH +   +  S+  I + Q   NFG+  F+ F+       F+I  ++
Sbjct: 125 YTMALLFMLSVNAHHLLLDGIFYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFIIAFQM 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
           S+P +    + ++++G++ + VPQ+ ++ +  P  I +    L +C+S+  +V +
Sbjct: 185 SAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAISFIMLIVCMSVMFVVVR 239


>gi|322833208|ref|YP_004213235.1| flagellar biosynthetic protein FliR [Rahnella sp. Y9602]
 gi|321168409|gb|ADW74108.1| flagellar biosynthetic protein FliR [Rahnella sp. Y9602]
          Length = 261

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 102/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P  S   +P +V+L   M  + ++ P L   +D   F   A +  L
Sbjct: 17  FWPLLRILALISTAPITSEKSVPNRVKLGLGMMITFLIAPSL-PPVDTPIFSTPALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G+ +++    ++  G ++   +G++  T    S+ L    L   + ++ 
Sbjct: 74  AMQQIMIGTALGITMQLAFAAIRMAGEIMGLQMGISFATFYDPSNRLNTPLLAQFLNLLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   L  S+ T+PI         F +        F   + L+ P +  
Sbjct: 134 VLLFLSFNAHLWLISLLADSFHTLPISHNPVNAEGFMAVAKAGSIVFSGGMMLALPIVTL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ ++ I  P  + +G L + L + ++     H F
Sbjct: 194 LLTLNMALGLLNRVTPQLSVFVIGFPLTLSIGILAISLMMPMLAPFSEHLF 244


>gi|167037651|ref|YP_001665229.1| flagellar biosynthesis protein FliR [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116066|ref|YP_004186225.1| flagellar biosynthetic protein FliR [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856485|gb|ABY94893.1| flagellar biosynthetic protein FliR [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929157|gb|ADV79842.1| flagellar biosynthetic protein FliR [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 260

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 100/215 (46%), Gaps = 9/215 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT---IDLQNFVNRAYYS 70
           L+  R+    +L P      +P   ++      ++++    +DT   +DLQ   N   Y 
Sbjct: 16  LLFVRMLGIFILTPFFGTKNVPTTFKIGLGFFAAVIV----FDTMGPVDLQ-INNVLDYF 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +V+ E  +G V GL   +    +   G +I   +G  L   + I        + + I I
Sbjct: 71  IVVISEFIVGLVIGLASMISFSAIHLAGQLIDYQLGFGLVNILDIHSETQVPLMGNFIYI 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + +L   +++ H+ +F  L KS   IPIG+   +   +      M+   F++  R+S+P 
Sbjct: 131 LTILIFMLMNGHYTLFTMLAKSVDIIPIGKVAFDLSGMSQVLTKMVSDMFILGFRISAPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           +   ++ ++++G++++ +PQ+ ++ I  P  I +G
Sbjct: 191 ILTTLLTDLTLGIISRTIPQLNVFMIGMPAKIFVG 225


>gi|220929450|ref|YP_002506359.1| flagellar biosynthesis protein FliR [Clostridium cellulolyticum
           H10]
 gi|219999778|gb|ACL76379.1| flagellar biosynthetic protein FliR [Clostridium cellulolyticum
           H10]
          Length = 265

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 105/229 (45%), Gaps = 11/229 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFA-----MAFSIVLLPFLWDTIDLQNFVNRAY 68
           LI  R+    +  P      IP+  ++ FA     +A S++ +  + +T    NF+  A 
Sbjct: 17  LIFVRMTGLFVTAPIFGRRNIPVYYKVGFAFITAILASSVIRVDHIINT---DNFLIFAL 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y   ++ E  +G + G +       +   G +I   IG  +        ++      +L 
Sbjct: 74  Y---ILKEFLVGIIIGFVAYAVFTCIYLAGQIIDMQIGFGMVNVFDPISNIQIPVTANLY 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+ ++   + + HH +  AL +S+  IP+G  +    +    + ++Q  F +  ++++P
Sbjct: 131 FILSMIIFLLTNGHHMLIRALYESFQIIPLGSAVIGPKLKDDVIGIMQGVFSMGFKIAAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
            +    + ++ +G+++K +PQ+ ++ +  P  I +G L + ++I   VY
Sbjct: 191 IVAAIFITDVVLGIISKTIPQMNVFILGMPLKIFVGILIILITIPAFVY 239


>gi|307264885|ref|ZP_07546447.1| flagellar biosynthetic protein FliR [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306920143|gb|EFN50355.1| flagellar biosynthetic protein FliR [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 260

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 87/181 (48%), Gaps = 3/181 (1%)

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           N   Y  +V+ E  +G V GL   +    +   G +I   +G  L   + I        +
Sbjct: 65  NVLDYFIVVISEFIVGLVIGLASMISFSAIHLAGQLIDYQLGFGLVNILDIHSETQVPLM 124

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIML 183
            + I I+ +L   +++ H+ +F  L KS   IPIG+   +   I      M+   F++  
Sbjct: 125 GNFIYILTILIFMLMNGHYTLFTMLAKSVDIIPIGKVAFDLSGISQVLAKMVSDMFILGF 184

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLSIEIIVYQFSH 241
           R+S+P +   ++ ++++G++++ +PQ+ ++ I  P    +G+ +L + L + + +  F  
Sbjct: 185 RISAPIILTTLLTDLTLGIISRTIPQLNVFMIGMPAKIFVGIFTLLIMLPMYLTIIDFMF 244

Query: 242 S 242
           S
Sbjct: 245 S 245


>gi|225181593|ref|ZP_03735034.1| flagellar biosynthetic protein FliR [Dethiobacter alkaliphilus AHT
           1]
 gi|225167701|gb|EEG76511.1| flagellar biosynthetic protein FliR [Dethiobacter alkaliphilus AHT
           1]
          Length = 253

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 94/214 (43%), Gaps = 3/214 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           LFLI  R+ + I +LP  +   IP   ++ FA  F+ ++  FL  +          YY  
Sbjct: 9   LFLIFVRLSALIAVLPFFTWRGIPALPKIGFAGVFAYLI--FLASSPQEFEIPEHFYYYV 66

Query: 72  L-VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           L V  E+  G   G L+ +     +  G ++    GL + +          T       +
Sbjct: 67  LAVGSEVLFGLALGFLVLLIFAAARIAGQMVDVQAGLMMASVFDPQFGSQVTLFGQFYYL 126

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L+    ++ HH +F A+ +S   +  G  +    +  + +  +   F+I  +L+ P +
Sbjct: 127 FALVFYLTVNGHHMLFMAIARSIELVTPGGVVFSPQLIPNVMQFIFQMFIIAFQLAVPVV 186

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
              I  ++++GLL+K VPQ+ ++ +  P  +G+ 
Sbjct: 187 AVLIFSDLALGLLSKTVPQLHVFMVGMPLKVGVA 220


>gi|302392377|ref|YP_003828197.1| flagellar biosynthetic protein FliR [Acetohalobium arabaticum DSM
           5501]
 gi|302204454|gb|ADL13132.1| flagellar biosynthetic protein FliR [Acetohalobium arabaticum DSM
           5501]
          Length = 258

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 91/205 (44%), Gaps = 1/205 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ R+    +  P      IP +++   A   +++L P + D  +L+   N        
Sbjct: 14  LIMLRLTGLFLTAPFFGSRVIPKRIKAALAFLVTLILSP-VVDGSNLELPTNILILLFNF 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + EL +G + G +  +    +Q  G +IS  +GL +   M   +  +   +     ++  
Sbjct: 73  LSELTIGLIFGFITILIFASIQLAGQMISMRMGLAMANIMDPMNGSSIAVIGQFKNVLAT 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L   VI+ HHQ+  AL  S+  IP+        +F   + M    F +  +++ P +   
Sbjct: 133 LLFLVINGHHQLLRALKHSFDVIPLTGLRISDALFMKLLRMAGDLFPLAFQIALPIIAAL 192

Query: 194 IVFNISIGLLNKLVPQIPIYFISTP 218
            + +++ GL+ + VPQ+ ++ +  P
Sbjct: 193 FLTDVAFGLVARTVPQMNVFVMGLP 217


>gi|160880829|ref|YP_001559797.1| flagellar biosynthetic protein FliR [Clostridium phytofermentans
           ISDg]
 gi|160429495|gb|ABX43058.1| flagellar biosynthetic protein FliR [Clostridium phytofermentans
           ISDg]
          Length = 255

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 93/206 (45%), Gaps = 8/206 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY--YS 70
           F+I+ R+ + I   P  S+  +P +V++  ++  +I+L      TI     V      ++
Sbjct: 12  FVILVRISAFIYTGPFFSLKNVPQKVKIGLSLTLAIIL----NQTIPYSELVYEGVIGFA 67

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +++ E   G + G    +    L   G ++   IG ++        +   T   +    
Sbjct: 68  IVIVGEALAGAIMGFFSNICFQILSLAGQLMDMEIGFSMVNEFDPISNAQVTITANFYHY 127

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
             +L L + + HH +  ALV SY  IP+G  +LN   I++  V  +   F+I  R+  P 
Sbjct: 128 AVMLFLLITNMHHYIIKALVDSYQVIPVGGAKLN-PLIYTVMVQFVVDFFVIAFRIILPI 186

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFI 215
               ++ N+ + +L K+ PQ+ ++ I
Sbjct: 187 FASMLIVNVVLAILAKVAPQMNMFVI 212


>gi|260853446|ref|YP_003227337.1| putative lateral flagellar export pore protein [Escherichia coli
           O26:H11 str. 11368]
 gi|300817292|ref|ZP_07097510.1| flagellar biosynthetic protein FliR [Escherichia coli MS 107-1]
 gi|307315218|ref|ZP_07594797.1| flagellar biosynthetic protein FliR [Escherichia coli W]
 gi|331666525|ref|ZP_08367399.1| flagellar biosynthetic protein FliR [Escherichia coli TA271]
 gi|257752095|dbj|BAI23597.1| predicted lateral flagellar export pore protein [Escherichia coli
           O26:H11 str. 11368]
 gi|300530268|gb|EFK51330.1| flagellar biosynthetic protein FliR [Escherichia coli MS 107-1]
 gi|306905399|gb|EFN35936.1| flagellar biosynthetic protein FliR [Escherichia coli W]
 gi|315059467|gb|ADT73794.1| Flagellar biosynthetic protein fliR [Escherichia coli W]
 gi|323158015|gb|EFZ44116.1| flagellar biosynthetic protein FliR [Escherichia coli EPECa14]
 gi|323171039|gb|EFZ56688.1| flagellar biosynthetic protein FliR [Escherichia coli LT-68]
 gi|323181525|gb|EFZ66945.1| flagellar biosynthetic protein FliR [Escherichia coli 1357]
 gi|323379975|gb|ADX52243.1| flagellar biosynthetic protein FliR [Escherichia coli KO11]
 gi|331065749|gb|EGI37633.1| flagellar biosynthetic protein FliR [Escherichia coli TA271]
          Length = 260

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D I L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|150020742|ref|YP_001306096.1| flagellar biosynthetic protein FliR [Thermosipho melanesiensis
           BI429]
 gi|149793263|gb|ABR30711.1| flagellar biosynthetic protein FliR [Thermosipho melanesiensis
           BI429]
          Length = 254

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 103/216 (47%), Gaps = 26/216 (12%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           +++ R+    ++ P LS  +IP  V++   ++ S ++LP   ++I L   V     S  +
Sbjct: 16  MLISRITGMFIITPLLSGRFIPTTVKVFLVLSLSYMMLP-QTNSIPLNTPVIHIVLS--L 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG- 132
                +G   GL+  +        G ++    G  L TSM    ++ E+P      IIG 
Sbjct: 73  TNNFIVGFAMGLMAFMILGAFSIAGELLGVESGFGLATSM--DPTMEESP------IIGQ 124

Query: 133 ---LLALWV---IDFHHQVFYALVKSYGTIPIGQEL---NFGN-IFSSFVNMLQTTFMIM 182
              LLA++V   ++ H  V+ A++ S    P+  +    NF   I + FV M    F I 
Sbjct: 125 FVFLLAIFVFISLNGHLVVYEAILDSIKIFPLDLDFLDFNFTKFITTKFVEM----FFIA 180

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           L++  P + +  + N+ +G+L++LVPQ+ ++ +  P
Sbjct: 181 LKIGLPVIGYMFIINVLLGILSRLVPQMNVFMVGIP 216


>gi|113969637|ref|YP_733430.1| flagellar biosynthesis protein FliR [Shewanella sp. MR-4]
 gi|113884321|gb|ABI38373.1| flagellar biosynthetic protein FliR [Shewanella sp. MR-4]
          Length = 265

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 111/235 (47%), Gaps = 24/235 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  A+A ++ + P L    D + F   A +  ++ +++
Sbjct: 21  RVTSMLMVMVVFGATTTPTRVRLLLAVAITLAIAPVLPPVKDAELFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTQMVMQTFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  L    +D H  +   LV S+ T+PI    N G   +S+  + +     F   L +S
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETLPIS---NQGLTLTSYRALAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F  
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFEE 242


>gi|210134371|ref|YP_002300810.1| flagellar biosynthesis protein FliR [Helicobacter pylori P12]
 gi|210132339|gb|ACJ07330.1| flagellar biosynthetic protein [Helicobacter pylori P12]
          Length = 255

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  ESFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|15835467|ref|NP_297226.1| type III secretion inner membrane protein SctT [Chlamydia muridarum
           Nigg]
 gi|270285647|ref|ZP_06195041.1| type III secretion inner membrane protein SctT [Chlamydia muridarum
           Nigg]
 gi|270289656|ref|ZP_06195958.1| type III secretion inner membrane protein SctT [Chlamydia muridarum
           Weiss]
 gi|301337043|ref|ZP_07225245.1| type III secretion inner membrane protein SctT [Chlamydia muridarum
           MopnTet14]
 gi|7190878|gb|AAF39649.1| type III secretion inner membrane protein SctT [Chlamydia muridarum
           Nigg]
          Length = 289

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 108/235 (45%), Gaps = 7/235 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ S + L+P L     P  +++  A ++  V+ P +     + ++ +   +  L+
Sbjct: 33  LLSARMLSILALVPFLGAKLFPSPIKIGIAFSWMGVIFPKVIQDTTIAHYQDLDIFYILL 92

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIG 132
           + E+ +G + G L        Q  GS I+   G+  L+ +  +      +P         
Sbjct: 93  IKEIVIGVLIGFLFSFPFYAAQSAGSFITNQQGIQGLEGATSLVSIEQTSPHGIFYHYFV 152

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG----QELN--FGNIFSSFVNMLQTTFMIMLRLS 186
            +  W++  H  +   L++S   IPI     +E+      I+ + + M Q   ++ ++LS
Sbjct: 153 TIVFWLVGGHRIILSVLLQSLEVIPIHAVFPEEMMSLRAPIWIAILKMCQLCLIMTIQLS 212

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +P     ++ ++ +G++N++ PQ+ + ++ +     LG LFL L+   IV Q  +
Sbjct: 213 APAAVAMLMSDLFLGIINRMAPQVQVIYLLSALKAFLGLLFLTLAWWFIVKQIDY 267


>gi|332994109|gb|AEF04164.1| flagellar biosynthesis protein FliR [Alteromonas sp. SN2]
          Length = 259

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 99/236 (41%), Gaps = 2/236 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            L L   R+    + + GLS   IP QVR    +  +++++P +     + + VN   + 
Sbjct: 14  DLMLPFMRISGLFVAMIGLSAQSIPPQVRALLGIMLTLIIMPVV-PPAPVDDLVNLGTF- 71

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L + +L +G   G +  +        G +I+   GL   + +   + +    +     I
Sbjct: 72  ILGIQQLLIGVAIGFVSMMVLNTFVLAGQIIAMQTGLGFASIVDPVNGINVPAVGQFYLI 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L  W +D H  + + +V S+   PIG+    G  F    +     F+  + LS   +
Sbjct: 132 LATLLFWTLDGHLAMIHMIVLSFHAFPIGEAWWTGEQFREIAHWGGWMFVSAITLSLAPI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              ++ N++ G++ K  PQ+ I+ I       +G L + ++++     F   +L  
Sbjct: 192 VSLLIVNLAFGVMTKAAPQLNIFSIGFSIAQVMGLLIIWITLDNFTAHFETQWLRA 247


>gi|20807871|ref|NP_623042.1| flagellar biosynthesis protein FliR [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516435|gb|AAM24646.1| Flagellar biosynthesis/type III secretory pathway protein
           [Thermoanaerobacter tengcongensis MB4]
          Length = 260

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 109/233 (46%), Gaps = 13/233 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL---LPFLWDTIDLQNFVNRAYYS 70
           L+  R+    +L P     ++P   ++      S+++   +P +  +ID     N   Y 
Sbjct: 16  LLFVRMLGIFILAPFFGTKHVPTVFKIGLGFFASLIVFDVMPPVSISID-----NVLTYF 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
            LV+ E  +G   GL   +    +   G +I   +G  L   + I  S A+ PL  + I 
Sbjct: 71  LLVISEFLVGLTIGLASMISFSAVYLAGQLIDYQLGFGLVNILDIH-SEAQVPLMGNFIY 129

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           I+ +L   +++ H+ +F  L KS   IPIG+   +   +      M+   F I  R+S+P
Sbjct: 130 IMTILIFMLMNGHYLLFTFLAKSTEIIPIGKIYFDLSGMLQVLTKMVSDMFAIGFRISAP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQF 239
            +   ++ ++ +G++++ +PQ+ ++ +  P    +G+ +L + L + + +  F
Sbjct: 190 IILTTVLTDLVLGIISRTIPQLNVFMVGMPAKVFVGIFTLIIMLPMYLTIVDF 242


>gi|329897647|ref|ZP_08272171.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC3088]
 gi|328921096|gb|EGG28505.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC3088]
          Length = 238

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 107/232 (46%), Gaps = 8/232 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-E 76
           R+ + I+  P +S+  + + +R+  A+  + V+ P     I++ N    +    +++V E
Sbjct: 3   RISAMIIAAPLISLDVVSLPIRIVLAIVLTWVIYPL----IEVPNLNPLSPEGMVILVRE 58

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIGLLA 135
           +F+G    + ++V    L   G  +S ++GL +   M    S    P L+S + I   L 
Sbjct: 59  MFVGIAIAVTLQVVNGALILAGQALSMSMGLGMAQIM--DPSAGTVPVLSSFLIIFSTLI 116

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
                 H  +F+ +++S+  +PIG   +   +    +      F+  + ++ P +   ++
Sbjct: 117 FMSFGGHSLLFFLILQSFEFVPIGAAFDLDAVILKVMAWTSMVFLGGILIAMPIMLTMLL 176

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            N+ +G++ +  P + I+ +  P +I  G   L +++  I ++    ++  F
Sbjct: 177 VNLCLGIVTRSAPALNIFAVGFPAMILAGLALLIINLTNIAHRIEWLWVEAF 228


>gi|218133681|ref|ZP_03462485.1| hypothetical protein BACPEC_01550 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991056|gb|EEC57062.1| hypothetical protein BACPEC_01550 [Bacteroides pectinophilus ATCC
           43243]
          Length = 260

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 102/206 (49%), Gaps = 14/206 (6%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ---NFVNRAYYS 70
           LI+ R+ + +   P  + +  P +V++ F+ A +I++      T+DL     +     Y+
Sbjct: 16  LILVRISTFVYAAPFFNTANTPNRVKIGFSFALAILVY-----TLDLGITYTYSGMLDYA 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP---LNSL 127
            +V+ E  +G + G         + F+G +I   +G+++ T   I D   +T    +++L
Sbjct: 71  AIVLSEAAVGLLLGYAANASVQIIMFSGHIIDVDMGISMAT---IFDPTTKTQVGIMSNL 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  L L V   +  +  A+V +Y  IPIGQ     +++++ V+ +   F+I  R++ 
Sbjct: 128 YYYLLSLLLIVSGLYRYLVSAIVDTYKVIPIGQAAFRPSLYTTIVDFIGDYFVIGFRIAL 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIY 213
           P     ++ N  +G+L ++ PQ+ ++
Sbjct: 188 PMFACMMLLNCILGVLARIAPQMNMF 213


>gi|212709500|ref|ZP_03317628.1| hypothetical protein PROVALCAL_00542 [Providencia alcalifaciens DSM
           30120]
 gi|212687838|gb|EEB47366.1| hypothetical protein PROVALCAL_00542 [Providencia alcalifaciens DSM
           30120]
          Length = 259

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 78/160 (48%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   GL +++    ++  G VI   +GL+  T    +       L  ++ +I LL 
Sbjct: 77  QIVIGAAMGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRILNLITLLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + Y L  S+  +PI       + F  F+    T F+  L L+ PF+  +++
Sbjct: 137 FLSFDGHLWLIYILTNSFELLPIQTTPLHRDGFWIFLQFANTIFINGLMLALPFITLFLI 196

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            N+S+G+LN++ PQ+ ++ +  P  + +G   L L I I+
Sbjct: 197 LNLSLGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISIL 236


>gi|225159016|ref|ZP_03725326.1| type III secretion system inner membrane R protein [Opitutaceae
           bacterium TAV2]
 gi|224802395|gb|EEG20657.1| type III secretion system inner membrane R protein [Opitutaceae
           bacterium TAV2]
          Length = 252

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 95/220 (43%), Gaps = 14/220 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R    +MLLP      +P  +R+  A  F  +L   +     +       + ++  + E+
Sbjct: 15  RALGVVMLLPVPGGKVLPAMLRVACAFMFPTLLAGII-PHAPMPEPPGWPWLAEAAVREM 73

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            LG   G + R+   G +  G +I+  +GL       +    ++ PL + IG    L  +
Sbjct: 74  VLGLALGFVGRLVFAGAELAGRLIANELGLVAAPGFDVPTP-SQEPLPAFIGSFAGLMFF 132

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM--LRLSSPFLFFYIV 195
           ++  H     A V+S+   P G    F ++ +     + T  +I   +R+++PF+    V
Sbjct: 133 LMGGHEGALAAFVRSFDFAPAGAA-RF-SVLAGETLTICTAQVIEFGMRMAAPFIALNFV 190

Query: 196 FNISIGLLNKLVPQIPIYFISTPY--------LIGLGSLF 227
            +++  +L + VP++ ++ IS P         L G G LF
Sbjct: 191 ISLAFSILGRAVPRMNVFIISYPVRTLVGLSLLAGAGGLF 230


>gi|254478864|ref|ZP_05092228.1| flagellar biosynthetic protein FliR [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035177|gb|EEB75887.1| flagellar biosynthetic protein FliR [Carboxydibrachium pacificum
           DSM 12653]
          Length = 260

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 109/233 (46%), Gaps = 13/233 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL---LPFLWDTIDLQNFVNRAYYS 70
           L+  R+    +L P     ++P   ++      S+++   +P +  +ID     N   Y 
Sbjct: 16  LLFVRMLGIFILAPFFGTKHVPTVFKIGLGFFTSLIVFDVMPLVPISID-----NVLTYF 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
            LV+ E  +G   GL   +    +   G +I   +G  L   + I  S A+ PL  + I 
Sbjct: 71  LLVISEFLVGLTIGLASMISFSAVYLAGQLIDYQLGFGLVNILDIH-SEAQVPLMGNFIY 129

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           I+ +L   +++ H+ +F  L KS   IPIG+   +   +      M+   F I  R+S+P
Sbjct: 130 IMTILIFMLMNGHYLLFTFLAKSTEIIPIGKVYFDLSGMSQVLTKMVSDMFAIGFRISAP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLSIEIIVYQF 239
            +   ++ ++ +G++++ +PQ+ ++ +  P    +G+ +L + L + + +  F
Sbjct: 190 IILTTVLTDLILGIISRTIPQLNVFMVGMPAKVFVGIFTLIIMLPMYLTIVDF 242


>gi|226313052|ref|YP_002772946.1| flagellar biosynthesis protein FliR [Brevibacillus brevis NBRC
           100599]
 gi|226096000|dbj|BAH44442.1| flagellar biosynthetic protein FliR [Brevibacillus brevis NBRC
           100599]
          Length = 260

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 96/213 (45%), Gaps = 16/213 (7%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY-YSKL 72
           L+  R+ +  +  P  S+  +P Q ++  A+AF I ++ F   ++ +Q  +     +   
Sbjct: 13  LVFVRMSAFFVTAPFFSIRGVPNQFKI--ALAFIIAVISF--QSLPVQGEIPMDLTFVMY 68

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+ E  +G + G +  +  + +Q  G ++   +GL +   +            +   I+ 
Sbjct: 69  VIKEALVGVILGYICEMMFIAIQVAGGLMDMQMGLAMANVIDPKTGAYIPVTGNFKNILA 128

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPI-------GQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +L  + ID HH +   ++ SY  IP+       G E        +F+ M  + FMI    
Sbjct: 129 VLYFFSIDGHHMLIRGVISSYQVIPVDIMWAAFGSENVMMTAVKTFLTMFTSAFMI---- 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           ++P +    + ++S+G++ K VPQ  I+ +  P
Sbjct: 185 AAPIVVALFLVDLSLGIIAKSVPQFNIFVVGLP 217


>gi|21231362|ref|NP_637279.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768585|ref|YP_243347.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991604|ref|YP_001903614.1| hypothetical protein xccb100_2210 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113024|gb|AAM41203.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573917|gb|AAY49327.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733364|emb|CAP51565.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 263

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 85/207 (41%), Gaps = 29/207 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R G+ +  +P +    +P +VR+      ++ L P L    +   F   A  S  +  EL
Sbjct: 27  RTGALLTAMPLIGTRAVPGRVRVMLTGTLAMALAPILPPVPEWDGFNATAVLS--IAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G ++R+        G ++S A GL+      +SD     PL  +    G++A W
Sbjct: 85  AVGASMGFMLRLIFEAGALAGELVSQATGLSFAQ---MSD-----PLRGVTS--GVIAQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR--- 184
                       + H  V   LV SY  +PIG  +      ++F  +  T  + +LR   
Sbjct: 135 FYIGFGLLFFAANGHLAVIALLVDSYKALPIGTAVPDA---AAFAEVAPTLLLQVLRGGL 191

Query: 185 -LSSPFLFFYIVFNISIGLLNKLVPQI 210
            L+ P +   +  N++ G L K  P +
Sbjct: 192 TLALPMMVAMLAVNLAFGALAKAAPAL 218


>gi|162139929|ref|YP_339328.2| flagellar biosynthesis protein FliR [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 259

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 103/233 (44%), Gaps = 14/233 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R+ S IM++ GL    +P ++++  A+  + V +P L        F N   +  +++V  
Sbjct: 21  RISSMIMVMAGLGAKNVPTRIKMGLAIVVTFVAVPML----PPATFTNLFSFEMILVVIQ 76

Query: 76  ELFLGCVHG----LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           ++ +G   G    LL+  + L     G +++   GL   + +  S+ L+   +     I+
Sbjct: 77  QMLIGIAIGFASTLLLNTFVLA----GQILAMQTGLGFASVVDPSNGLSVPAVGQFYLIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L  +V + H  +   +V S+  +PI       + +   V      F   L LS   L 
Sbjct: 133 ATLLFFVFNGHLMMIQMVVHSFEVLPIDGNWWSVDHYWDIVTWGGWMFTTALVLSLAPLT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             +V N+S G++ +  PQ+ I+ I  P+ +  G + +  ++   V QF   +L
Sbjct: 193 AMLVINMSFGIMTRAAPQLNIFSIGFPFTLVAGLIIIWATLGNFVSQFEFQWL 245


>gi|149182521|ref|ZP_01860994.1| flagellar biosynthesis protein R [Bacillus sp. SG-1]
 gi|148849781|gb|EDL63958.1| flagellar biosynthesis protein R [Bacillus sp. SG-1]
          Length = 258

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 16/227 (7%)

Query: 10  MSLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +S+FL+V  RV +  + LP  S   IP Q R+ FA   + ++    + TID       A 
Sbjct: 8   LSIFLLVFMRVSAFFVTLPLFSYRSIPAQHRVGFAGVIAWIM----YYTIDASPMPIDAA 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNL----QTSMGISDSLAETPL 124
           Y  L+M E  +G + G    +    +Q  GS I   +G  +        G    L    L
Sbjct: 64  YILLIMKEAMIGLLIGFTAYMIISAIQVAGSFIDFQMGFAIANVIDPQTGAQSPLVGQYL 123

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGN--IFSSFVNMLQTTFMI 181
            +   ++ L           VFY    SY  IP+ Q  + FGN  +    V    + F+I
Sbjct: 124 YTFALLLLLALDGHHLLLDGVFY----SYQFIPVDQPWIPFGNENLVEYIVKTFNSVFII 179

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
             ++S P +    + ++++G++ + VPQ+ ++ +  P  I +  L L
Sbjct: 180 AFQMSIPVVATLFLVDVALGIVARTVPQLNVFVVGFPIKIAVSFLVL 226


>gi|302874605|ref|YP_003843238.1| flagellar biosynthetic protein FlhB [Clostridium cellulovorans
           743B]
 gi|307690784|ref|ZP_07633230.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           cellulovorans 743B]
 gi|302577462|gb|ADL51474.1| flagellar biosynthetic protein FlhB [Clostridium cellulovorans
           743B]
          Length = 607

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 107/239 (44%), Gaps = 11/239 (4%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           ++L LI  R+    +  PG+  +  P  ++    +  + ++LP     I+          
Sbjct: 8   VALILITLRLAGMFIAAPGILPTGTPNILKAVLILILAYMVLP----VINYSGASALTEP 63

Query: 70  SKLV---MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +KL+   + E   G   G +I ++ +  +  GS+I   +G ++ T    + +   T L  
Sbjct: 64  TKLIIQCLNEFSTGLAVGFIINLFFIAARIAGSIIDMQVGFSMVTLFDPTANSTATYLER 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +I ++  ++ID HH V  A + +Y  + IG            + +    + I ++++
Sbjct: 124 FFNLIAIMIFFIIDGHHYVIKAFIATYDKVSIGVFFLDQGTLQEILKLFGHFYAIGVKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLSIEIIVYQFSHSF 243
            P +   +V ++ +G+L++ +PQ+ I  +  P   LIG G   L +S    V   ++SF
Sbjct: 184 LPIILVILVADVLMGVLSRTMPQLNIMILGMPVKLLIGFG--ILAVSAPFFVRLITNSF 240


>gi|121997284|ref|YP_001002071.1| flagellar biosynthetic protein FliR [Halorhodospira halophila SL1]
 gi|121588689|gb|ABM61269.1| flagellar biosynthetic protein FliR [Halorhodospira halophila SL1]
          Length = 263

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/211 (18%), Positives = 95/211 (45%), Gaps = 2/211 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+  ++ P      +P+QVR+   +A +I +LP + +   +           + + E+
Sbjct: 21  RIGAAALVAPVFGNDMVPLQVRVFIGVALTIAVLPAVGEVPPVDPLSPDGLL--IAVQEI 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G+++ +        G  I+ A+GL   T +     ++   ++ L+  I  L   
Sbjct: 79  LVGLTIGMVLALALNTAVIAGESIALAMGLGFATMVDPQTGMSVPVISQLLLTIVTLLFL 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            +  H  +   L  S+  +PIG+ +   ++F          +   + ++ P +   +V N
Sbjct: 139 AVGGHLMLIQLLADSFSAVPIGEIVLDRDVFWGVAAWGTQMYAGAVLIALPLVTVLLVIN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
           +S+G++ +  PQ+ ++ +  P  I +G + +
Sbjct: 199 LSLGVMTRAAPQMNVFSVGLPLTILVGGVLM 229


>gi|120598262|ref|YP_962836.1| flagellar biosynthesis protein FliR [Shewanella sp. W3-18-1]
 gi|146293660|ref|YP_001184084.1| flagellar biosynthesis protein FliR [Shewanella putrefaciens CN-32]
 gi|120558355|gb|ABM24282.1| flagellar biosynthetic protein FliR [Shewanella sp. W3-18-1]
 gi|145565350|gb|ABP76285.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens CN-32]
 gi|319427059|gb|ADV55133.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens 200]
          Length = 265

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 110/235 (46%), Gaps = 24/235 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  AMA +  + P L    +   F   A +  ++ +++
Sbjct: 21  RVASMLMVMVVFGAATTPARVRLLLAMAITFAIAPVLPPVENADLFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVSQMVMQTFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  L    +D H  +   LV S+ T+PI    N G   +S+ ++ +     F   L +S
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETLPIS---NQGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F  
Sbjct: 188 ISAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFDE 242


>gi|89897881|ref|YP_514991.1| type III secretion flagellar biosynthesis inner membrane protein
           [Chlamydophila felis Fe/C-56]
 gi|89331253|dbj|BAE80846.1| type III secretion flagellar biosynthesis inner membrane protein
           [Chlamydophila felis Fe/C-56]
          Length = 289

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/224 (19%), Positives = 105/224 (46%), Gaps = 7/224 (3%)

Query: 25  LLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           ++P L     P  +++  A+++  ++ P +  +  + N+++   +  L++ EL +G + G
Sbjct: 45  IVPFLGGKLFPAPIKIGIALSWVAIIFPKVLMSTHIANYLDDDIFYFLIIKELCIGTLIG 104

Query: 85  LLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            ++       Q  GS I+   G+  L+ +  +      +P          +A W+   H 
Sbjct: 105 FILAFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGIFYHYFVTIAFWLSGGHR 164

Query: 144 QVFYALVKSYGTIPIGQELNF------GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            V   L+++   IPI + L          ++ + + M Q   ++ ++LS+P     ++ +
Sbjct: 165 IVLTILLQTLEVIPIHKFLPAEMMSLDAPVWIALIKMCQLCLVMTIQLSAPAAVAMLMSD 224

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +G++N++ PQ+ + ++ +     +G LF+ L+   IV Q  +
Sbjct: 225 LFLGIINRMAPQVQVIYLLSALKAFMGLLFITLAWWFIVKQIDY 268


>gi|218887106|ref|YP_002436427.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758060|gb|ACL08959.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 264

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 110/236 (46%), Gaps = 13/236 (5%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M+S  L   RV   + LLP       P QV+    + F++ L    W  + L       +
Sbjct: 11  MLSFLLTFMRVSLVLFLLPFFGGEAAPTQVKAALCLVFTLAL----WPHVSLPGGQMPTH 66

Query: 69  YSKLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL--AETP 123
              L+++   EL +G + G+ +     G+Q  G V++T +G  + T   ++D L  A   
Sbjct: 67  PFSLIVLLAGELIMGLMLGMTVHFLFAGIQTGGQVLATQMGFTMIT---LADPLTGANVS 123

Query: 124 LNS-LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
           + S  + ++ +L+  V+D H  +  A V+++  +P G  L    +    + +  + F++ 
Sbjct: 124 ITSHFLYMVAMLSFLVLDGHLYMLRAFVRTFELVPAGGLLLTPMLVKEVLALSGSMFVLA 183

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
           +++++P L    +  +++ L+ +  PQ+ +  I  P  I +G  F+ +   I+  +
Sbjct: 184 VKIAAPVLVSLFLVELALALMARAAPQMNLLMIGFPLKIAVGFFFIGMLFTIMADK 239


>gi|77457778|ref|YP_347283.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens Pf0-1]
 gi|77381781|gb|ABA73294.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens Pf0-1]
          Length = 261

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 105/228 (46%), Gaps = 13/228 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           RV S +M++P    + +P ++RL FA A ++V+ P L        +DL   +       L
Sbjct: 25  RVASMLMVMPVFGTTLVPRRIRLYFAFAITVVITPNLPPMPAVSPLDLSGLL-------L 77

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  ++ +G V G  ++++       G +++  +G+   + +  ++ ++   +     ++ 
Sbjct: 78  IAEQILVGAVLGFSLQLFFQAFVVAGQIVAIQMGMGFASMIDPTNGVSVAVIGQFFTMLV 137

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            L    ++ H  VF  L +S+ T+P+G  L   + +      L       L L  P +  
Sbjct: 138 TLLFLSMNGHLVVFEVLTESFTTLPVGGGLMTTH-YWELAGKLGWVLGAALLLVLPAVTA 196

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +V NI+ G++ +  PQ+ I+ I  P  + LG   + + +  I+ Q+ 
Sbjct: 197 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGLFIVWVGLADILNQYQ 244


>gi|15606960|ref|NP_214342.1| flagellar biosynthetic protein FliR [Aquifex aeolicus VF5]
 gi|6225369|sp|O67773|FLIR_AQUAE RecName: Full=Flagellar biosynthetic protein fliR
 gi|2984202|gb|AAC07732.1| flagellar biosynthetic protein FliR [Aquifex aeolicus VF5]
          Length = 258

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 106/224 (47%), Gaps = 17/224 (7%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDL 60
            ++ E  +++L L   R+ S +   P      IP  +RL  A A S  +L F+  T + +
Sbjct: 3   KVTSEEFLITLLLSYFRIVSFLFTFPFYGSFLIPNTIRLYLAFALSFAVLSFINITPVKV 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN-LQTSM-GISDS 118
             FV    Y+   + EL  G   GL++R+    L   G +I+   GL  LQ  + G++  
Sbjct: 63  NTFVEFLVYA---LNELLFGFSAGLILRLLFDALIIAGELIALHTGLGFLQMFIPGMTQM 119

Query: 119 LAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIF----SSFVNM 174
              +   +L G +  L+L   +F   +   L +S+  +P+G      NIF      F+N 
Sbjct: 120 SLFSGFFTLYGTLIFLSLGGGEF---IILGLAESFKRLPVGSF----NIFYLNPEVFLNF 172

Query: 175 LQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
              +F + ++++ P +   ++ N+ + ++N+ +PQ+ ++ +  P
Sbjct: 173 FYESFRLGVKIAMPLILTALILNLVLAVVNRFIPQMNVFMVGLP 216


>gi|73539699|ref|YP_300066.1| flagellar biosynthesis protein FliR [Ralstonia eutropha JMP134]
 gi|72123036|gb|AAZ65222.1| Flagellar biosynthesis protein FliR [Ralstonia eutropha JMP134]
          Length = 261

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 88/203 (43%), Gaps = 10/203 (4%)

Query: 32  SYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK----LVMVELFLGCVHGLLI 87
           S IP +V++  A   ++V+ P       L N      YS     +++ E+ +G   G  +
Sbjct: 36  STIPGRVKVGLAALTAMVVSP------TLGNLPVVPVYSWQGLIIILNEVGIGLATGFTM 89

Query: 88  RVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFY 147
           R+    +Q  G +I   +GL   +    +       L   + II +L    +D H  +  
Sbjct: 90  RLVFAIVQQAGEIIGMQMGLGFASFFDRAAGGQTMVLARFLNIIAVLLFLAMDGHLLMLG 149

Query: 148 ALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLV 207
           ALV S+  +PIG     G  + +        F   L L+ P +   +  N+++G+LN+  
Sbjct: 150 ALVDSFQGLPIGATPVSGEGWHAVARAGGMVFSSGLLLALPMIAALLTLNLAMGILNRAS 209

Query: 208 PQIPIYFISTPYLIGLGSLFLCL 230
           PQ+ I+ +  P  +  G L L L
Sbjct: 210 PQLSIFAVGFPVTLSGGLLVLAL 232


>gi|194365645|ref|YP_002028255.1| flagellar biosynthetic protein FliR [Stenotrophomonas maltophilia
           R551-3]
 gi|194348449|gb|ACF51572.1| flagellar biosynthetic protein FliR [Stenotrophomonas maltophilia
           R551-3]
          Length = 263

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 80/204 (39%), Gaps = 23/204 (11%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+  M +P +    +P +VR+  A   +I L P L    D   F   A     +  EL
Sbjct: 27  RIGAVAMAMPMVGTRAVPARVRVVLAGTLAIALAPLLPPVPDWTGF--DAATVLTIAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G L+R+        G +I+   GL       +SD     PL    G  G++  W
Sbjct: 85  AIGVSIGFLLRLVFEAGAMAGELIAQGTGLAFAQ---MSD-----PLRG--GTSGVIGQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRLS 186
                       + H  +   +V SY  +PIG  L   + F S     L T     L L+
Sbjct: 135 FYLLFGLLFFTANGHLALISLVVDSYRALPIGAPLPDPHAFFSIAPTFLLTVLRGALTLA 194

Query: 187 SPFLFFYIVFNISIGLLNKLVPQI 210
            P     +  N++ G+L +  P +
Sbjct: 195 IPLTVAMLAVNLAFGVLARAAPAL 218


>gi|150019066|ref|YP_001311320.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           beijerinckii NCIMB 8052]
 gi|149905531|gb|ABR36364.1| flagellar biosynthetic protein FlhB [Clostridium beijerinckii NCIMB
           8052]
          Length = 613

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 71/146 (48%), Gaps = 4/146 (2%)

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +M  L LG +  L+ +V    ++  G  +    G ++ + +  +     T L +L   I 
Sbjct: 74  IMSGLILGYITNLIFQV----VKLAGEWMDIHAGFSMVSVLDPTTQTTSTLLGNLSYFIS 129

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L   +++D HH V   LV+S   IPIG+ + +       +  +   F + ++++ P +  
Sbjct: 130 LAFFFIVDGHHVVINMLVESTKIIPIGKTIVYQETLMEVMKTIFDYFTLGVKIAIPIVLI 189

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP 218
            ++ ++ +GL+++ VP IPI  +  P
Sbjct: 190 IVITDVCLGLISRTVPTIPIMILGMP 215


>gi|109946963|ref|YP_664191.1| flagellar biosynthesis protein FliR [Helicobacter acinonychis str.
           Sheeba]
 gi|109714184|emb|CAJ99192.1| flagellar biosynthesis protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 255

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 102/237 (43%), Gaps = 13/237 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N  Y  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNATYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-N 125
           +      + ELFLG    + +++    L F    IS ++GL +  S+    S A+ P+  
Sbjct: 68  ESFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTM-ASVYDPISGAQKPIVG 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   +
Sbjct: 127 QALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFIIGFSM 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P L   ++ +I  G++ K  PQ  +  I  P  I +G + + L +  I+ +F   
Sbjct: 187 AFPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIVSAIMGRFKDE 243


>gi|134300233|ref|YP_001113729.1| flagellar biosynthesis protein FliR [Desulfotomaculum reducens
           MI-1]
 gi|134052933|gb|ABO50904.1| flagellar biosynthetic protein FliR [Desulfotomaculum reducens
           MI-1]
          Length = 255

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 54/105 (51%)

Query: 139 IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNI 198
           +D HH +  ALVKSY  +P+      G +    + +   TF + +++ +P +   ++ ++
Sbjct: 136 MDGHHALIRALVKSYELVPLTAAAMNGELTLLIIRIFTDTFALAVQICAPVVAVLVITDL 195

Query: 199 SIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++GL+ K  PQ+ I+ +  P  I +G   L + +  +   F + F
Sbjct: 196 AMGLIGKTAPQLNIFQLGFPLKIAVGVSTLAILLPALTSVFKYLF 240


>gi|331671780|ref|ZP_08372576.1| flagellar biosynthetic protein FliR [Escherichia coli TA280]
 gi|331070769|gb|EGI42128.1| flagellar biosynthetic protein FliR [Escherichia coli TA280]
          Length = 277

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 101/216 (46%), Gaps = 21/216 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 39  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 91

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 92  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 151

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 152 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 207

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGL 223
            F  ++     GLLN++ P + ++ +  P   L+GL
Sbjct: 208 TFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLVGL 243


>gi|307824491|ref|ZP_07654716.1| flagellar biosynthetic protein FliR [Methylobacter tundripaludum
           SV96]
 gi|307734475|gb|EFO05327.1| flagellar biosynthetic protein FliR [Methylobacter tundripaludum
           SV96]
          Length = 238

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 107/225 (47%), Gaps = 6/225 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ +  + +P  S+  +P +VRL  ++  ++V++P L     ++ F    + + +   ++
Sbjct: 2   RISAMFVAVPLFSIKAVPARVRLILSVVITLVVMPLLPPLPSVEMFSYAGFMTAIA--QV 59

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIGLLAL 136
            +G   G ++++      F G  ++ ++GL   + M    S  + P +  L  +   L  
Sbjct: 60  MIGLTTGFILQLVFAAAVFAGQSVALSMGLGF-SMMVDPQSGQQVPVIAQLYTVTTTLIF 118

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
             +D H  +   L+ S+ T+PIG + ++   I+S  +      F   L L+ P +   ++
Sbjct: 119 ISLDGHLLLIQMLLDSFKTLPIGIDGIDKAGIWS-IIAWSSRMFAGGLLLTMPIIASLLL 177

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            NI  G+  +  PQ+ I+ +  P  + LG L +  ++  ++ QFS
Sbjct: 178 VNIIFGVAARAAPQLQIFSVGIPVTLMLGLLLIWKTLPDVLDQFS 222


>gi|300936101|ref|ZP_07151042.1| flagellar biosynthetic protein FliR [Escherichia coli MS 21-1]
 gi|300458750|gb|EFK22243.1| flagellar biosynthetic protein FliR [Escherichia coli MS 21-1]
          Length = 260

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQN 62
           +++ L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L +
Sbjct: 12  LVLGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            +       L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T
Sbjct: 72  LI-------LTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTT 124

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTF 179
            L  LI +  +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  
Sbjct: 125 VLAELINVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASAS 184

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           ++ L    P  F  ++     GLLN++ P + ++ +  P
Sbjct: 185 LLAL----PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|331640692|ref|ZP_08341839.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
 gi|331040066|gb|EGI12274.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
          Length = 277

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 39  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 91

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 92  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 151

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 152 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 207

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 208 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 236


>gi|306813327|ref|ZP_07447520.1| flagellar biosynthetic protein FliR [Escherichia coli NC101]
 gi|305854090|gb|EFM54529.1| flagellar biosynthetic protein FliR [Escherichia coli NC101]
          Length = 260

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 96/209 (45%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S +  +VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYMPVLDNSALTARVRIILSLALAIIITPLIPHPVPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|255323533|ref|ZP_05364664.1| flagellar biosynthetic protein FliR [Campylobacter showae RM3277]
 gi|255299570|gb|EET78856.1| flagellar biosynthetic protein FliR [Campylobacter showae RM3277]
          Length = 253

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 103/226 (45%), Gaps = 16/226 (7%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF 63
           +PE ++ +  L+  R+G  ++  P      IPM V+     AFS +L  FL+    ++N 
Sbjct: 8   APERVI-TFMLLFARIGGLMLFFPFYGHEQIPMSVK----TAFSFLLTLFLFPLASIKN- 61

Query: 64  VNRAYYSKLVMV-ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
               YY  + +V E  LG   GLL+ +    LQ  G  IS  +G ++ + +     L+  
Sbjct: 62  -GEIYYLAVEIVSEAALGVCAGLLLHIVFASLQLAGEQISMIMGFSMASVLDPQTGLSSP 120

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIF----SSFVNMLQTT 178
            ++++I  + L+     D HH +   +  S   +P+G      +I      S +N+    
Sbjct: 121 VISNIINFLALMTFLAFDGHHLILLFISNSLTHVPLGGFYPSPDIVQYASKSMINLFTFG 180

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           F+I    S P L   ++ ++  G+L K +PQ  +  +  P  I +G
Sbjct: 181 FII----SFPILALSLLSDLIFGMLMKTMPQFNLLVVGYPIKITIG 222


>gi|254445194|ref|ZP_05058670.1| Bacterial export protein, family 1 [Verrucomicrobiae bacterium
           DG1235]
 gi|198259502|gb|EDY83810.1| Bacterial export protein, family 1 [Verrucomicrobiae bacterium
           DG1235]
          Length = 256

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 109/231 (47%), Gaps = 16/231 (6%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ RV    +  P  S   IP+  ++  A AF++++ P     +D     N A    L 
Sbjct: 12  LILTRVLGLFLAAPVFSHKSIPVIAKVTLAAAFAMMVFPM----VD-HEVANPASIWSLT 66

Query: 74  M---VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE-TPLNSLIG 129
           +    EL +G + G+ IR+    L F   VI+  IGL    +     S ++  PL ++I 
Sbjct: 67  LWFAKELTVGLMMGIAIRMVFFVLDFASHVITVEIGLQPGPAFDPGSSSSQGNPLGTII- 125

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTT--FMIMLRLS 186
               L L +    + +  A ++S+   PIG    FG N F++   +L+T   F I + + 
Sbjct: 126 YFLGLMLLLSGSEYNMLRAFMRSFEIAPIG---FFGLNSFAADFIILKTADIFRIGILMG 182

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
           +P +    + N+    L K+VP++ ++ +S    I LG+  L L++ ++ +
Sbjct: 183 APIVAVNFLVNLVFATLGKVVPKLNVFILSFSARIFLGTTVLTLTVGLLAH 233


>gi|208434126|ref|YP_002265792.1| flagellar biosynthetic protein [Helicobacter pylori G27]
 gi|208432055|gb|ACI26926.1| flagellar biosynthetic protein [Helicobacter pylori G27]
          Length = 255

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F + AY  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSSAAYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPKLAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|218703504|ref|YP_002411023.1| Flagellar biosynthetic protein fliR [Escherichia coli UMN026]
 gi|293403335|ref|ZP_06647426.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298378946|ref|ZP_06988827.1| flagellar biosynthetic protein FliR [Escherichia coli FVEC1302]
 gi|300898062|ref|ZP_07116431.1| flagellar biosynthetic protein FliR [Escherichia coli MS 198-1]
 gi|59889760|emb|CAH19115.1| Lateral flagellar export/assembly protein (FliR-like) [Escherichia
           coli]
 gi|218430601|emb|CAR11467.1| Flagellar biosynthetic protein fliR [Escherichia coli UMN026]
 gi|284920024|emb|CBG33080.1| flagellar biosynthetic protein [Escherichia coli 042]
 gi|291429188|gb|EFF02208.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298280059|gb|EFI21563.1| flagellar biosynthetic protein FliR [Escherichia coli FVEC1302]
 gi|300358240|gb|EFJ74110.1| flagellar biosynthetic protein FliR [Escherichia coli MS 198-1]
          Length = 260

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 101/216 (46%), Gaps = 21/216 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP--YLIGL 223
            F  ++     GLLN++ P + ++ +  P   L+GL
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLVGL 226


>gi|90021815|ref|YP_527642.1| flagellar biosynthetic protein FliR [Saccharophagus degradans 2-40]
 gi|89951415|gb|ABD81430.1| flagellar biosynthetic protein FliR [Saccharophagus degradans 2-40]
          Length = 261

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 106/246 (43%), Gaps = 12/246 (4%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-----TIDLQ 61
           +++   FL  CR+G+  + +P L    +  +VRL  A   +++++P L        + +Q
Sbjct: 13  LLLQQYFLPFCRIGAMFLAMPILGSQLVSPRVRLGLAFIVTLMVVPMLGSIPKVSGLSVQ 72

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
            F+   Y S+    E+ LG   G   +V        G +I+  +GL   +     + +  
Sbjct: 73  TFI---YISQ----EILLGLAAGYCFQVAFQVFVLAGQLIAMKMGLGFASMNDPVNGVQT 125

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
           T ++    ++  L    ++ H  +   LV+S+ T P G  +   N      N+    F  
Sbjct: 126 TAISQFYLMLVTLMFVSVNGHLVMINMLVESFVTFPPGGFIFSTNTMWKIANVGTWLFAA 185

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L ++ P L   +  NI+ G++++  PQ+ I+ I  P+ +  G L + L +      F  
Sbjct: 186 GLLMALPVLTALLFINIAFGIMSRAAPQLNIFAIGFPFTLLCGLLMIWLGLVTFDSNFES 245

Query: 242 SFLYGF 247
               GF
Sbjct: 246 VMDDGF 251


>gi|317179432|dbj|BAJ57220.1| flagellar biosynthesis protein FliR [Helicobacter pylori F30]
          Length = 255

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 91/218 (41%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N  Y  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNATYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|293408346|ref|ZP_06652185.1| flagellar biosynthetic protein FliR [Escherichia coli B354]
 gi|291471524|gb|EFF14007.1| flagellar biosynthetic protein FliR [Escherichia coli B354]
          Length = 260

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQN 62
           +++ L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L +
Sbjct: 12  LVLGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            +       L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T
Sbjct: 72  LI-------LTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTT 124

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTF 179
            L  LI +  +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  
Sbjct: 125 VLAELINVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIELAFSWVLASAS 184

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           ++ L    P  F  ++     GLLN++ P + ++ +  P
Sbjct: 185 LLAL----PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|289678969|ref|ZP_06499859.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae FF5]
          Length = 199

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 82/169 (48%), Gaps = 1/169 (0%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   +     ++
Sbjct: 15  LIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIGQFFTML 74

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L    ++ H  V   LV+S+ T+P+G  L   N F    N L       LRL  P + 
Sbjct: 75  VTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNN-FWELANGLGWALASGLRLVLPAIT 133

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  ++ Q+ 
Sbjct: 134 ALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDMLNQYQ 182


>gi|160902842|ref|YP_001568423.1| flagellar biosynthetic protein FliR [Petrotoga mobilis SJ95]
 gi|160360486|gb|ABX32100.1| flagellar biosynthetic protein FliR [Petrotoga mobilis SJ95]
          Length = 257

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 104/236 (44%), Gaps = 13/236 (5%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F I  RV      +P  S +++P+ +++   +  S ++L  +  T  + +       S L
Sbjct: 14  FFIFARVAGITFFIPFFSTTFVPVHIKVFITLFISYLVLFEVNGTFPINS-------SPL 66

Query: 73  VMV-----ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           V++         G   GL+  +     QF G  I   +G  +        S   + ++ L
Sbjct: 67  VIIFYLLMNFVFGSSVGLIANILFYAFQFAGETIGIQMGFAMANVFDPVTSDEVSLVSEL 126

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +  +L  ++      ++  ++ S+  +P+   L   + F  F   L   F I L+LS 
Sbjct: 127 SFLFSMLLFFIFKGPLILYSIIIDSFNKVPVVFTLA-PDGFMVFSQKLFDVFTIGLQLSM 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           PF+ F I+  +++G++++L+PQ+ ++ +  P  I +G L     I I   QF+  F
Sbjct: 186 PFIAFMILLKVALGIVSRLIPQVNVFMVGIPLEILVGFLLFLGVILIWEDQFTTLF 241


>gi|301646789|ref|ZP_07246643.1| flagellar biosynthetic protein FliR [Escherichia coli MS 146-1]
 gi|307136836|ref|ZP_07496192.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
 gi|301075024|gb|EFK89830.1| flagellar biosynthetic protein FliR [Escherichia coli MS 146-1]
 gi|315616849|gb|EFU97466.1| flagellar biosynthetic protein FliR [Escherichia coli 3431]
          Length = 260

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|310641561|ref|YP_003946319.1| flagellar biosynthetic protein flir [Paenibacillus polymyxa SC2]
 gi|309246511|gb|ADO56078.1| Flagellar biosynthetic protein fliR [Paenibacillus polymyxa SC2]
          Length = 215

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 82/190 (43%), Gaps = 10/190 (5%)

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL- 119
           Q       Y  LV  E+ +G + G    ++   +Q  GS I   +G  + +   + D + 
Sbjct: 11  QQVPTDVAYVLLVGREVLIGLLLGFTAYLFMTAIQTAGSFIDLQVGFGMAS---VFDPMT 67

Query: 120 -AETPLNSLIGI-IGLLALWVIDFHHQVFYALVKSYGTIPIGQE----LNFGNIFSSFVN 173
            A TPL       I +L    I+ HH +  A++ SY  +P+  +    L  G++    V 
Sbjct: 68  GASTPLTGNFKFAIAVLFFLSINGHHHLLNAILYSYDWVPLTNDFFIKLYGGSVTEFLVR 127

Query: 174 MLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
               +FM+  ++++P +    + ++ +G L K  PQ  I+ I  P  I +G   L L + 
Sbjct: 128 SFAESFMLAFQIAAPIVVATFLTDVGLGFLAKTAPQFNIFVIGVPLKIIVGLFMLLLLMP 187

Query: 234 IIVYQFSHSF 243
              + F   F
Sbjct: 188 SFAFIFERLF 197


>gi|170683764|ref|YP_001742350.1| lateral flagellar export/assembly protein LfiR [Escherichia coli
           SMS-3-5]
 gi|170521482|gb|ACB19660.1| lateral flagellar export/assembly protein LfiR [Escherichia coli
           SMS-3-5]
          Length = 260

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|305431791|ref|ZP_07400958.1| flagellar biosynthetic protein FliR [Campylobacter coli JV20]
 gi|304444875|gb|EFM37521.1| flagellar biosynthetic protein FliR [Campylobacter coli JV20]
          Length = 255

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 95/213 (44%), Gaps = 8/213 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRAYYSKL 72
           L+  R+   I+  P  S + IPM ++  FA+  ++ L P    + + L +F      S++
Sbjct: 17  LLFARMSGLIVFFPFFSHNSIPMIIKTTFALFLTMYLFPLAKLEILHLDSFFIIQLLSEI 76

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V      G + GL++++    +   G  I+  +G  + + +  S        + ++ +I 
Sbjct: 77  V-----FGMIAGLMLQIVFAIVMMAGEQIAFTMGFTMASVLDPSSGTNMPITSQILHLIA 131

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLF 191
           LL     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L 
Sbjct: 132 LLFFLAFDGHHLMLLFLSHSLGYINLGGFYPHENLMH-YLNMGMLNIFIIGFTMSFPILG 190

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             ++ +   GLL K +PQ  +  I  P  I LG
Sbjct: 191 ISLLADTIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|269302613|gb|ACZ32713.1| bacterial export protein, fliR/mopE/spaR family [Chlamydophila
           pneumoniae LPCoLN]
          Length = 289

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/222 (18%), Positives = 103/222 (46%), Gaps = 7/222 (3%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P L     P  +++   +++  ++ P +     + N+++   +  L++ E+ +G V G +
Sbjct: 47  PFLGAKLFPSPIKIGIGLSWLAIIFPKVLADTQITNYMDNNLFYVLLVKEMIIGIVIGFV 106

Query: 87  IRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQV 145
           +       Q  GS I+   G+  L+ +  +      +P   L      +  W++  H  V
Sbjct: 107 LAFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGILYHYFVTIVFWLVGGHRIV 166

Query: 146 FYALVKSYGTIPI-----GQELNF-GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
              L+++   IPI      + ++    I+ + + M Q   ++ ++LS+P     ++ ++ 
Sbjct: 167 ISLLLQTLEVIPIHSFFPAEMMSLSAPIWITMIKMCQLCLVMTIQLSAPAALAMLMSDLF 226

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +G++N++ PQ+ + ++ +     +G LFL L+   I+ Q  +
Sbjct: 227 LGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIIKQIDY 268


>gi|326204608|ref|ZP_08194464.1| flagellar biosynthetic protein FliR [Clostridium papyrosolvens DSM
           2782]
 gi|325985175|gb|EGD46015.1| flagellar biosynthetic protein FliR [Clostridium papyrosolvens DSM
           2782]
          Length = 265

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 103/229 (44%), Gaps = 11/229 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFA-----MAFSIVLLPFLWDTIDLQNFVNRAY 68
           LI  R+    +  P      IP+  ++ FA     +A S++ +  + +T    NF+  A 
Sbjct: 17  LIFVRMTGLFVTAPIFGRRNIPVYFKVGFAFITAILASSVIKVDHIINT---DNFLIFAL 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y   ++ E  +G + G +       +   G +I   IG  +        ++      +L 
Sbjct: 74  Y---ILKEFLVGIIIGFVAYAVFTCIYLAGQIIDMQIGFGMVNVFDPMSNIQIPVTANLY 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+ ++   V + HH +  AL +S+  +P+G  +         + ++   F +  ++++P
Sbjct: 131 FILAMIIFLVTNGHHMLIKALFESFQLVPLGSGVIGPKFTDDVIGLISGVFSMGFKIAAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
            +    + ++ +G+++K +PQ+ ++ +  P  I LG L + ++I   VY
Sbjct: 191 VVAAIFITDVVLGIISKTIPQMNVFILGMPLKIFLGILIVMITIPAFVY 239


>gi|190574227|ref|YP_001972072.1| putative flagellar biosynthetic protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012149|emb|CAQ45772.1| putative flagellar biosynthetic protein [Stenotrophomonas
           maltophilia K279a]
          Length = 257

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 80/204 (39%), Gaps = 23/204 (11%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+  M +P +    +P ++R+  A   +I L P L    D   F   A     +  EL
Sbjct: 21  RIGAVAMAMPMVGTRAVPARIRVILAGTLAIALAPLLPPVPDWTGF--DAATVLTIAREL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G L+R+        G +I+   GL       +SD     PL    G  G++  W
Sbjct: 79  AIGVSIGFLLRLVFEAGAMAGELIAQGTGLAFAQ---MSD-----PLRG--GTSGVIGQW 128

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRLS 186
                       + H  +   +V SY  +PIG  L   + F S     L T     L L+
Sbjct: 129 FYLLFGLLFFTANGHLALISLVVDSYRALPIGAPLPDPHAFFSIAPTFLLTVLRGALTLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQI 210
            P     +  N++ G+L +  P +
Sbjct: 189 IPLTVAMLAVNLAFGVLARAAPAL 212


>gi|170021381|ref|YP_001726335.1| flagellar biosynthetic protein FliR [Escherichia coli ATCC 8739]
 gi|169756309|gb|ACA79008.1| flagellar biosynthetic protein FliR [Escherichia coli ATCC 8739]
          Length = 260

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLFKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|117919802|ref|YP_868994.1| flagellar biosynthesis protein FliR [Shewanella sp. ANA-3]
 gi|117612134|gb|ABK47588.1| flagellar biosynthetic protein FliR [Shewanella sp. ANA-3]
          Length = 265

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 111/235 (47%), Gaps = 24/235 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  A+  ++ + P L    D + F   A +  ++ +++
Sbjct: 21  RVTSMLMVMVVFGATTTPTRVRLLLAVTITLAIAPVLPPVKDAELFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTQMVMQTFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  L    +D H  +   LV S+ T+PI    N G   +S+ ++ +     F   L +S
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETLPIS---NQGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F  
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFEE 242


>gi|157692317|ref|YP_001486779.1| flagellar biosynthesis protein FliR [Bacillus pumilus SAFR-032]
 gi|157681075|gb|ABV62219.1| flagellar biosynthesis protein FliR [Bacillus pumilus SAFR-032]
          Length = 259

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 110/234 (47%), Gaps = 18/234 (7%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAM-----AFSIVLLPFLWDTIDLQNFVN 65
           +  L+  R+ +  + +P L+   IP   R+ F++     +FS +  P   D ID      
Sbjct: 9   AFLLVFIRITAFFVTVPLLAHRTIPAVHRVGFSLFLAVISFSTIKEPPALD-ID------ 61

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL- 124
              Y  L + E  +G + GL+  +    +Q  GS I   +G  +   +    + A+TPL 
Sbjct: 62  -GLYMMLAVKEAMVGLLLGLIAYIMVSAVQIAGSFIDFQMGFAIANVID-PQTGAQTPLM 119

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGN-IFSSFV-NMLQTTFMI 181
                 + LL +   + HH +   +  S+  I + Q  LNFG+  F+ F+       F+I
Sbjct: 120 GQFFYTVTLLLMLATNAHHLLLDGIYYSFQYIAVDQYALNFGSESFAYFIAKSFNQMFII 179

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
             ++S+P +    + ++++G++ + VPQ+ ++ +  P  +G+  + + + + +I
Sbjct: 180 AFQISAPVVASLFLVDLALGIVARTVPQMNVFVVGLPIKMGVSFIMIIICMGVI 233


>gi|261407966|ref|YP_003244207.1| flagellar biosynthetic protein FliR [Paenibacillus sp. Y412MC10]
 gi|261284429|gb|ACX66400.1| flagellar biosynthetic protein FliR [Paenibacillus sp. Y412MC10]
          Length = 262

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 95/205 (46%), Gaps = 9/205 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQNFVNRAYYSKL 72
           LI CR+ S  ++ P  +   IP   ++  +   + IV L F    +  Q+      Y+ L
Sbjct: 13  LIFCRITSFFVISPVFASRGIPSSYKIALSAIIALIVYLSFGLGEVVPQDLS----YAIL 68

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ E+ +G + G    +    +Q  G++I   IG ++   +      +   + +    + 
Sbjct: 69  IVQEVLVGLLLGFTAYLIMAVVQTAGALIDIQIGFSMANVIDPFTGTSTPLIGNFKYYLA 128

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQE----LNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           LL    ++ HH +F A++ SY  IPI  +    ++ GN+    V     +F++ +++++P
Sbjct: 129 LLVFLSMNGHHYLFDAIMYSYDWIPITGDVFGKIHEGNVTDFLVRTFSHSFVLAIQMAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIY 213
            +    + ++ +G L +  PQ  ++
Sbjct: 189 LVAALFLTDVGLGFLARTAPQFNVF 213


>gi|327254529|gb|EGE66145.1| flagellar biosynthetic protein FliR [Escherichia coli STEC_7v]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLIFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|78485087|ref|YP_391012.1| flagellar biosynthetic protein FliR [Thiomicrospira crunogena
           XCL-2]
 gi|78363373|gb|ABB41338.1| flagellar biosynthetic protein FliR [Thiomicrospira crunogena
           XCL-2]
          Length = 247

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 102/222 (45%), Gaps = 32/222 (14%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRL------CFAMAFSIVLLP----FLWDTIDLQNFVNRA 67
           R+   ++++P LS SY+PM VRL       FA+A S+ L P    F W  I         
Sbjct: 10  RISGMLLMVPILSGSYVPMNVRLLLAVFITFAVAPSLALPPPVDPFTWHGI--------- 60

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ +L +G   GL+  +        G + S ++GL + + +  +  +    +   
Sbjct: 61  ---LLIVQQLGIGVAIGLIFALIFQAFVIAGHLASMSMGLAMASMVDPATGVNTPIIGRY 117

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIG----QELNFGNIFSSFVNMLQTTFMIML 183
             II  L   +++ H  VF A+++S+ T+PIG     + +   I+     M ++   I L
Sbjct: 118 FTIIATLLFLLMNGHVLVFKAVLQSFETLPIGLHFFTQDSLKLIYGFGSQMFESGVTIAL 177

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGL 223
            L +  L    + NI+ G++ +  P + I+ +  P   L+GL
Sbjct: 178 PLVTALL----LVNIAFGVVARAAPALNIFAVGFPVTLLVGL 215


>gi|86150314|ref|ZP_01068540.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88596317|ref|ZP_01099554.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562791|ref|YP_002344570.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85839139|gb|EAQ56402.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88191158|gb|EAQ95130.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360497|emb|CAL35294.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|284926403|gb|ADC28755.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315926597|gb|EFV05978.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni DFVF1099]
          Length = 255

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 98/212 (46%), Gaps = 6/212 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+G  I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMGGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFF 192
           +     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L  
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFTMSFPILGI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 192 SLLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|94500292|ref|ZP_01306825.1| flagellar biosynthesis protein [Oceanobacter sp. RED65]
 gi|94427591|gb|EAT12568.1| flagellar biosynthesis protein [Oceanobacter sp. RED65]
          Length = 262

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 107/229 (46%), Gaps = 32/229 (13%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R     M+LP      +  +VRL  A   SI++ P L      D + +Q  V     ++ 
Sbjct: 29  RFAGFFMVLPLFGTRLVTARVRLFLAFFTSILVTPLLPPMPVIDAVSVQTMV---IIAQQ 85

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +++ + LG V  +L++++ L     G +I+      +QT +G++  +   P N +   + 
Sbjct: 86  ILIGIALGFVVEILMQIFIL----CGQLIA------MQTGLGMA--MMVDPTNGVN--VA 131

Query: 133 LLALWVIDFHHQVFYAL----------VKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
           ++A W + F + +F  L            S+ TIP+G+     N+  S V +    F   
Sbjct: 132 VVAQWFLIFANLLFITLNGHLVAIEILADSFFTIPVGEGTISTNVMWSIVELAHWMFSAA 191

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLS 231
           + L+ P +   +V NI+ G++ +L PQ+ I+ +  P  + LG + L ++
Sbjct: 192 IVLALPAITSMLVVNIAFGVMARLAPQLNIFAVGFPVTMLLGLIVLWIA 240


>gi|224370772|ref|YP_002604936.1| FliR [Desulfobacterium autotrophicum HRM2]
 gi|223693489|gb|ACN16772.1| FliR [Desulfobacterium autotrophicum HRM2]
          Length = 262

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 101/225 (44%), Gaps = 5/225 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ RV   + +LP    +  P  V+   AM  S++L   +    DL      A    + 
Sbjct: 17  LVLARVSIVLFMLPIFGTTMFPTMVKAGLAMVISMLLYSVVQLDPDL--LPETAMGMGIF 74

Query: 74  MV-ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +V E  +G   GL +R++    Q  G VI   +G ++   +        + +  L   + 
Sbjct: 75  LVSEAMIGLTLGLCVRLFFGSFQLAGEVIGFQMGFSMINVVDPQSGANVSLMEQLAYWVA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT-FMIMLRLSSPFLF 191
           LL    ++ HH +  +LV S+  +  G    F  I    V  L +  F++ +++ +P + 
Sbjct: 135 LLVFLAMNGHHIMLLSLVDSFELVQPG-SFVFQQIMVDKVIFLGSQMFILAIKIGAPVIA 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
             +  +++ GL  K  PQ+ +  ++ P  I +G +   LS+EII+
Sbjct: 194 ALLFTSVAFGLTAKFSPQMNVMIVAFPLKIIVGLVLFGLSLEIII 238


>gi|317013592|gb|ADU81028.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           Gambia94/24]
          Length = 255

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 91/218 (41%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N  Y  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNATYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|15618732|ref|NP_225018.1| Yop proteins translocation protein T [Chlamydophila pneumoniae
           CWL029]
 gi|15836356|ref|NP_300880.1| YopT tranlocation T [Chlamydophila pneumoniae J138]
 gi|16752217|ref|NP_445585.1| type III secretion inner membrane protein SctT [Chlamydophila
           pneumoniae AR39]
 gi|33242183|ref|NP_877124.1| YOP proteins translocation protein T [Chlamydophila pneumoniae
           TW-183]
 gi|4377135|gb|AAD18960.1| Yop proteins translocation protein T [Chlamydophila pneumoniae
           CWL029]
 gi|6672008|dbj|BAA88641.1| YopT tranlocation protein [Chlamydophila pneumoniae]
 gi|8163545|gb|AAF73727.1| type III secretion inner membrane protein SctT [Chlamydophila
           pneumoniae AR39]
 gi|8979197|dbj|BAA99031.1| YopT tranlocation T [Chlamydophila pneumoniae J138]
 gi|33236694|gb|AAP98781.1| YOP proteins translocation protein T [Chlamydophila pneumoniae
           TW-183]
          Length = 289

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/222 (18%), Positives = 104/222 (46%), Gaps = 7/222 (3%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P L     P  +++  ++++  ++ P +     + N+++   +  L++ E+ +G V G +
Sbjct: 47  PFLGAKLFPSPIKIGISLSWLAIIFPKVLADTQITNYMDNNLFYVLLVKEMIIGIVIGFV 106

Query: 87  IRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQV 145
           +       Q  GS I+   G+  L+ +  +      +P   L      +  W++  H  V
Sbjct: 107 LAFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGILYHYFVTIIFWLVGGHRIV 166

Query: 146 FYALVKSYGTIPI-----GQELNF-GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
              L+++   IPI      + ++    I+ + + M Q   ++ ++LS+P     ++ ++ 
Sbjct: 167 ISLLLQTLEVIPIHSFFPAEMMSLSAPIWITMIKMCQLCLVMTIQLSAPAALAMLMSDLF 226

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +G++N++ PQ+ + ++ +     +G LFL L+   I+ Q  +
Sbjct: 227 LGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIIKQIDY 268


>gi|71277858|ref|YP_268256.1| flagellar biosynthesis protein FliR [Colwellia psychrerythraea 34H]
 gi|71143598|gb|AAZ24071.1| flagellar biosynthetic protein FliR [Colwellia psychrerythraea 34H]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 97/225 (43%), Gaps = 6/225 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNR 66
           M    L   R+ + IM + G S   IP +V++   ++ +I ++P +      +L +    
Sbjct: 12  MADFVLPFSRISALIMTMIGFSSKTIPGRVKVFLCISITIAVMPAIPPASVTNLMSLNTA 71

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
               + +++ + LG V  +++  +TL     G +I+   GL   + +  +  +    +  
Sbjct: 72  ILLGQQMIIGVMLGFVTIMVVNTFTLA----GQIIAMQSGLGFASLVDPASGMNVPAIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  WV+D H      +V S+ T+PI  E      +   V      F   L L+
Sbjct: 128 FFLILSSLLFWVMDGHLAYLQFIVASFDTLPIPTEHLSSIKYREVVEWGGWMFATALSLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLS 231
              +   ++ N S G++ +  PQ+ I+ I  P  +  G L + L+
Sbjct: 188 LAPITAMLLINFSFGIMTRAAPQLNIFAIGFPITMMAGLLIMWLT 232


>gi|311068159|ref|YP_003973082.1| flagellar biosynthesis protein FliR [Bacillus atrophaeus 1942]
 gi|310868676|gb|ADP32151.1| flagellar biosynthesis protein FliR [Bacillus atrophaeus 1942]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 106/229 (46%), Gaps = 12/229 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-RAYY 69
           +  L+  R+ +  + +P      +P   R+ FA   +++     + T+D    +    +Y
Sbjct: 10  AFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVIC----FSTLDQAPSIEIDEHY 65

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLI 128
             L + E  +G   GL+  +    +Q  GS I   +G  +   +    + A++PL    I
Sbjct: 66  MLLAVKETVVGLSLGLIAFIMIAAVQIAGSFIDFQMGFAIANVID-PQTGAQSPLIGQFI 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNI-FSSFV-NMLQTTFMIMLRL 185
             + LL +  ++ HH +   +  S+  I I Q    FGN  F+ F+       F+I  ++
Sbjct: 125 YTMALLFMLSVNAHHLLLDGIYYSFQYISIDQAFPAFGNEEFAYFIAKSFNAMFIIAFQM 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSI 232
           S+P +    + ++++G++ + VPQ+ ++ +  P  I +    L +C+S+
Sbjct: 185 SAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSV 233


>gi|256831233|ref|YP_003159961.1| flagellar biosynthetic protein FliR [Desulfomicrobium baculatum DSM
           4028]
 gi|256580409|gb|ACU91545.1| flagellar biosynthetic protein FliR [Desulfomicrobium baculatum DSM
           4028]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 76/161 (47%)

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            EL LG + G++IR     +Q  G +I   +G  +   +      +E      + ++ LL
Sbjct: 76  AELLLGLILGMVIRFVFAAIQTGGQLIGFQMGFAMVNVVDPDSGASEAVTAHFMYMVSLL 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               I+ H  +   L+KS+  +P G  L    +      +    F++ +++ +P +   +
Sbjct: 136 TFLSINGHLYLLSGLMKSFDLLPPGSILISPRLTDQIFALSGQIFVLAIQIGAPVIAAIL 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           + ++++ L+++  PQ+ +  I  P  I +G LFL +  EII
Sbjct: 196 LVDLALALISRASPQMNVLIIGFPIKISVGFLFLGIIFEII 236


>gi|167040312|ref|YP_001663297.1| flagellar biosynthesis protein FliR [Thermoanaerobacter sp. X514]
 gi|300914396|ref|ZP_07131712.1| flagellar biosynthetic protein FliR [Thermoanaerobacter sp. X561]
 gi|307724368|ref|YP_003904119.1| flagellar biosynthetic protein FliR [Thermoanaerobacter sp. X513]
 gi|166854552|gb|ABY92961.1| flagellar biosynthetic protein FliR [Thermoanaerobacter sp. X514]
 gi|300889331|gb|EFK84477.1| flagellar biosynthetic protein FliR [Thermoanaerobacter sp. X561]
 gi|307581429|gb|ADN54828.1| flagellar biosynthetic protein FliR [Thermoanaerobacter sp. X513]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 93/192 (48%), Gaps = 7/192 (3%)

Query: 54  LWDT---IDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQ 110
           ++DT   +DLQ   N   Y  +V+ E  +G V GL   +    +   G +I   +G  L 
Sbjct: 52  VFDTMGPVDLQ-INNVLDYFIVVISEFIVGLVIGLASMISFSAIHLAGQLIDYQLGFGLV 110

Query: 111 TSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFS 169
             + I        + + I I+ +L   +++ H+ +F  L KS   I IG+   +F  +  
Sbjct: 111 NILDIHSETQVPLMGNFIYILTILIFMLMNGHYTLFTMLAKSVDIIAIGKVAFDFSGMSQ 170

Query: 170 SFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLF 227
               M+   F++  R+S P +   ++ ++++G++++ +PQ+ ++ I  P    +G+ +L 
Sbjct: 171 VLTKMVSDMFLLGFRISVPIILTTLLTDLTLGIISRTIPQLNVFMIGMPAKIFVGIFTLL 230

Query: 228 LCLSIEIIVYQF 239
           + L + + +  F
Sbjct: 231 IMLPVYLTIIDF 242


>gi|254523778|ref|ZP_05135833.1| flagellar biosynthetic protein FliR [Stenotrophomonas sp. SKA14]
 gi|219721369|gb|EED39894.1| flagellar biosynthetic protein FliR [Stenotrophomonas sp. SKA14]
          Length = 263

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 80/204 (39%), Gaps = 23/204 (11%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+  M +P +    +P +VR+  A   +I L P L    +   F   A     +  EL
Sbjct: 27  RIGAVAMAMPMVGTRAVPARVRVVLAGTLAIALAPLLPPVPEWTGF--DAATVLTIAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G L+R+        G +I+   GL       +SD     PL    G  G++  W
Sbjct: 85  AIGVAIGFLLRLVFEAGAMAGELIAQGTGLAFAQ---MSD-----PLRG--GTSGVIGQW 134

Query: 138 ----------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRLS 186
                       + H  +   +V SY  +PIG  L   + F S     L T     L L+
Sbjct: 135 FYLLFGLLFFTANGHLALISLVVDSYRALPIGAPLPDPHAFFSIAPTFLLTVLRGALTLA 194

Query: 187 SPFLFFYIVFNISIGLLNKLVPQI 210
            P     +  N++ G+L +  P +
Sbjct: 195 IPLTVAMLAVNLAFGVLARAAPAL 218


>gi|256020207|ref|ZP_05434072.1| flagellar biosynthetic protein FliR [Shigella sp. D9]
 gi|332281369|ref|ZP_08393782.1| lateral flagellar export/assembly protein [Shigella sp. D9]
 gi|332103721|gb|EGJ07067.1| lateral flagellar export/assembly protein [Shigella sp. D9]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D I L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|307636862|gb|ADN79312.1| flagellar biosynthesis protein [Helicobacter pylori 908]
 gi|325995451|gb|ADZ50856.1| Flagellar biosynthesis protein [Helicobacter pylori 2018]
 gi|325997049|gb|ADZ49257.1| Flagellar biosynthesis protein [Helicobacter pylori 2017]
          Length = 255

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 91/218 (41%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N  Y  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNATYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|254517019|ref|ZP_05129077.1| flagellar biosynthetic protein FliR [gamma proteobacterium NOR5-3]
 gi|219674524|gb|EED30892.1| flagellar biosynthetic protein FliR [gamma proteobacterium NOR5-3]
          Length = 256

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 106/217 (48%), Gaps = 2/217 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ + ++  P  S S I ++VR+  A+  S ++ P L  T  ++     A    L + E+
Sbjct: 21  RLSAMLLAAPIFSYSSISVRVRVLLAVLVSALVAPLLPVTPVVEPL--SALGLVLALREV 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G V G ++++    +   G  ++ ++GL    ++   + +    ++ L  ++  L   
Sbjct: 79  AIGLVMGFVMQLVFAAVVVAGHSVAMSMGLGFAMAVDPQNGVQVPVVSQLNVVLATLLFL 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ID H  +  A+V+S+  IP+G   +   +FS+   +    F   L L+ P L   ++ N
Sbjct: 139 AIDGHLMLITAVVESFELIPVGSAFSPEGMFSNVAALGTQLFASALLLALPALTAILMIN 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEI 234
           ++ G++ +  PQ+ I+ +  P  I  G +F+ L++ +
Sbjct: 199 VAFGVITRAAPQLNIFAVGFPVTIIAGFVFMLLALPM 235


>gi|149191145|ref|ZP_01869403.1| putative flagellar biosynthetic protein FliR [Vibrio shilonii AK1]
 gi|148834983|gb|EDL51962.1| putative flagellar biosynthetic protein FliR [Vibrio shilonii AK1]
          Length = 259

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 94/209 (44%), Gaps = 5/209 (2%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF-VNRAYYSKLVMV 75
            R+    ++ P    + IP++V+L FA  FS++L P + +      F ++   +S   + 
Sbjct: 20  VRLTGLFLIAPFFGDNAIPVRVKLLFAFIFSLLLAPLVHEVPPFNPFSIDTLLFS---LY 76

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           +L  G + G  + ++       G  IS  +GL +      ++ ++   +  ++ I  +L 
Sbjct: 77  QLIFGFLVGFAVMIFFTIFSIAGQAISMQMGLAMAVMNDPANGISIAIIGRIMFITSMLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H  V     +S+   P+     F +I    + M+   F   L ++ P +   ++
Sbjct: 137 FLSLDAHLVVLLVFKESFTYWPLDSTFPFSSI-DYVLKMVSWMFATGLLVAVPAIVVMLL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            NI+ GL+NK  P + ++ +  P  + LG
Sbjct: 196 SNITFGLMNKAAPSLNVFALGFPMTMLLG 224


>gi|217972628|ref|YP_002357379.1| flagellar biosynthesis protein FliR [Shewanella baltica OS223]
 gi|217497763|gb|ACK45956.1| flagellar biosynthetic protein FliR [Shewanella baltica OS223]
          Length = 265

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 106/232 (45%), Gaps = 18/232 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  AMA +  + P L    +   F   A +  ++ +++
Sbjct: 21  RVASMLMVMVVFGAATTPSRVRLLLAMAITFAIAPVLPPVQNADLFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++V+ L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTQMVMQVFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++  L    +D H  +   LV S+ T+PI  +      + +  +     F   L +S   
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRALADWGSYMFGAALTMSISA 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +   ++ N+S G++ +  PQ+ I+ I  P  +  G   L L++  ++  F  
Sbjct: 191 IIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLFILWLTLTPVMEHFDE 242


>gi|307720324|ref|YP_003891464.1| flagellar biosynthetic protein FliR [Sulfurimonas autotrophica DSM
           16294]
 gi|306978417|gb|ADN08452.1| flagellar biosynthetic protein FliR [Sulfurimonas autotrophica DSM
           16294]
          Length = 254

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 98/208 (47%), Gaps = 9/208 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL---LPFLWDTIDLQNFVNRAYYS 70
           L+  R     + +P  +   IPM ++   A  F++V    +P L  +ID+   +      
Sbjct: 17  LLFFRFAGLFIAVPIFNHQNIPMNIKASMAFFFAVVFYSSMPALHISIDVPTILVA---- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             V+ EL LG   G+++++    + F G  IS  +G ++ +++     ++   ++  + +
Sbjct: 73  --VLGELLLGLSVGVVLQLAYNVITFAGGQISFMMGFSMASAIDPQSGVSMPIISQFLSL 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +GL+ L  ++ HH +   +  S  T+P+G  +   ++F   ++     F++   ++ P +
Sbjct: 131 MGLMILLSLNLHHWMLLFIDHSLKTVPLGGFVMSKDLFHYIMHATSNMFLVGFIIAFPII 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
               + ++  G+L K +PQ  +  I  P
Sbjct: 191 ALSWLADVIFGMLMKTMPQFNLLVIGFP 218


>gi|157373226|ref|YP_001471826.1| flagellar biosynthetic protein FliR [Shewanella sediminis HAW-EB3]
 gi|157315600|gb|ABV34698.1| flagellar biosynthetic protein FliR [Shewanella sediminis HAW-EB3]
          Length = 257

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 107/231 (46%), Gaps = 17/231 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+    M++P LS SYIP+ VR+  A+  S +L P L     +      A +  L + +L
Sbjct: 22  RIMGAFMVMPFLSSSYIPVTVRVLLALTISTLLAPMLPPLPSVDAISIGALF--LAIEQL 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG----IIGL 133
            +G + GL + +    +   G+++S  +GL    +M + +  A    N ++G    + G 
Sbjct: 80  LVGFMLGLFLTIMIHVMTLLGAMMSMQMGL----AMAVMNDPANGSSNPILGQWFLLYGT 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           L    +D H      LV S+   PIG    +L    + S F  +  +  M+ L    P +
Sbjct: 136 LLFLALDGHLVAIGVLVDSFRLWPIGSGVLDLPLMGLVSRFAWIFASALMLAL----PSI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              ++ NI+ G+L++  P + ++ +  P  + +G L + LS   +  ++S 
Sbjct: 192 LAMLMVNITFGVLSRAAPSLNVFALGFPMSMLMGLLCVMLSFSGLPTRYSD 242


>gi|331645395|ref|ZP_08346499.1| flagellar biosynthetic protein FliR [Escherichia coli M605]
 gi|331045557|gb|EGI17683.1| flagellar biosynthetic protein FliR [Escherichia coli M605]
          Length = 277

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 98/211 (46%), Gaps = 11/211 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ + +  +P L  S +  +VR+  ++A +I++ P +   I   + +       L + ++
Sbjct: 39  RIMAFLRYMPVLDNSALTARVRIILSLALAIIITPLIPHPIP--HNLLSLNSLILTVEQI 96

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  +L  +
Sbjct: 97  LWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYAILLFF 156

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P  F  +
Sbjct: 157 AMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PTTFIML 212

Query: 195 VFNISIGLLNKLVPQIPIYFISTP--YLIGL 223
           +     GLLN++ P + ++ +  P   L+GL
Sbjct: 213 IVQGCFGLLNRIAPPLNLFSLGFPINMLVGL 243


>gi|126175116|ref|YP_001051265.1| flagellar biosynthesis protein FliR [Shewanella baltica OS155]
 gi|153001440|ref|YP_001367121.1| flagellar biosynthesis protein FliR [Shewanella baltica OS185]
 gi|160876165|ref|YP_001555481.1| flagellar biosynthesis protein FliR [Shewanella baltica OS195]
 gi|304409947|ref|ZP_07391566.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|307302340|ref|ZP_07582098.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
 gi|125998321|gb|ABN62396.1| flagellar biosynthetic protein FliR [Shewanella baltica OS155]
 gi|151366058|gb|ABS09058.1| flagellar biosynthetic protein FliR [Shewanella baltica OS185]
 gi|160861687|gb|ABX50221.1| flagellar biosynthetic protein FliR [Shewanella baltica OS195]
 gi|304351356|gb|EFM15755.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|306914378|gb|EFN44799.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
 gi|315268361|gb|ADT95214.1| flagellar biosynthetic protein FliR [Shewanella baltica OS678]
          Length = 265

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 106/232 (45%), Gaps = 18/232 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P +VRL  AMA +  + P L    +   F   A +  ++ +++
Sbjct: 21  RVASMLMVMVVFGAATTPSRVRLLLAMAITFAIAPVLPPVQNADLFSLSAVFITAQQIII 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  ++++V+ L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTQMVMQVFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++  L    +D H  +   LV S+ T+PI  +      + +  +     F   L +S   
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRALADWGSYMFGAALTMSISA 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +   ++ N+S G++ +  PQ+ I+ I  P  +  G   L L++  ++  F  
Sbjct: 191 IIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLFILWLTLTPVMEHFDE 242


>gi|328958268|ref|YP_004375654.1| flagellar biosynthesis protein FliR [Carnobacterium sp. 17-4]
 gi|328674592|gb|AEB30638.1| flagellar biosynthesis protein FliR [Carnobacterium sp. 17-4]
          Length = 230

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 93/198 (46%), Gaps = 15/198 (7%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY-YSKLVMVELFLGCVHGL 85
           PG S+  +P   ++  +M  ++      +  + +       + ++ L++ E+ LG   G 
Sbjct: 3   PGFSIKGLPSVAKIALSMGITLAA----YSAVPVMGQEAGTFLFAILILKEVLLGIAIGF 58

Query: 86  LIRVYTLGLQFTGSVISTAIGLNL----QTSMGISDSLAETPLNSLIGIIGLLALWVIDF 141
           + +++   ++  G+ +   +G ++      SMGI+ S        +   + +   ++ + 
Sbjct: 59  ITKLFFSAVEIAGNFVDFQVGFSMGAVYDPSMGINVSY----YGKIYYWLSMCVFYLTNL 114

Query: 142 HHQVFYALVKSYGTIPIGQELNFGNI-FSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISI 200
           HH V  +L++S+ T+PI    N G+      + +L   F +   LS+P +   ++  + +
Sbjct: 115 HHVVIKSLIQSFQTMPISST-NIGDFGVEGMMKLLGIIFELAFNLSAPMVIVALLTEVIL 173

Query: 201 GLLNKLVPQIPIYFISTP 218
           GL+++ VPQI +  +  P
Sbjct: 174 GLISRSVPQINVLILGMP 191


>gi|302670738|ref|YP_003830698.1| flagellar biosynthetic protein FliR [Butyrivibrio proteoclasticus
           B316]
 gi|302395211|gb|ADL34116.1| flagellar biosynthetic protein FliR [Butyrivibrio proteoclasticus
           B316]
          Length = 261

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 105/226 (46%), Gaps = 9/226 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL---LPFLWDTIDLQNFVNRAYYS 70
           LI  RV S I + P       P  V++ F +  SI+L   +PF     +  ++     Y+
Sbjct: 16  LIFVRVASFIFIAPFFGGRQTPNLVKIGFGLLLSIMLYGAVPF-----EAPSYNTIIGYT 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +V+ E+  G + G  +++  L   F G+++   +GL++      + +   T   SL   
Sbjct: 71  VIVLKEVLAGFLIGYAVQLCELISAFAGTIVDMQVGLSMVNIFDPNTNEQVTITGSLYSQ 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +  + L +   +  +  AL  ++  IPI G  +N   + +S +  L+   +I  R+  P 
Sbjct: 131 VLTMMLILTGMYQYILKALADTFYLIPINGAVINADRLLASIMEFLRDYIVIGFRICLPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
                + N+ +G+L K+ PQ+ ++ +     I +G L + +++ ++
Sbjct: 191 FIITFITNVILGVLAKVSPQMNMFAVGIQIKIIIGLLIMFITVTML 236


>gi|322432983|ref|YP_004210232.1| flagellar biosynthetic protein FliR [Acidobacterium sp. MP5ACTX9]
 gi|321165210|gb|ADW70914.1| flagellar biosynthetic protein FliR [Acidobacterium sp. MP5ACTX9]
          Length = 258

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 104/227 (45%), Gaps = 7/227 (3%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           I+ +   I  R+   ++  P L  + IP +++    +A + V+ P +  ++  Q   +  
Sbjct: 8   IIQAFLAIGVRLSGLMLFAPFLGSAVIPARIKAVLVVALTFVIYPLVSRSLTPQPLND-- 65

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  LV  EL +G   G+   V    +Q  G ++S  +G +L   +  +  +  T +   
Sbjct: 66  -WPLLVFRELLVGVSIGIATSVVFEAVQMAGQILSIQMGYSLINILDPNTQVDTTVIAMF 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I +L    +D H  +  A+  S+  +P G  +L+   +F+  +        I ++++
Sbjct: 125 HQSIAMLIFLRLDVHLWLIRAIGNSFTYLPPGGAQLSRPFMFT-LIGAGSAILSIGVQIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFI--STPYLIGLGSLFLCLS 231
           +P L   ++ +I +GLL K  PQ+P+  +  +   L+GL  LF  L 
Sbjct: 184 APVLSATLLTDIVLGLLGKASPQLPLMLLGPAVKSLLGLAILFTSLK 230


>gi|295399826|ref|ZP_06809807.1| flagellar biosynthetic protein FliR [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111662|ref|YP_003989978.1| flagellar biosynthetic protein FliR [Geobacillus sp. Y4.1MC1]
 gi|294978229|gb|EFG53826.1| flagellar biosynthetic protein FliR [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216763|gb|ADP75367.1| flagellar biosynthetic protein FliR [Geobacillus sp. Y4.1MC1]
          Length = 257

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 101/238 (42%), Gaps = 18/238 (7%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFA-----MAFSIVLLPFLWDTIDLQNFVNRAY 68
           LI  RV S    LP  S   IPM  ++  +     M F  +  P    T+ L    +  Y
Sbjct: 13  LIFARVASFFATLPLFSYRTIPMAHKIGLSFFLSWMMFFAISKP----TVAL----DEMY 64

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSL 127
              +V   L   C+ GL   +    +Q  G +I   +G  +   +    + A+ PL    
Sbjct: 65  VLLVVKEVLVGLCI-GLFAFMIISAIQIVGGLIDFQMGFAIANVID-PQTGAQNPLMGQY 122

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ--ELNFGNIFSSFVNMLQTTFMIMLRL 185
             +  LL L  ++ HH +   +  SY  IP+     L+ G++    V      F I  ++
Sbjct: 123 FYMFALLLLLSVNGHHLLLDGVFYSYRFIPLDHWPRLDHGHVAEYIVKSFSAMFAIAFQM 182

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           S P +    + ++++G++ + VPQ+ I+ +  P  I +G + L +++  I     H F
Sbjct: 183 SVPLVGCLFLVDVALGIVARTVPQLNIFVVGFPVKIAVGFILLIVTMAAIFLAVRHLF 240


>gi|223038929|ref|ZP_03609221.1| flagellar biosynthetic protein FliR [Campylobacter rectus RM3267]
 gi|222879902|gb|EEF14991.1| flagellar biosynthetic protein FliR [Campylobacter rectus RM3267]
          Length = 253

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 104/226 (46%), Gaps = 16/226 (7%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF 63
           +PE ++ +  L+  R+G  ++  P  +   IPM V+     AFS +L  FL+    +++ 
Sbjct: 8   APERVI-TFMLLFARIGGLMLFFPFYAHEQIPMSVK----TAFSFLLTLFLFPLASIKS- 61

Query: 64  VNRAYYSKLVMV-ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
               YY  + +V E  LG   GLL+ +    LQ  G  IS  +G ++ + +     L+  
Sbjct: 62  -GEVYYLAVEIVSEAALGVCAGLLLHIVFASLQLAGEQISMIMGFSMASVLDPQTGLSSP 120

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIF----SSFVNMLQTT 178
            ++++I  + L+     D HH +   +  S   +P+G      +I      S +N+    
Sbjct: 121 VISNIINFLALMTFLAFDGHHLILLFISNSLTHVPLGGFYPSPDIVQYASKSMINLFTFG 180

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           F+I    S P L   ++ ++  G+L K +PQ  +  +  P  I +G
Sbjct: 181 FII----SFPILALSLLSDLIFGMLMKTMPQFNLLVVGYPIKITIG 222


>gi|170757192|ref|YP_001782263.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum B1 str. Okra]
 gi|169122404|gb|ACA46240.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum B1
           str. Okra]
          Length = 609

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G ++ T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVINVFIQYFYISIKIAVPIVFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|152980679|ref|YP_001353119.1| FliR component of the flagellar biosynthesis pathway
           [Janthinobacterium sp. Marseille]
 gi|151280756|gb|ABR89166.1| FliR component of the flagellar biosynthesis pathway
           [Janthinobacterium sp. Marseille]
          Length = 263

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 88/197 (44%), Gaps = 14/197 (7%)

Query: 34  IPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIR 88
           +P +V++   +  ++++ P +      D + LQ  +  A        +L +G   G  +R
Sbjct: 38  VPARVKIGLGILLAMIIAPTVPAMPALDPMSLQGLLILAQ-------QLIIGLSIGFAMR 90

Query: 89  VYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYA 148
           +   G++  G +I   +GL   +          + ++  + ++ L+     + H  V   
Sbjct: 91  ITFAGVEMAGEIIGMTMGLGFASFFDPQTRARSSAISQFLALLTLMIYLATNLHLVVLST 150

Query: 149 LVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLV 207
           L +S+  +PI    L+ G +    V      F   ++LS P +   ++ NI++G+L +  
Sbjct: 151 LAQSFEMLPISSSFLSAGGMLE-VVKWGGRIFSAGVQLSLPIVAALLITNIALGILTRAA 209

Query: 208 PQIPIYFISTPYLIGLG 224
           PQ+ I+ I  P  IG+G
Sbjct: 210 PQLNIFGIGFPITIGVG 226


>gi|330814978|ref|YP_004358683.1| Flagellar biosynthetic protein FliR [Burkholderia gladioli BSR3]
 gi|327367371|gb|AEA58727.1| Flagellar biosynthetic protein FliR [Burkholderia gladioli BSR3]
          Length = 259

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 103/233 (44%), Gaps = 7/233 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P +V++  +   SI + P L        F     +   ++V 
Sbjct: 21  VRILALVATAPLIGHASVPARVKIGVSALVSIAVAPALGPLPQATVFSAEGIW---ILVN 77

Query: 77  LFL-GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIGLL 134
            FL G   G  +++    ++  G  I   +GL   +          TP L  ++    +L
Sbjct: 78  QFLIGAALGFTMQIVFAVVEAAGDYIGLQMGLGFASFF--DPHSGNTPMLGRVLNAFAML 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
           A    D H Q+  ALV+S+  +PI   L     +          F + L L+ P +   +
Sbjct: 136 AFIAFDGHLQLIAALVQSFDIVPISSNLLRAAGWRIVAGAGINVFSMGLLLALPVVAALL 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           + N+++G+LN+  PQI I+ +  P L+ +G L + L I  ++  FSH F  G+
Sbjct: 196 ISNLALGILNRAAPQIGIFQVGFPVLMLVGLLLVQLMIPNLMPFFSHLFDDGY 248


>gi|159045797|ref|YP_001534591.1| flagellar biosynthesis protein FliR [Dinoroseobacter shibae DFL 12]
 gi|157913557|gb|ABV94990.1| flagellar biosynthesis protein FliR [Dinoroseobacter shibae DFL 12]
          Length = 257

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 104/230 (45%), Gaps = 2/230 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L + R+G+ +  LP      +P++++L   +A + ++LP L  T         A +    
Sbjct: 18  LALLRIGAAMAFLPAFGERAVPLRIKLVLTLALTALVLPTLLAT-GAPPLERPADWVLAG 76

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E+  G   G   R+    LQ  G++ + +  L  Q   G      +  L ++  + GL
Sbjct: 77  GAEVVSGLFLGFTFRLMVFALQVAGTIAAQSTSLA-QVFGGAVTPDPQPALGNIFLMAGL 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
               +   H  +  A + S+  +P+G   N   I +  +  +   F++   LS+PF+   
Sbjct: 136 ALAALSGLHVHLTEAFLLSFLLLPVGNFPNSDIISAWAIADVSRMFVVGFTLSAPFVAAA 195

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +++N+++G +N+ +PQ+ + F+  P L   G     LS+  ++  + + F
Sbjct: 196 MLYNLALGAINRAMPQLMVAFVGAPALTLGGLALAALSVPFLLTHWWYLF 245


>gi|114562372|ref|YP_749885.1| flagellar biosynthesis protein FliR [Shewanella frigidimarina NCIMB
           400]
 gi|114333665|gb|ABI71047.1| flagellar biosynthetic protein FliR [Shewanella frigidimarina NCIMB
           400]
          Length = 267

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 114/238 (47%), Gaps = 20/238 (8%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+ S +M++     +  P +VRL  ++A ++ + P L   + ++L    +    ++ +++
Sbjct: 21  RISSMLMVMAVFGANTTPARVRLMLSVAITMAVAPILPPIENVELLALSSVFVIAQQILI 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETPL-NSLIG 129
            + +G V  ++++ + L    TG +I       +QTS+G +      S  +TP+ ++   
Sbjct: 81  GVTMGFVTLMVMQTFVL----TGQII------GMQTSLGFASMVDPGSGEQTPVVSNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           ++  L    +D H  +   LV S+ TIPI  Q ++  N + +  +     F   L +S  
Sbjct: 131 LLATLIFLAVDGHLLMIRMLVASFETIPISNQGISIAN-YRALADWGSFMFGSALTMSIS 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  I+  F   ++  
Sbjct: 190 AIVALLLINLSFGVMTRASPQLNIFSIGFPVTMVSGLLILWLTLAPIMAHFDEVWMAA 247


>gi|300696943|ref|YP_003747604.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum CFBP2957]
 gi|299073667|emb|CBJ53187.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum CFBP2957]
          Length = 262

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 91/210 (43%), Gaps = 12/210 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  S + IP  +++ F +A ++ L P L     +   V+   Y  L   ++
Sbjct: 22  RVLAFIAMAPPFSNTEIPTSIKVAFGVALTVALAPML----PVPQGVSVGSYEGLWITLL 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G  +++    +   G ++S  IGL   T +    + +   L   I +  + A
Sbjct: 78  QVAIGMALGFCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGRFISLTAITA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + +AL  S+  +P+      G  + +        F + +R++ P +   ++
Sbjct: 138 FIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGSAVFALAVRIALPIIAIMMI 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGS 225
            N++  +L++    +       P+ +G+ +
Sbjct: 198 VNLAFAVLSRTAQAL------NPFAVGIAA 221


>gi|255348945|ref|ZP_05380952.1| type III secretion system, membrane protein [Chlamydia trachomatis
           70]
 gi|255503484|ref|ZP_05381874.1| type III secretion system, membrane protein [Chlamydia trachomatis
           70s]
 gi|255507162|ref|ZP_05382801.1| type III secretion system, membrane protein [Chlamydia trachomatis
           D(s)2923]
 gi|296435170|gb|ADH17348.1| type III secretion system, membrane protein [Chlamydia trachomatis
           E/150]
 gi|296438890|gb|ADH21043.1| type III secretion system, membrane protein [Chlamydia trachomatis
           E/11023]
          Length = 289

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 108/235 (45%), Gaps = 7/235 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ S + ++P L     P  +++  A+++  +LLP +     + ++ +   +  L+
Sbjct: 33  LLAARILSMLSIIPFLGAKLFPSPIKIGIALSWMGLLLPQVIQDSTIVHYQDLDIFYILL 92

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIG 132
           + E+ +G + GLL       +Q  GS I+   G+  L+ +  +      +P         
Sbjct: 93  IKEILIGVLIGLLFSFPFYAVQSAGSFITNQQGIQGLEGATSLVSIEQTSPHGIFYHYFV 152

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN------FGNIFSSFVNMLQTTFMIMLRLS 186
            +  W+   H  +   L++S   IP+              ++ + + M Q   ++ ++LS
Sbjct: 153 TIVFWLAGGHRIILSVLLQSLEIIPLHAVFPESMMSLRAPMWIAILKMCQLCLIMTIQLS 212

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +P     ++ ++ +G++N++ PQ+ + ++ +     +G LFL L+   IV Q  +
Sbjct: 213 APAAVAMLMSDLFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIVKQIDY 267


>gi|289525609|emb|CBJ15087.1| type III secretion system, membrane protein [Chlamydia trachomatis
           Sweden2]
          Length = 289

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 108/235 (45%), Gaps = 7/235 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ S + ++P L     P  +++  A+++  +LLP +     + ++ +   +  L+
Sbjct: 33  LLAARILSMLSIIPFLGAKLFPSPIKIGIALSWMGLLLPQVIQDSTIVHYQDLDIFYILL 92

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIG 132
           + E+ +G + GLL       +Q  GS I+   G+  L+ +  +      +P         
Sbjct: 93  IKEILIGVLIGLLFSFPFYAVQSAGSFITNQQGIQGLEGATSLVSIEQTSPHGIFYHYFV 152

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN------FGNIFSSFVNMLQTTFMIMLRLS 186
            +  W+   H  +   L++S   IP+              ++ + + M Q   ++ ++LS
Sbjct: 153 TIVFWLAGGHRIILSVLLQSLEIIPLHAVFPESMMSLRAPMWIAILKMYQLCLIMTIQLS 212

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +P     ++ ++ +G++N++ PQ+ + ++ +     +G LFL L+   IV Q  +
Sbjct: 213 APAAVAMLMSDLFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIVKQIDY 267


>gi|187778764|ref|ZP_02995237.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
 gi|187772389|gb|EDU36191.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
          Length = 587

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G ++ T    S +   T L  ++     + 
Sbjct: 51  EILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVTFLERILYWFSTIV 110

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 111 FFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVINVFIQYFYISIKIAVPIVFIILI 170

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 171 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 207


>gi|308050044|ref|YP_003913610.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
 gi|307632234|gb|ADN76536.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
          Length = 259

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 94/210 (44%), Gaps = 9/210 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+     L+P  S  ++P++V++  A   + ++ P L     +      A+   +   +L
Sbjct: 22  RIAGAFALMPFFSNGHVPVRVKVLLAFFLATLVGPVLPTPPPVDPL--SAHALLIAFEQL 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G + GL++ +    L   G ++S  +GL +      ++ +    L   + + G L   
Sbjct: 80  AVGAMMGLILSMLLHILSMLGQMLSMQMGLAMSVMNDPANGVNHALLGQWMVMYGTLLFL 139

Query: 138 VIDFHHQVFYALVKSYGTIPIG---QELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            +D H      +V+S+   PIG   QEL    +   F      TF + L L+ P +   +
Sbjct: 140 ALDGHLVALGIVVESFTLWPIGSGVQELPLMMLIMKF----GWTFAMALMLAIPAVMAML 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           + NI+ G+LNK  P + +Y +  P  + LG
Sbjct: 196 MVNITFGVLNKSAPTLNVYSLGFPLAMMLG 225


>gi|291519580|emb|CBK74801.1| Flagellar biosynthesis pathway, component FliR [Butyrivibrio
           fibrisolvens 16/4]
          Length = 237

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 96/211 (45%), Gaps = 3/211 (1%)

Query: 23  IMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCV 82
           +++ P  S+S  P +V++ F+   S+ LL F+ D   L N+     Y+ LV+ E   G +
Sbjct: 3   VVVAPFFSISNTPARVKIGFSALVSL-LLYFVVDFSAL-NYSTVVGYAFLVVREALTGLI 60

Query: 83  HGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFH 142
            G         +   G++I   IGL++      +     T   SL     ++ L +   H
Sbjct: 61  IGFSTYCCNFIILLAGNMIDMNIGLSMAQEYDPTLRTETTITGSLYNNFIMILLVLSGMH 120

Query: 143 HQVFYALVKSYGTIPIGQEL-NFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIG 201
             +F A   ++  IPIG  +  + ++F S    +   F+I  R+  P     ++ N  +G
Sbjct: 121 RYIFKAFCDAFTLIPIGGAIFRWDSLFKSTAIFMADVFVIAFRIILPVFAVIMLLNAILG 180

Query: 202 LLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           +L K+ PQI ++ +     I +G   L L++
Sbjct: 181 ILVKVAPQIHMFSVGAQMKIIVGFTILFLTV 211


>gi|15611229|ref|NP_222880.1| flagellar biosynthesis protein FliR [Helicobacter pylori J99]
 gi|4154675|gb|AAD05742.1| FLAGELLAR BIOSYNTHESIS PROTEIN [Helicobacter pylori J99]
          Length = 255

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 91/218 (41%), Gaps = 11/218 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
             FL+  RV   +   P      +P+ VR   ++  S +  P L        F N  Y  
Sbjct: 15  DFFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTL-------EFSNAIYTP 67

Query: 71  K----LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +      + ELFLG    + +++    L F    IS ++GL + ++        +  +  
Sbjct: 68  EGFIIACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++
Sbjct: 128 ALLLLAILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            P L   ++ +I  G++ K  PQ  +  I  P  I +G
Sbjct: 188 FPILCLVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIG 225


>gi|183598642|ref|ZP_02960135.1| hypothetical protein PROSTU_02046 [Providencia stuartii ATCC 25827]
 gi|188020825|gb|EDU58865.1| hypothetical protein PROSTU_02046 [Providencia stuartii ATCC 25827]
          Length = 260

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 81/164 (49%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +++ ++ +G   GL +++    ++  G VI   +GL+  T    +       L  ++ +I
Sbjct: 73  VIVQQIVIGVAIGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRILNLI 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            LL     D H  + Y L+ S+  IPI       + F S      + F+  L L+ PF+ 
Sbjct: 133 MLLLFLSFDGHLWLIYILIHSFELIPIQVSPLSRDGFWSLAQFASSIFINGLMLALPFIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            +++ N+++G+LN++ PQ+ ++ +  P  + +G   L L I I+
Sbjct: 193 LFLILNLALGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISIL 236


>gi|168180929|ref|ZP_02615593.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
 gi|182668325|gb|EDT80304.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
          Length = 609

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G ++ T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGTFFINQEGIKHVLNVFIQYFYISIKIAVPIIFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|91795013|ref|YP_564664.1| flagellar biosynthetic protein FliR [Shewanella denitrificans
           OS217]
 gi|91717015|gb|ABE56941.1| flagellar biosynthetic protein FliR [Shewanella denitrificans
           OS217]
          Length = 259

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 114/243 (46%), Gaps = 9/243 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           SL+   CR+    M++P L  +Y+P+ VR+  +++ ++++   +     +      A Y 
Sbjct: 15  SLWWPFCRIMGAFMIMPLLGNAYVPVTVRILLSLSIAVLISHLIPSVPPVDALSLSAVY- 73

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L + +L +G + G ++ +    +   G+++S  +GL +      +   A   L+    +
Sbjct: 74  -LAIEQLLIGVMLGFILYLLLHVMTLLGTIMSMQMGLAIAIMNDPATGDANPILSQWFLL 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            G L    +D H      LV S+   PIG +L F      FV+ +   F   L L+ P +
Sbjct: 133 FGTLIFLALDGHLVAIGVLVDSFRLWPIGSDL-FSLPLLGFVHRVGWLFAAALMLALPAV 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH------SFL 244
              ++ NI+ G+L++  P + I+ +  P  + +G L + LS+  +  ++S       +F+
Sbjct: 192 LAMLMVNITFGVLSRSAPSLNIFSLGFPMTMLMGLLCVLLSLSGVPERYSDLCLEALAFM 251

Query: 245 YGF 247
           Y F
Sbjct: 252 YQF 254


>gi|188494213|ref|ZP_03001483.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
 gi|188489412|gb|EDU64515.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
          Length = 260

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           R+ + +  +P L  S + ++VR+  ++A +I++ P +      D + L + +       L
Sbjct: 22  RIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNSLI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  LI +  
Sbjct: 75  TVEQILWGMLFGLMFQFLFLVLQLAGQILSFNMGMSMAVMNDPSSGASTTVLAELINVYA 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +L  + +D H  +   L K +   PIG  L+      I  +F  +L +  ++ L    P 
Sbjct: 135 ILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQTLRTIALAFSWVLASASLLAL----PT 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            F  ++     GLLN++ P + ++ +  P
Sbjct: 191 TFIMLIVQGCFGLLNRIAPPLNLFSLGFP 219


>gi|154686054|ref|YP_001421215.1| flagellar biosynthesis protein FliR [Bacillus amyloliquefaciens
           FZB42]
 gi|154351905|gb|ABS73984.1| FliR [Bacillus amyloliquefaciens FZB42]
          Length = 259

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 109/234 (46%), Gaps = 10/234 (4%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L+  R+ +  + +P      +P   R+ FA   S++    L    +++       Y 
Sbjct: 10  AFLLVFIRISAFFVTVPVFGHRNLPAVHRIGFAFFLSVICFSTLKHAPEIEI---GEQYM 66

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIG 129
            LV+ E  +G   GL+  +    +Q  GS I   +G ++   +    S  ++PL    + 
Sbjct: 67  LLVIKEAVVGLSLGLIAFMMMTAIQIAGSFIDFQMGFSIANVID-PQSGTQSPLIGQFVY 125

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNI-FSSFV-NMLQTTFMIMLRLS 186
            + LL +  I+ H+ +   +  S+  IP+ Q   +FGN  F  F+       F+I  ++S
Sbjct: 126 TLALLFMLSINAHYLLLDGIYYSFQYIPLDQAFPSFGNDHFGLFIAKSFNAMFIIAFQMS 185

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
           +P +    + ++++G++ + VPQ+ ++ +  P  I +    L +C+++  +V +
Sbjct: 186 APVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMAVMFVVVR 239


>gi|62185509|ref|YP_220294.1| putative type III export protein [Chlamydophila abortus S26/3]
 gi|62148576|emb|CAH64348.1| putative type III export protein [Chlamydophila abortus S26/3]
          Length = 289

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/224 (19%), Positives = 103/224 (45%), Gaps = 7/224 (3%)

Query: 25  LLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           ++P L     P  +++  A+++  ++ P +  +  + N+++   +  L++ E+ +G +  
Sbjct: 45  IVPFLGGKLFPAPIKIGIALSWVAIIFPKVLMSTHVANYLDDDVFYILIIKEICIGTLIS 104

Query: 85  LLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            ++       Q  GS I+   G+  L+ +  +      +P          +  W+   H 
Sbjct: 105 FILSFPFYAAQSAGSFITNQQGIQGLEGATSLISIEQTSPHGIFYHYFVTIVFWLSGGHR 164

Query: 144 QVFYALVKSYGTIPIGQELNF------GNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            V   L++S   IPI + L          I+ + + M Q   ++ ++LS+P     ++ +
Sbjct: 165 IVLTILLQSLEVIPIHKFLPMEMMSLDAPIWITLIKMCQLCLIMTIQLSAPAAVAMLMSD 224

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +G++N++ PQ+ + ++ +     +G LFL L+   IV Q  +
Sbjct: 225 LFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIVKQIDY 268


>gi|330447935|ref|ZP_08311583.1| flagellar biosynthetic protein FliR [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492126|dbj|GAA06080.1| flagellar biosynthetic protein FliR [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 258

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 104/234 (44%), Gaps = 23/234 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+G+ ++ +P    + IP+ VR   A+A S +  P +    T DL +        +  + 
Sbjct: 21  RIGAAMLAMPFFGDALIPIWVRALLALAISFIAAPLMPAMPTTDLLSLNALTLAFEQAIW 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL-IGIIGLL 134
            +  G +   L  + TL     G +IS  +GL +        ++   P+N + I I+G +
Sbjct: 81  GILFGLILHFLFSIMTL----LGQIISLQMGLGM--------AMMNDPVNGVSIAILGRM 128

Query: 135 ALWVI-------DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
            L          D H  V   LV+S+ + P+G  L   ++    + +    F   L ++ 
Sbjct: 129 FLLFSTLLFLALDGHLLVIDILVQSFTSWPVGSGLALSSV-KQILTLFGWMFSSALAIAL 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           P +   ++ NIS G++N+  P + +Y +  P  + LG   + +S+  +  +++ 
Sbjct: 188 PAIVSMLLANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVSGVPTRYAE 241


>gi|329929261|ref|ZP_08283014.1| flagellar biosynthetic protein FliR [Paenibacillus sp. HGF5]
 gi|328936630|gb|EGG33073.1| flagellar biosynthetic protein FliR [Paenibacillus sp. HGF5]
          Length = 264

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 94/205 (45%), Gaps = 9/205 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQNFVNRAYYSKL 72
           LI CR+ S  ++ P  +   IP   ++  +   + IV L F    +  Q+        + 
Sbjct: 15  LIFCRITSFFVISPVFASRGIPSSYKIALSAIIALIVYLSFGLGEVVPQDLSYVILIVQE 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V+V L LG    L++ V    +Q  G++I   IG ++   +      +   + +    + 
Sbjct: 75  VLVGLLLGFTAYLIMAV----VQTAGALIDIQIGFSMANVIDPFTGTSTPLIGNFKYYLA 130

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQE----LNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           LL    ++ HH +F A++ SY  IPI  +    ++ GN+    V     +F++ +++++P
Sbjct: 131 LLVFLSMNGHHYLFDAIMYSYDWIPITGDVFGKIHEGNVTDFLVRTFSHSFVLAIQMAAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIY 213
            +    + ++ +G L +  PQ  ++
Sbjct: 191 LVAALFLTDVGLGFLARTAPQFNVF 215


>gi|90577373|ref|ZP_01233184.1| putative flagellar biosynthetic protein FliR [Vibrio angustum S14]
 gi|90440459|gb|EAS65639.1| putative flagellar biosynthetic protein FliR [Vibrio angustum S14]
          Length = 258

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 105/238 (44%), Gaps = 15/238 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+G+ ++ +P    + IP+ VR   A+A S +  P +    T DL +        +  + 
Sbjct: 21  RIGAAMLAMPFFGDALIPIWVRALLALAISFIAAPLMPAMPTTDLLSLSALMLAFEQAIW 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            L  G +   L  + TL     G +IS  +GL +       + ++   L  +  +   L 
Sbjct: 81  GLLFGLIIHFLFSIMTL----LGQIISLQMGLGMAMMNDPVNGVSVAILGRMFLLFSTLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H  V   LV+S+ + P+G  L   ++    + +    F   L ++ P +   ++
Sbjct: 137 FLALDGHLLVIDILVQSFTSWPVGSGLAVSSV-KQILALFGWMFSSALAIALPAIVSMLL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS------IEIIVYQFSHSFLY 245
            NIS G++N+  P + +Y +  P   L+GL S+ + +S      +E++ Y      LY
Sbjct: 196 ANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVSGVPARYVELVHYSLDQLQLY 253


>gi|256750758|ref|ZP_05491643.1| flagellar biosynthetic protein FliR [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256750341|gb|EEU63360.1| flagellar biosynthetic protein FliR [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 260

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 93/192 (48%), Gaps = 7/192 (3%)

Query: 54  LWDT---IDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQ 110
           ++DT   +DLQ   N   Y  +V+ E  +G V GL   +    +   G +I   +G  L 
Sbjct: 52  VFDTMGPVDLQ-INNVLDYFIVVISEFIVGLVIGLASMISFSAIYLAGQLIDYQLGFGLV 110

Query: 111 TSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFS 169
             + I        + + I I+ +L   +++ H+ +F  L KS   I IG+   +F  +  
Sbjct: 111 NILDIHSETQVPLMGNFIYILTILIFMLMNGHYTLFTMLAKSVDIIAIGKVAFDFSGMSQ 170

Query: 170 SFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY--LIGLGSLF 227
               M+   F++  R+S P +   ++ ++++G++++ +PQ+ ++ I  P    +G+ +L 
Sbjct: 171 VLTKMVSDMFLLGFRISVPIILTTLLTDLTLGIISRTIPQLNVFMIGMPAKIFVGIFTLL 230

Query: 228 LCLSIEIIVYQF 239
           + L + + +  F
Sbjct: 231 IMLPVYLTIIDF 242


>gi|148380604|ref|YP_001255145.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 3502]
 gi|153931538|ref|YP_001384891.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937825|ref|YP_001388360.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. Hall]
 gi|148290088|emb|CAL84207.1| flagellar biosynthetic protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152927582|gb|ABS33082.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 19397]
 gi|152933739|gb|ABS39238.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. Hall]
          Length = 609

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G ++ T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVLNVFIQYFYISIKIAVPIVFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|300717243|ref|YP_003742046.1| flagellar biosynthesis protein [Erwinia billingiae Eb661]
 gi|299063079|emb|CAX60199.1| Flagellar biosynthesis protein [Erwinia billingiae Eb661]
          Length = 261

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 111/233 (47%), Gaps = 3/233 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            LF  + RV + IM  P LS   I  +V++   +  + VLLP L  T ++  F    ++ 
Sbjct: 15  QLFWPLARVLALIMTAPLLSEKSISKKVKIGLGVMITYVLLPSLPPT-NVTLFSVGGFW- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L++ ++ +G   G  ++     ++  G VI   +GL+  T    +  L    L   + +
Sbjct: 73  -LLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPASRLNMPVLARFLDM 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + +L     + H  +   +  S+ T+PIG +   GN F +        F+  LRL+ P +
Sbjct: 132 LAMLLFLSFNGHLWLISMVADSFHTLPIGGDPINGNAFLALTKAASLIFLNGLRLALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F
Sbjct: 192 TLLLTLNLALGLLNRVAPQLSVFAIGFPVTLSIGIIFISLMMPLLAPFCEHLF 244


>gi|283785720|ref|YP_003365585.1| flagellar biosynthesis protein FliR [Citrobacter rodentium ICC168]
 gi|282949174|emb|CBG88782.1| flagellar biosynthesis protein FliR [Citrobacter rodentium ICC168]
          Length = 264

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 106/231 (45%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    ++  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERVIPKRVKLGLGIIITVVIAPAL-PPHNVPVFSFNALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  +I ++ 
Sbjct: 74  AMQQILIGIALGFTMQFTFAAVRTAGEIIGLQMGLSFATFVDPGSRLNMPVLARIIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG +    N F +  +     F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVYTFHTLPIGGDPVNSNAFLALASAGSLIFLNGLMLALPVITM 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGMTLIAALMPLIAPFCEHLF 244


>gi|327394277|dbj|BAK11699.1| flagellar biosynthetic protein FliR [Pantoea ananatis AJ13355]
          Length = 261

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 105/231 (45%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + +   P LS   +  +V++  A   + +L+P L   +++  F    +   L
Sbjct: 17  FWPLVRILALLATAPVLSEKAVSKRVKIGLAAMITWILIPNL-PPVNVTLFSPAGFM--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ ++ +G   G  ++     ++  G +I   +GL+  T    +  L    L   + ++ 
Sbjct: 74  LIQQMLIGIAIGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPASRLNMPVLARFLDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   L  S+ T+PIG E    N F + V      F+  + L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLSDSFHTLPIGGEPLQANAFMALVKSGSMIFLNGMMLALPLIVL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+ +GLLN+L PQ+ I+ I  P  + +G L + L + ++     H F
Sbjct: 194 LLTINMVLGLLNRLSPQLSIFAIGFPITLSVGILTISLLMPLLAPFCEHLF 244


>gi|15895417|ref|NP_348766.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           acetobutylicum ATCC 824]
 gi|15025140|gb|AAK80106.1|AE007715_11 FliR/FlhB fusion protein [Clostridium acetobutylicum ATCC 824]
 gi|325509563|gb|ADZ21199.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           acetobutylicum EA 2018]
          Length = 610

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 106/223 (47%), Gaps = 5/223 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           SLF++  RV +  + L  +    +P  V++  ++  S  ++P++ +   +    N   Y+
Sbjct: 8   SLFMVFLRVFAFFIALQVMFPKSLPNTVKVMLSLCISFFVMPYI-NLSQVSALNNGFLYT 66

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
              + E+  G + G    +  LG++  G  +   IG ++ T+   S     + +   + +
Sbjct: 67  WQCICEILTGLILGFFANLMFLGVKIGGQFLDFQIGYSMMTAYDPSSESNASLIERFLNM 126

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
             ++  + I  H  V   LV S+ ++ +G   +N  ++  +F N+    F+I  +++ P 
Sbjct: 127 FSVVLFFSIGGHEVVIKELVSSFNSVKLGTFVINDQSVMVAF-NVFVQFFVIGFKIALPV 185

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           +   ++ +I +GL+++ VPQ+ +  +  P  I LG    CL I
Sbjct: 186 VLVLLITDIVMGLMSRTVPQLNVMILGMPIKILLG--LTCLMI 226


>gi|332524234|ref|ZP_08400460.1| flagellar biosynthetic protein FliR [Rubrivivax benzoatilyticus
           JA2]
 gi|332107569|gb|EGJ08793.1| flagellar biosynthetic protein FliR [Rubrivivax benzoatilyticus
           JA2]
          Length = 253

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 96/216 (44%), Gaps = 4/216 (1%)

Query: 26  LPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGL 85
           +P L    +P +VR+  A   +    P L     +     +A+   LV+ ++ +G   G 
Sbjct: 30  MPVLGTRSVPTRVRIGLAGLIAFAAQPSLPAVEPVPLDSPQAFV--LVVQQVVIGLSLGF 87

Query: 86  LIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQV 145
            +R+    ++F G ++   +GLN             T  +   G        VI+ H  V
Sbjct: 88  AVRIVFAAVEFAGEIVGLQMGLNFAAFFDPIRGGTATATSRFYGTTIAWLFIVINGHLLV 147

Query: 146 FYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT-FMIMLRLSSPFLFFYIVFNISIGLLN 204
             ALV+S+   P+G E  FG +  +  ++     F   + ++ P L   +  NI +G ++
Sbjct: 148 IAALVQSFTAFPVGPE-PFGFLKEARPHLWAAEIFSTGVWIALPLLAMLLFVNIVLGAVS 206

Query: 205 KLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           ++ PQ+ ++ +  P  +G+G + + L++  +   F+
Sbjct: 207 RVAPQMNVFSVGFPITLGVGLVGILLTLPAMQGPFT 242


>gi|226950059|ref|YP_002805150.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
 gi|226843732|gb|ACO86398.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
          Length = 609

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 75/157 (47%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G  + T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGAFFINQEGIKHVLNVFIQYFYISIKIAVPIIFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|74317630|ref|YP_315370.1| flagellar biosynthesis protein FliR [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057125|gb|AAZ97565.1| flagellar biosynthesis protein FliR [Thiobacillus denitrificans
           ATCC 25259]
          Length = 262

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 103/228 (45%), Gaps = 8/228 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVM 74
            R+   +M+ P      +P +V++   +  +++  P L     + L +     ++   ++
Sbjct: 21  TRILGLVMVAPVFGHRAVPGRVKIGLGIFIALIAAPTLPPMPAVGLGS-----WHGLFIL 75

Query: 75  VELFL-GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           V+ FL G   G ++R+    ++  G +I   +GL   +      +     L     ++ +
Sbjct: 76  VQQFLIGVAIGFIMRIVFAAVEAAGEIIGLQMGLGFASFFDPQSAGQTLVLARFFNMLAV 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L +  ++ H  +   LV+S+  +PI  E      F +      T F + L+L+ P +   
Sbjct: 136 LLMLAVNAHLLLLGVLVESFQILPISHEPLAAAGFRNVAAFGTTIFSLGLQLALPLIAIL 195

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           ++ N+++G+L +  PQ+ I+ I  P  +G+G + L +++     QF  
Sbjct: 196 LMTNLTLGILTRSAPQLNIFAIGFPITLGVGLIMLDVTLPYFAPQFEQ 243


>gi|170761528|ref|YP_001787967.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408517|gb|ACA56928.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A3
           str. Loch Maree]
          Length = 609

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 75/157 (47%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G  + T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGTFFINQEGIKHVLNVFIQYFYISIKIAVPIIFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|225850261|ref|YP_002730495.1| flagellar biosynthetic protein FliR [Persephonella marina EX-H1]
 gi|225646347|gb|ACO04533.1| flagellar biosynthetic protein FliR [Persephonella marina EX-H1]
          Length = 260

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 120/239 (50%), Gaps = 9/239 (3%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVR--LCFAMAFSIVLLPFLWDTIDL 60
           I+PEI  ++  L++ R+    +  P L+   IP  VR  L  +++F I+ +  +   I  
Sbjct: 5   ITPEI-AITFGLVLSRIIGIFLSFPLLNTGLIPANVRILLVVSLSFYIMKIFGINAGISP 63

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL- 119
           +NF    Y+  LV+ EL +G + GLL+ ++     +   +IS  +G    T + + D   
Sbjct: 64  ENFSVLLYF-LLVLKELLMGFLLGLLVNLFISAFSYAAEIISYFMGF---TIVNLFDPTF 119

Query: 120 -AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTT 178
              + L+    ++  L  ++   +  V  +L  ++  +P+G+     +IF   +  L   
Sbjct: 120 GQISVLDRFFILLFYLLFFITGAYQIVLGSLFMTFKIMPVGKLYINTDIFPHLLEKLPIL 179

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
           F + L+++ PF+   ++ N+++ L+N+L+PQI ++ +  P  I +G   L +   +I+Y
Sbjct: 180 FYLALKIAFPFVLILLIVNVALALINRLIPQINVFIVGLPLQIFVGLASLAIGTSLIIY 238


>gi|167034910|ref|YP_001670141.1| flagellar biosynthesis protein FliR [Pseudomonas putida GB-1]
 gi|166861398|gb|ABY99805.1| flagellar biosynthetic protein FliR [Pseudomonas putida GB-1]
          Length = 258

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 102/212 (48%), Gaps = 13/212 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           RV + +M +P      +P +VRL  A+A ++V++P L     +D + L+  +       L
Sbjct: 22  RVTAVLMTMPIFGTRMLPARVRLYVAVAITVVIVPALPPLPEFDPLSLRGLL-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++  + ++ 
Sbjct: 75  CAEQIIVGALFGLALQLLFQAFVIAGQIVAVQMGMAFASMVDPANGVNVTVISQFMTMLV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L  P +  
Sbjct: 135 SVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFAAGLLLILPVIAA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +V NI+ G++ +  PQ+ I+ I  P  + LG
Sbjct: 194 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLG 225


>gi|323703183|ref|ZP_08114836.1| flagellar biosynthetic protein FliR [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531842|gb|EGB21728.1| flagellar biosynthetic protein FliR [Desulfotomaculum nigrificans
           DSM 574]
          Length = 255

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 63/131 (48%)

Query: 94  LQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSY 153
           ++  G ++   IG  + + M        T ++  +  + L+    +D HH +  AL KSY
Sbjct: 91  IRMAGQLLDFQIGFAMASVMDPLSGSVNTLVSRFLYFLTLVLFLNVDGHHVLIRALAKSY 150

Query: 154 GTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIY 213
             +P+      G +    + +   TF + +++ +P +   ++ ++++GL+ K  PQ+ I+
Sbjct: 151 ELVPLNAAGINGEVTLLIIRIFADTFALAVQICAPVVAVLVITDLAMGLVGKTAPQMNIF 210

Query: 214 FISTPYLIGLG 224
            +  P  I +G
Sbjct: 211 QLGFPLKIAVG 221


>gi|237796086|ref|YP_002863638.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
 gi|229263066|gb|ACQ54099.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
          Length = 609

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 75/157 (47%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G  + T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGTFFINQEGIKHVLNVFIQYFYISIKIAVPIIFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|124265770|ref|YP_001019774.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
 gi|124258545|gb|ABM93539.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
          Length = 256

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 110/237 (46%), Gaps = 23/237 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL---LPFLWDTIDLQNFVNRAYYSKLVM 74
           RV +  +  P LSM  +P++V++  A   +I     LP +   I L    + A   + V+
Sbjct: 22  RVLALFISAPVLSMRSVPVRVKVALAFFITIAAQASLPPM-PVIAL----DSAQAFEAVI 76

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            +L +G   G   R+   G++F G +I   +GLN        D ++ +   ++    G  
Sbjct: 77  QQLVIGLALGFSARIVMAGIEFAGEMIGLQMGLNFA---AFFDPISASQSTAVSRFFGTS 133

Query: 135 ALW---VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ------TTFMIMLRL 185
           A W   V++ H  +  A+++S+   P+           +F++ LQ        F + L +
Sbjct: 134 AAWLFVVMNGHLLLTAAVIQSFHAFPVATP---EAAPLAFLSALQPQLWGAEVFRLGLWI 190

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P +   +  N+ +GL++++  QI I+ I  P  +G+G + + L++  +   F+ +
Sbjct: 191 ALPIITMLLFMNLVLGLISRVASQINIFAIGFPITLGVGLVGITLTLPFMEQPFTMA 247


>gi|315932323|gb|EFV11266.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 255

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 98/212 (46%), Gaps = 6/212 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++     A  + L  +L+    L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIK----SAIVLFLTMYLYPLARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFF 192
           +     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L  
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFTMSFPILGI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 192 SLLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|153939695|ref|YP_001391947.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum F str. Langeland]
 gi|152935591|gb|ABS41089.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. Langeland]
 gi|295319965|gb|ADG00343.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. 230613]
          Length = 609

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 75/157 (47%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G  + T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVLNVFIQYFYISIKIAVPIVFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFIFAL 229


>gi|167626136|ref|YP_001676430.1| flagellar biosynthetic protein FliR [Shewanella halifaxensis
           HAW-EB4]
 gi|167356158|gb|ABZ78771.1| flagellar biosynthetic protein FliR [Shewanella halifaxensis
           HAW-EB4]
          Length = 232

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 107/239 (44%), Gaps = 35/239 (14%)

Query: 24  MLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMVELFLGC 81
           M++P L  +YIP  VR+  A++ S ++ P L  +  +D  +F       + +++   L  
Sbjct: 1   MVMPFLGNAYIPATVRILLAISISALIAPMLPPFPAVDAISFQALILAVEQLLIGFMLAL 60

Query: 82  VHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG----IIGLLALW 137
              ++I V TL     G+++S  +GL    SM + +  +    N ++G    + G L   
Sbjct: 61  FLSIMIHVMTL----FGAMMSMQMGL----SMAVMNDPSSGGANPILGLWFMLYGTLLFL 112

Query: 138 VIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            +D H      LV S+   PIG    +L    + + F  +    FM+ L    P +   +
Sbjct: 113 ALDGHLVAIGILVDSFHLWPIGMGVFDLPLMGLIARFSWIFAAAFMLAL----PAILAML 168

Query: 195 VFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLF------------LCLSIEIIVYQF 239
           V N++ G+L++  P + ++ +  P   L+GL  +F            LCL     +YQF
Sbjct: 169 VVNLTFGVLSRAAPSLNVFALGFPMSMLMGLLCVFFSFSGLPTRYSDLCLDALSAMYQF 227


>gi|294140215|ref|YP_003556193.1| flagellar biosynthetic protein FliR [Shewanella violacea DSS12]
 gi|293326684|dbj|BAJ01415.1| flagellar biosynthetic protein FliR [Shewanella violacea DSS12]
          Length = 265

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 103/230 (44%), Gaps = 14/230 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV S  M++     +  P++VR   +MA +  ++P L    +++ F   A +  + + +L
Sbjct: 21  RVSSMFMVMAVFGANTTPVRVRALLSMAITFAIVPVLPPVENVELFAASAMF--ITLQQL 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIGII 131
            +G   G +  +       TG +I       +QTS+G +      S  +TP + +L  ++
Sbjct: 79  LIGIAMGFVTLLVMQTFVLTGQII------GMQTSLGFASMVDPSSGQQTPVIGNLFLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             +    +D H  +   LV S+ TIPI  +      +    +     F   L +S   + 
Sbjct: 133 TTMIFLAVDGHLVMIRMLVMSFETIPISDQGLSITSYRMLADWGGYMFGAALTMSITPIV 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
             ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F+ 
Sbjct: 193 ALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLVILWLTLTPIMEHFNE 242


>gi|294084389|ref|YP_003551147.1| flagellar biosynthetic protein FliR [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663962|gb|ADE39063.1| flagellar biosynthetic protein FliR [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 225

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 91/183 (49%), Gaps = 8/183 (4%)

Query: 34  IPMQVR--LCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYT 91
           +P+Q+R  + F +A S+ +     + ID+ N +       ++  E+ +G   GL++ ++ 
Sbjct: 1   MPLQIRIIMAFMLAMSVAIQ---VEPIDV-NVITSLPGFMIMATEITIGLAAGLVLTIWF 56

Query: 92  LGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWV-IDFHHQVFYALV 150
            G    G  I++  GL     +  S    +TP+ S I  + L  +++ +D H  V   ++
Sbjct: 57  AGALLAGEKIASTAGLGFAAQVDPSTG-GQTPVISQILYLFLTVIFLSLDGHLMVIRIML 115

Query: 151 KSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQI 210
           +SY  +P+G   + G +  + ++   + F +   +  P +   ++ N+SIG++ +  PQ+
Sbjct: 116 ESYSIMPLGHVPDMGILVEAGISAAGSMFFVGAIIMLPVVIILLMINVSIGVITRSAPQL 175

Query: 211 PIY 213
            ++
Sbjct: 176 NLF 178


>gi|322806976|emb|CBZ04546.1| flagellar biosynthesis protein FlhB [Clostridium botulinum H04402
           065]
          Length = 609

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 75/157 (47%), Gaps = 2/157 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G + G +     +  ++ G+++   +G  + T    S +   T L  ++     + 
Sbjct: 73  EILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVTFLERILYWFSTIV 132

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ID HH +  ALV+S+  I +G            +N+    F I ++++ P +F  ++
Sbjct: 133 FFLIDGHHMLIRALVESFNVIKLGAFFINQEGIKHVLNVFIQYFYISIKIAVPIVFIILI 192

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL 230
            ++++GL+ + VPQ+ I  +  P   L+GL +    L
Sbjct: 193 TDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFAL 229


>gi|188592194|ref|YP_001796792.1| flir: flagellar biosynthesis inner membrane protein. flir/mope/spar
           family. [Cupriavidus taiwanensis LMG 19424]
 gi|170938568|emb|CAP63555.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Cupriavidus taiwanensis LMG 19424]
          Length = 265

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 101/225 (44%), Gaps = 16/225 (7%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F I+  +G+     P    S IP + ++  +   ++V+ P    TI     V    +  L
Sbjct: 21  FRILALIGTA----PLFGESTIPRRAKIALSALIAMVVSP----TIAQVPVVPVYSFGGL 72

Query: 73  VMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           +++  E+ +G   G ++R+    +Q  G +I   +GL+  +    +       L+  + +
Sbjct: 73  MIILNEVGIGLATGFVMRLVFATVQQAGEIIGLQMGLSFASFFDRAAGGQTMVLSRFLNL 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQE-----LNFGNIFSSFVNMLQTTFMIMLRL 185
           I +L    +D H  +  ALV S+ ++PIG       L+ G   +         F   L L
Sbjct: 133 IAVLLFLALDGHLLMLGALVDSFNSLPIGGNPGGTPLSAGGAMA-VARAGGMVFASGLLL 191

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           + P +   ++ N+++G+LN+  PQ+ I+ +  P  +  G L L L
Sbjct: 192 ALPMIAALLILNLAMGILNRASPQLSIFAVGFPVTLSGGLLVLML 236


>gi|168704084|ref|ZP_02736361.1| flagellar biosynthesis protein FliR [Gemmata obscuriglobus UQM
           2246]
          Length = 254

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 95/219 (43%), Gaps = 22/219 (10%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ-------- 61
           ++L L++ R+G+ + ++P L  +  P  VR        +VL  F       +        
Sbjct: 6   VALGLLLARIGAFVAVMP-LFAARTPRTVR----AGMVVVLAAFYVGPAGAELAAAPPGS 60

Query: 62  -NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
              V+   Y  ++  E  +G   G    ++ L  +  G  ++  IGLN+   +G +   +
Sbjct: 61  VREVDPLRYGLVLAREALIGVAMGFAFGLFLLPGRIAGEFVTQQIGLNISPQLGPAGGES 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSS---FVNMLQT 177
             PL ++    G L   ++D HH V  A   S+  +PIG     G++       V  L +
Sbjct: 121 GGPLTNVFETAGALVFLLVDGHHIVLMAFHASFAALPIG-----GSVVPEAGPMVTGLAS 175

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFIS 216
            + + L L++P      + +I++ ++ +  PQ+ IY + 
Sbjct: 176 AYEMGLLLAAPLALCLFLLSITLAVMARAAPQLNIYSVG 214


>gi|229544410|ref|ZP_04433468.1| flagellar biosynthetic protein FliR [Bacillus coagulans 36D1]
 gi|229324895|gb|EEN90572.1| flagellar biosynthetic protein FliR [Bacillus coagulans 36D1]
          Length = 259

 Score = 46.2 bits (108), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 108/246 (43%), Gaps = 18/246 (7%)

Query: 11  SLFLIV-CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           S+FL+V  RV +  +++P  S   +P + R+      S+++      TI  + F     Y
Sbjct: 9   SIFLLVFIRVTTFFIMMPLFSHRSVPARFRIGLGFFLSVLVT----YTIHAKPFTMDGAY 64

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN---- 125
             L++ E  +G + G +       +Q  G+ I    G ++   +    S A+TPL     
Sbjct: 65  FMLMIKEALVGLLLGFVAYFILSAVQLAGTFIDFQAGFSMANVID-PQSGAQTPLTGEYL 123

Query: 126 -SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMI 181
            +   ++ L           ++Y    SY  IP+ Q    L   N+      +L   F++
Sbjct: 124 YTFALLLLLSLNGHHLLLDGIYY----SYSFIPLDQAWVHLGSFNLAKYLATLLARVFLV 179

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
             ++S+P +    + +I++G++ + VPQ+ I+ +  P  I +  + L +++  I     H
Sbjct: 180 AFQMSAPVVAVLFLTDIALGIIARTVPQLNIFVVGFPVKIAVSLIALAVAMGTIYIAVEH 239

Query: 242 SFLYGF 247
            F + F
Sbjct: 240 LFEWMF 245


>gi|313905146|ref|ZP_07838515.1| type III secretion system inner membrane R protein [Eubacterium
           cellulosolvens 6]
 gi|313470049|gb|EFR65382.1| type III secretion system inner membrane R protein [Eubacterium
           cellulosolvens 6]
          Length = 250

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 101/222 (45%), Gaps = 7/222 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY-YSKL 72
           LIV R+   I+L P    S IP  V+     AFS++L  F+W    L       + ++ +
Sbjct: 7   LIVMRMTGAIVLNPMTGRSEIPALVKGALTFAFSLML--FMWTGGRLAVAPKTWFEFASM 64

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + EL LG   G  + +    ++F  +++   +GL++            T  + L     
Sbjct: 65  ALRELLLGFTIGFGMELSMTVIRFGTAIVDYMMGLSMAQVYDPRSGAQMTVSSGLYTTFM 124

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM-LRLSSPFLF 191
           +L   V D H + F  +  +   IP G  ++F      F+       +IM L+ + P + 
Sbjct: 125 MLVFLVNDGHLRFFQLVFGTADKIPFG-AVHFTVELPQFMMKYYCECIIMGLQFAMPIIV 183

Query: 192 FYIVFNISIGLLNKLVPQIPIYFIS--TPYLIGLGSLFLCLS 231
             ++  ++IG++ ++VPQI I+ I+     ++GL  LFL  +
Sbjct: 184 IELLAEVAIGIMMRVVPQINIFAINFQVKIIVGLVMLFLLFA 225


>gi|86152607|ref|ZP_01070812.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|121612403|ref|YP_001000854.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157415443|ref|YP_001482699.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|283956577|ref|ZP_06374056.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|85843492|gb|EAQ60702.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87249142|gb|EAQ72103.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157386407|gb|ABV52722.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|283791826|gb|EFC30616.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|307748085|gb|ADN91355.1| Flagellar biosynthetic protein fliR [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 255

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 97/212 (45%), Gaps = 6/212 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFF 192
           +     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L  
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFTMSFPILGI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 192 SLLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|108758221|ref|YP_630669.1| FliR/MopE/SpaR family protein [Myxococcus xanthus DK 1622]
 gi|108462101|gb|ABF87286.1| FliR/MopE/SpaR family protein [Myxococcus xanthus DK 1622]
          Length = 272

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 99/214 (46%), Gaps = 7/214 (3%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ ++ L++CRV   ++  P L    +P ++++   +  SIVL P +  ++         
Sbjct: 19  VIFTVALVMCRVMPVLIFSPFLGGEVVPTELKMGIGLTLSIVLYPLIAGSVTSIPLSALP 78

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           Y + L+  E+F+G     ++       +  G+++ T  G N    + +     +  L S 
Sbjct: 79  YIA-LMAKEVFVGFTIAFVVNTLFEAARVAGNLVDTMSGSN-NAQLYVPQLGQQVTLFSS 136

Query: 128 IGI-IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             + + ++    ++ HH V  AL  S   +P+     F +    F +++   F  +LR+S
Sbjct: 137 FKVQLAVVLFLTLNGHHLVIEALADSLVAVPLDGFPRFHDGPWPFFDLMIRVFADLLRVS 196

Query: 187 SPFLFFYIVF----NISIGLLNKLVPQIPIYFIS 216
                  ++     ++++G +N++ PQI ++FIS
Sbjct: 197 LALAAPAMLATFLTDVALGAINRVAPQIQVFFIS 230


>gi|205356203|ref|ZP_03222969.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|205345808|gb|EDZ32445.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
          Length = 255

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 97/212 (45%), Gaps = 6/212 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFF 192
           +     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L  
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFAMSFPILGI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 192 SLLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|148976241|ref|ZP_01812965.1| putative flagellar biosynthetic protein FliR [Vibrionales bacterium
           SWAT-3]
 gi|145964335|gb|EDK29590.1| putative flagellar biosynthetic protein FliR [Vibrionales bacterium
           SWAT-3]
          Length = 260

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 96/218 (44%), Gaps = 7/218 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF-VNRAYYSKLVMV 75
            R     ++ P      IP++V+L FA  FS++L P + +      F ++   +S     
Sbjct: 21  VRFTGLFLIAPFFGDKAIPVRVKLLFAFIFSLLLAPMVKEVPPFNPFSIDTLLFS---FY 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           +L  G + G  + ++       G  IS  +GL +      ++ ++   +  ++ I  +L 
Sbjct: 78  QLIFGFLIGFAVMIFFTIFSIAGQAISMQMGLAMAVMNDPANGVSIAIIGRIMFITSMLL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H  V     +S+   P+     F +I    + M+   F   L ++ P +   ++
Sbjct: 138 FLSLDGHLVVLLVFKESFEYWPLNSPFPFNSI-EYVLKMVSWMFATGLLVAVPAIVVMLL 196

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
            NI+ GL+NK  P + ++ +  P   L+GL +L   L+
Sbjct: 197 SNITFGLMNKAAPSLNVFALGFPMTMLLGLFALMASLT 234


>gi|322378523|ref|ZP_08052971.1| flagellar biosynthesis protein FliR [Helicobacter suis HS1]
 gi|322379824|ref|ZP_08054119.1| flagellar biosynthesis protein FliR [Helicobacter suis HS5]
 gi|321147747|gb|EFX42352.1| flagellar biosynthesis protein FliR [Helicobacter suis HS5]
 gi|321149037|gb|EFX43489.1| flagellar biosynthesis protein FliR [Helicobacter suis HS1]
          Length = 275

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 95/234 (40%), Gaps = 3/234 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+   I L P    + IP+ +R   +   ++V  P L        +     +    
Sbjct: 38  LLFLRLSGVIALFPFFDNNLIPVSIRGALSFFLTLVFYPTLPHP---PLYTTAETFLIAC 94

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E FLG      ++V    + F    IS ++GL + ++        +  +  ++ ++ +
Sbjct: 95  CAEFFLGLCASFFLQVVFHAIAFATDTISFSMGLTMASAYDPISGAQKAIVGQVVLLLAI 154

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L +     HH +   +  S   IP+G  +   +I  + +  L   FM+   ++ P L   
Sbjct: 155 LIMLQTSMHHLIILWVQHSLEKIPLGGFVFTSHIAQASMQALGHLFMVGFSMAFPILAII 214

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           +  +I  G++ K  PQ  +  I  P  I +  L L L +  I+++F    L  F
Sbjct: 215 MFGDIVFGMIMKTHPQFNLLAIGFPLKIAIALLGLILIMASIMHRFKEQLLQAF 268


>gi|28211317|ref|NP_782261.1| flagellar biosynthetic protein fliR/B [Clostridium tetani E88]
 gi|28203757|gb|AAO36198.1| flagellar biosynthetic protein fliR/B [Clostridium tetani E88]
          Length = 539

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 107/220 (48%), Gaps = 7/220 (3%)

Query: 35  PMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGL 94
           P  +++ F +  S +L+P + D   + N  N   +      E+  G   G + ++  + +
Sbjct: 36  PAILKVAFTLILSYMLVPGI-DYSQISNINNTMVFITNCSSEIITGLALGFMTQLCFMAI 94

Query: 95  QFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYG 154
           +  G+ +   +G ++ + +  + S   T +  L+   GL+  +++D HH +   L+ S+ 
Sbjct: 95  RLGGNYMDIQVGFSMVSMLDPNTSSNSTLIERLLYWTGLILFFMVDGHHMLITQLIDSFN 154

Query: 155 TIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYF 214
            + IG+ +      S  + +    F++ L+++ P +   I+  +++GL+ + VPQ+ +  
Sbjct: 155 AVTIGRFILNQETASIIIEVFIQFFIMGLKIAIPIVLIIIIAELTLGLVGRAVPQLNVMI 214

Query: 215 ISTPY--LIGLGSLFLCLSI--EIIVYQFSH--SFLYGFF 248
           +  P   ++GL +L L + I  ++I   FS+      GFF
Sbjct: 215 LGLPLKIIVGLATLILAMPIIFKLIATGFSNIPEAFKGFF 254


>gi|83747645|ref|ZP_00944681.1| FliR [Ralstonia solanacearum UW551]
 gi|207739726|ref|YP_002258119.1| flagellar biosynthetic protein flir [Ralstonia solanacearum
           IPO1609]
 gi|83725697|gb|EAP72839.1| FliR [Ralstonia solanacearum UW551]
 gi|206593108|emb|CAQ60014.1| flagellar biosynthetic protein flir [Ralstonia solanacearum
           IPO1609]
          Length = 262

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 90/210 (42%), Gaps = 12/210 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  S + IP  +++ F +  ++ L P L     +   V+   Y  L   ++
Sbjct: 22  RVLAFIAMAPPFSNTEIPTSIKVAFGVVLTVALAPML----PVPQGVSVGSYEGLWITLL 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G  +++    +   G ++S  IGL   T +    + +   L   I +  + A
Sbjct: 78  QVAIGMALGFCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGRFISLTAITA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + +AL  S+  +P+      G  + +        F + +R++ P +   +V
Sbjct: 138 FIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGSAVFALAVRIALPIIAIMMV 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGS 225
            N++  +L++    +       P+ +G+ +
Sbjct: 198 VNLAFAVLSRTAQAL------NPFAVGIAA 221


>gi|237753461|ref|ZP_04583941.1| flagellar biosynthetic protein flir [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375728|gb|EEO25819.1| flagellar biosynthetic protein flir [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 259

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 79/172 (45%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+ LG +  + +++    + F G +IS A+GL +  +        +  +  L+ ++ LL 
Sbjct: 77  EVMLGFLASMALQIVFGMISFGGELISFAMGLTIANAYDPVTGAQKPIVGQLLTLLALLI 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
           +  +D+HH  FY + +S   IP+G  +   N     +      F+I L +S P +   ++
Sbjct: 137 MLGLDYHHLFFYFVSESVKEIPLGGFMYSQNYIEYIIKSFSHIFVIGLTMSFPIIALILL 196

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +I  G++ K  PQ  +  I  P  I +    L + +  I+  F   FL  F
Sbjct: 197 SDIIFGMIMKAHPQFNLLAIGFPVKIAIAFAVLIVIVPAIILHFKREFLSAF 248


>gi|116694512|ref|YP_728723.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
 gi|113529011|emb|CAJ95358.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
          Length = 261

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 98/221 (44%), Gaps = 12/221 (5%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F I+  +G+     P    S IP + ++  +   ++V+ P    TI     V    +  L
Sbjct: 21  FRILALIGTA----PLFGESTIPRRAKIALSAMVAVVVSP----TIAQLPVVPVYSFGGL 72

Query: 73  VMV--ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
           +++  E+ +G   G  +R+    +Q  G +I   +GL+  +    +       L+  + +
Sbjct: 73  MIILNEVGIGLATGFAMRLVFATVQQAGEIIGLQMGLSFASFFDRAAGGQTMVLSRFLNL 132

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           I +L    +D H  +  ALV S+  +PIG   L+ G   +         F   L L+ P 
Sbjct: 133 IAMLLFLALDGHLLMLGALVDSFSGLPIGGTPLSAGGAMA-VARAGGMVFSSGLLLALPM 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           +   +  N+++G+LN+  PQ+ I+ +  P  +  G L L L
Sbjct: 192 IAALLTLNLAMGILNRASPQLSIFAVGFPVTLSGGLLVLML 232


>gi|258624669|ref|ZP_05719604.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM603]
 gi|262173374|ref|ZP_06041051.1| flagellar biosynthesis protein FliR [Vibrio mimicus MB-451]
 gi|258583061|gb|EEW07875.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM603]
 gi|261890732|gb|EEY36719.1| flagellar biosynthesis protein FliR [Vibrio mimicus MB-451]
          Length = 258

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 100/219 (45%), Gaps = 11/219 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RVG+  + +P    + IP+ VR   A+A  ++  P +     +  F   + +  L   ++
Sbjct: 21  RVGAVFISMPFFGDALIPIWVRSLLALAIVVITAPLIPTMPAVDLFSMTSLF--LAFEQV 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G + GL++ +        G ++S  +GL +       + ++   L  L  I   L   
Sbjct: 79  IWGIIFGLILHMLFTVFAMLGQIVSLQMGLGMAMMNDPVNGISVAVLGRLFLIFSTLLFL 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            ++ H  V   L++S+   P+G     L+   + ++F  M  ++    L L+ P +   +
Sbjct: 139 ALEGHLLVIDVLIQSFVIWPVGSGITSLSLQGVINAFGWMFASS----LALALPAIISML 194

Query: 195 VFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
           + NIS G++N+  P + IY +  P   L+GL S+ + +S
Sbjct: 195 LANISFGVMNRAAPSLNIYALGFPMTMLLGLFSVLISVS 233


>gi|255099431|ref|ZP_05328408.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-63q42]
          Length = 516

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 71/141 (50%), Gaps = 9/141 (6%)

Query: 109 LQTSMGIS-------DSLAETPL-NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ 160
           +   MG+S       +S+ +T L ++L+    L+  + +D HH +   +  S+  IPIG+
Sbjct: 1   MDQQMGLSMINMFDPNSMTQTTLIDNLMNWTALMIFFNMDGHHVLIRGIRYSFELIPIGK 60

Query: 161 ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
                NI    +N+    F+   +++ P +   ++ +  +GL+++ VPQ+ +  +  P  
Sbjct: 61  PFVDNNI-DYIINIFVQCFLTGFKIAIPIVLCLLMADFILGLISRSVPQLNVMIVGMPLK 119

Query: 221 IGLGSLFLCLSIEIIVYQFSH 241
           I +G     +SI +IV Q SH
Sbjct: 120 ILVGIALFIISIPLIVNQISH 140


>gi|46445834|ref|YP_007199.1| putative type III secretion inner membrane protein SctT [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46399475|emb|CAF22924.1| putative type III secretion inner membrane protein SctT [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 280

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 100/213 (46%), Gaps = 19/213 (8%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLP---FLWDTIDLQNFVNRAYYSKLVM 74
           R+   I L P      +P  V++  A++F ++ LP   F+  T    N +   Y+ K   
Sbjct: 32  RMLPIIALAPFFGARVLPHPVKITLAISFFVIFLPQLIFVTTTPITFNLLLVLYFFK--- 88

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE---TPLNSLIGII 131
            ELF+G + G LI +  + +Q  G +I    G    +S+ I+D   +   +PL +L  ++
Sbjct: 89  -ELFVGLLLGYLISIPFIIVQNCGILIDHQRG---GSSLMINDPTLQNQSSPLGTLFNLV 144

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNF------GNIFSSFVNMLQTTFMIMLRL 185
            +   ++ID    +   + +SY  +P  + L         NI    + ++    ++  +L
Sbjct: 145 LIYLFFMIDGPFMILDIISQSYSILPPDKFLTAKFFTMNSNIVIDVMKIVGKVMILSTQL 204

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           ++P L   ++ +  +G+ N+L PQ+ I F+  P
Sbjct: 205 AAPALIMILMTDFFLGIANRLAPQVQITFLGMP 237


>gi|258622508|ref|ZP_05717530.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM573]
 gi|258585208|gb|EEW09935.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM573]
          Length = 258

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 100/219 (45%), Gaps = 11/219 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RVG+  + +P    + IP+ VR   A+A  ++  P +     +  F   + +  L   ++
Sbjct: 21  RVGAVFISMPFFGDALIPIWVRSLLALAIVVITAPLIPTMPAVDLFSMTSLF--LAFEQV 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G + GL++ +        G ++S  +GL +       + ++   L  L  I   L   
Sbjct: 79  IWGIIFGLILHMLFTVFAMLGQIVSLQMGLGMAMMNDPVNGISVAVLGRLFLIFSTLLFL 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            ++ H  V   L++S+   P+G     L+   + ++F  M  ++    L L+ P +   +
Sbjct: 139 ALEGHLLVIDVLIQSFVIWPVGSGITSLSLQGVINAFGWMFASS----LALALPAIISML 194

Query: 195 VFNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
           + NIS G++N+  P + IY +  P   L+GL S+ + +S
Sbjct: 195 LANISFGVMNRAAPSLNIYALGFPMTMLLGLFSVLISVS 233


>gi|237731998|ref|ZP_04562479.1| flagellar biosynthesis protein FliR [Citrobacter sp. 30_2]
 gi|226907537|gb|EEH93455.1| flagellar biosynthesis protein FliR [Citrobacter sp. 30_2]
          Length = 261

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 97/212 (45%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P +   +D+  F   A +   
Sbjct: 17  FWPLLRVLALISTAPILSERAIPKRVKLGLGLMITVVIAPSI-PAVDVPIFSVGALWQA- 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G +I   +GL+  T       L    L  LI ++ 
Sbjct: 75  -MQQILIGIALGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLARLIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGGNPVNSNAFLALARAGSLIFLNGLMLALPVMTL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ ++ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSVFVIGFPLTLTVG 225


>gi|116514993|ref|YP_802622.1| hypothetical protein BCc_050 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|116256847|gb|ABJ90529.1| type III protein export, membrane component [Buchnera aphidicola
           str. Cc (Cinara cedri)]
          Length = 266

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 65/138 (47%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++F+G V G LI+    GL F G + S  IGL+         +      ++L  I  L  
Sbjct: 78  QIFIGIVLGFLIKNVLFGLFFIGEIFSLQIGLSSLNFFYFDKNTYSLIFSNLFSIFFLFT 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
            ++ + H ++   L+ S+   P+   + +  IF   VN L   F   +    P LFF+++
Sbjct: 138 FFICNMHLKLLVLLIHSFEIYPLNNFIFYKKIFFYIVNFLNIIFFQSVSFILPILFFFLI 197

Query: 196 FNISIGLLNKLVPQIPIY 213
             I+   +NKL+P++  +
Sbjct: 198 LYITYIFINKLIPKVSFF 215


>gi|83646792|ref|YP_435227.1| flagellar biosynthesis pathway protein FliR [Hahella chejuensis
           KCTC 2396]
 gi|83634835|gb|ABC30802.1| Flagellar biosynthesis pathway, component FliR [Hahella chejuensis
           KCTC 2396]
          Length = 226

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 67/161 (41%), Gaps = 7/161 (4%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           EL LG    L +       Q  G +I    G      M  + + AE  + +++       
Sbjct: 46  ELVLGLAMALGLHAAFTVFQIAGRLIDFQSGFGAANIMNPATNSAEPLMGTILLFFATFV 105

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            + +D HH V   L  S   +P G     ++F      F  M    F   + L++P L  
Sbjct: 106 FFSMDAHHMVIKGLAYSVAQVPPGSGLVRMDFPGAMKQFGLM----FSFAMVLAAPVLAV 161

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
             + ++ + ++ + +PQ+ +YF+  P  + LG +   LS++
Sbjct: 162 LFLLDVGVAVMARTMPQMNVYFLFLPLKVALGIIVTALSLK 202


>gi|332669211|ref|YP_004452219.1| flagellar biosynthetic protein FliR [Cellulomonas fimi ATCC 484]
 gi|332338249|gb|AEE44832.1| flagellar biosynthetic protein FliR [Cellulomonas fimi ATCC 484]
          Length = 255

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 96/211 (45%), Gaps = 10/211 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L   R+ + +++ P  S   +P  V++  A+  ++ + P L     + +    A+   LV
Sbjct: 18  LASVRMAAFLVIAPPFSQRAVPPFVKVALALGLALAVAPRLEP---VPSDTTPAFVGALV 74

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP---LNSLIGI 130
             +  +G   G L+ +    +Q  GS+I    G  L T+    D L++T       L  +
Sbjct: 75  -AQAVIGAGLGFLVSLVFSAVQSAGSLIDLFGGFQLATAY---DPLSQTSGAQFGRLYQM 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L+ L+  D +  V   LV+++  +P+G  L+   + S+    L   F+  L+++ P L
Sbjct: 131 TALVLLFASDAYQVVVAGLVRTFDALPLGALLDPAALASTLTEGLTQMFLAALQIAGPLL 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
               + ++ +GLL ++ P +  + +  P  I
Sbjct: 191 VVLFLADVGLGLLTRVSPALNAFAMGFPLKI 221


>gi|157738151|ref|YP_001490835.1| flagellar biosynthetic protein FliR [Arcobacter butzleri RM4018]
 gi|157700005|gb|ABV68165.1| flagellar biosynthetic protein FliR [Arcobacter butzleri RM4018]
          Length = 249

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 103/239 (43%), Gaps = 13/239 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+ + ++ +P    + I + VR+ FA   SI + PF    +D+   +N+  +   +
Sbjct: 18  LLLARILAFVVFMPVFGHTAINVTVRIAFAFYLSIFIYPF----VDIVTSINQNNFIISL 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ LG V  +L+ +    ++  G  +  +  L++      + +  E  +  L+  I L
Sbjct: 74  ISEITLGLVAAMLVNIIFSAVRIIGEFVEYSTALSMAMMFDPTTNSQEGLVAKLLFWISL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSS-----FVNMLQTTFMIMLRLSSP 188
           +  +    +      L KS+  I +G      NIFS       ++ ++  F      + P
Sbjct: 134 MLFFQTGMYEMTLVILAKSFTMIHLGS----FNIFSYDGIQLAIDEIKRMFSFAFAFALP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             F   + ++  G   K +P    + I+      L  +FL L +EI    F++ F+  F
Sbjct: 190 LFFIGFIMDVYYGYGTKSMPAFSPFIITFQLKFALIFIFLILGMEIFADTFTNYFINKF 248


>gi|238025695|ref|YP_002909926.1| flagellar biosynthetic protein FliR [Burkholderia glumae BGR1]
 gi|237874889|gb|ACR27222.1| Flagellar biosynthetic protein FliR [Burkholderia glumae BGR1]
          Length = 259

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 92/204 (45%), Gaps = 7/204 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ + +   P +  + +P++V++  +   +I + P L        F     +   ++V 
Sbjct: 21  VRILALVAAAPLIGNAAVPVRVKIGLSALTAIAVAPALGPLPQATVFSAEGIW---ILVN 77

Query: 77  LFL-GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLL 134
            FL G   G ++++    ++  G  I   +GL   T          TP+   ++    +L
Sbjct: 78  QFLIGVSMGFVMQIVFAVVEAAGDYIGLQMGLGFATF--FDPHAGTTPMMGRILNAFAML 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
           A    D H Q+  ALV+S+ ++PI  +L     + +        F + L L+ P +   +
Sbjct: 136 AFVAFDGHLQLIAALVESFASVPISADLLHPAGWQTLAGAGINVFAMGLLLALPVVAALL 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTP 218
           + N+++G+LN+  PQI I+ I  P
Sbjct: 196 IANLALGILNRAAPQIGIFQIGFP 219


>gi|259908770|ref|YP_002649126.1| flagellar biosynthesis protein FliR [Erwinia pyrifoliae Ep1/96]
 gi|224964392|emb|CAX55901.1| Flagellar biosynthesis protein [Erwinia pyrifoliae Ep1/96]
 gi|283478746|emb|CAY74662.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae DSM 12163]
          Length = 261

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 109/233 (46%), Gaps = 3/233 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            LF  + RV + IM  P LS   I  +V++   +  + VL+P L  T ++  F    ++ 
Sbjct: 15  QLFWPLARVLALIMTAPLLSEKSISRKVKIGLGVMITWVLIPSLPPT-NVTLFSVGGFW- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   + +
Sbjct: 73  -LLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARFLDM 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + +L     + H  +   +  S+ T+PIG E   GN F +        F+  +RL+ P +
Sbjct: 132 LAMLLFLSFNGHLWLISMVADSFQTLPIGGEPLNGNAFMALTKAANIIFLNGMRLALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +  N+ +GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F
Sbjct: 192 TLLLTLNLGLGLLNRVSPQLSVFAIGFPVTLSVGMIFIILMMPLLAPFCEHLF 244


>gi|256376455|ref|YP_003100115.1| type III secretion system inner membrane R protein [Actinosynnema
           mirum DSM 43827]
 gi|255920758|gb|ACU36269.1| type III secretion system inner membrane R protein [Actinosynnema
           mirum DSM 43827]
          Length = 256

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 101/224 (45%), Gaps = 17/224 (7%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW----DTIDLQNF 63
           ++++L L   R  + +M+ P  +   IPM V+   A+  ++ ++P L      ++D  + 
Sbjct: 9   VLVALLLAATRSAAWLMVCPPFNGKAIPMTVKGMLAVGLALPVVPRLSAGSVPSLDTWSL 68

Query: 64  VNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
           V  A        ++ +G   G L  V   G+Q  G ++    G +L  +    D ++ + 
Sbjct: 69  VIAAGE------QVVVGAGLGFLTAVIFAGVQAAGDLLDVFGGFSLAFAF---DPMSFSG 119

Query: 124 LNSLIGII-GLLA---LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
            N+++G   GLLA   L+V   H  +      SY  IP+   L+ G + +     L    
Sbjct: 120 NNAVLGRFYGLLATTLLFVTGSHQVIIRGFTLSYDAIPLDGGLSLGRLGTLLTTGLGQLL 179

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGL 223
           +   +++ P +      ++ +GLLN++ P +  + I  P  IGL
Sbjct: 180 LSAAQIAGPLIVVLFCADVGLGLLNRIAPALNPFQIGFPAKIGL 223


>gi|225849159|ref|YP_002729323.1| flagellar biosynthetic protein FliR [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644067|gb|ACN99117.1| flagellar biosynthetic protein FliR [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 257

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 110/226 (48%), Gaps = 10/226 (4%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY- 68
           ++L L+  R+ +     P +S + IP  V++   ++F+     F     D+Q  VN+   
Sbjct: 10  IALALVFSRIIAFFSTFPLISSTVIPHNVKVLLVVSFAF----FTMLNFDIQVKVNQIEL 65

Query: 69  --YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L++ E+F+G   GL++ +      + G ++   +GL +      + +  +T + S
Sbjct: 66  ITFLILIVKEIFIGLSLGLIVNILISAFSYAGEIVGFLMGLTVMNMY--NPAFGQTSVLS 123

Query: 127 LIGIIGLLALWVIDFHHQVFY-ALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
              +     L+ +   +Q+   +L KS+  +P+ +      IF   +      F++  ++
Sbjct: 124 GFFVFLFYLLFFVSGSYQILIGSLFKSFEILPLTEASINQGIFPYLIEKSGDIFLLSFQM 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLS 231
           + PF+   +VFN+ + L+N+L+PQI ++FI  P  I +G + L  S
Sbjct: 184 AFPFILVLLVFNVVLALINRLIPQINVFFIGLPAQIWIGFIVLMFS 229


>gi|167568048|ref|ZP_02360964.1| type III secretion system EscT protein [Burkholderia oklahomensis
           EO147]
          Length = 260

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +Y +L   EL +G + G    +    L   G +I TA G ++ + +        +P   +
Sbjct: 69  HYLRLAFGELCVGALIGFCAAIPFWALDMAGFLIDTARGASMASVLNPLLGAQSSPFGMV 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTTFMIMLRLS 186
              +  L   V    + +   +  SY T+P G  L FG +  +      Q  + + LR +
Sbjct: 129 FSQVFTLLFLVSGGFNTLIETIYASYVTLPPGAPLRFGPDALALLTQQWQLMYELCLRFA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            P L   ++ ++++GL+N+   Q+ ++F+S P
Sbjct: 189 MPALAAILLVDMALGLVNRSAQQLNVFFLSMP 220


>gi|114320140|ref|YP_741823.1| flagellar biosynthetic protein FliR [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226534|gb|ABI56333.1| flagellar biosynthetic protein FliR [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 260

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/208 (18%), Positives = 92/208 (44%), Gaps = 2/208 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           SL   + RVG+ +M+ P      +P++VR+ F +A ++ +LP + +   +          
Sbjct: 14  SLMWPLMRVGAMVMVAPVFGNQLMPVRVRVFFGLALAVAVLPAVGEVPPVDPLSAEGLL- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            + + ++ +G + G ++ +    +   G  ++ A+GL   T +     ++   L+ ++ +
Sbjct: 73  -ISVQQVLIGLIMGFMLLLAVNAVVVAGESMALAMGLGFATMVDPQTGMSVPVLSQVMLV 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           I  L    I  H  +      S+  +PI  E      F          F   + ++ P +
Sbjct: 132 IVTLVFLGIGGHLMLIELTAASFSALPIAAEGVGREAFFEVAAWASQMFAGAVLIALPVV 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
              ++ N+++G++ +  PQ+ ++ +  P
Sbjct: 192 TVLLIINLALGVMTRAAPQMNVFSVGLP 219


>gi|300854222|ref|YP_003779206.1| bifunctional flagellar biosynthesis proteins FliR/FlhB [Clostridium
           ljungdahlii DSM 13528]
 gi|300434337|gb|ADK14104.1| fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium ljungdahlii DSM 13528]
          Length = 606

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 110/237 (46%), Gaps = 9/237 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +L L+  R+ S  +L+P    S IP  V++   +  + +L+P + D   + +  N  ++ 
Sbjct: 9   ALILVSIRIFSFFILVPIFFPSGIPNVVKVGLTVVMAYILMPGI-DYASISSIDNTMFFV 67

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
              + E+  G   G L  +    ++  G+++   +G  + +    + +   T +  L+  
Sbjct: 68  MNCLNEVAAGLTLGFLTSLCFSMVRIAGNLMDMQMGFAMVSMFDPTSNSNTTLIERLLYW 127

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIG----QELNFGNIFSSFVNMLQTTFMIMLRLS 186
             L+  +++D HH +  +L++S+  I +G     + +   IF +F+      F I +++ 
Sbjct: 128 FSLVIFFIVDGHHMLIKSLIQSFSVIKLGSFFLNQASINIIFKAFIEY----FGIAIQIG 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            P +   +  ++++ L+ + VPQ+ I  +  P  + +G    C ++ I +    H F
Sbjct: 184 IPIVLILLFTDLTMSLIARTVPQLNIMILGLPVKVLIGFASFCFALPIFLKLIEHLF 240


>gi|302389678|ref|YP_003825499.1| flagellar biosynthetic protein FliR [Thermosediminibacter oceani
           DSM 16646]
 gi|302200306|gb|ADL07876.1| flagellar biosynthetic protein FliR [Thermosediminibacter oceani
           DSM 16646]
          Length = 254

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 97/227 (42%), Gaps = 29/227 (12%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPF---------LWD 56
           E I+++  L+  R+    +L P       P+Q RL  +   +++L P          LWD
Sbjct: 2   EFIIVNFLLVFFRILGFFILTPVFGRREFPVQGRLGVSALIAVILYPVVNKIPLPDNLWD 61

Query: 57  TIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS 116
           T+             L + E  +G   G +  V    +   G +I   +G  +   +   
Sbjct: 62  TV------------ILFIRETAVGLSIGFITFVVFSAVYICGEIIDLQMGFGIVNVIDPQ 109

Query: 117 DSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQ 176
            +     + +   I+ +L    I+ HH +  AL+KSY  +P+G       +  SF+  + 
Sbjct: 110 TNAQIPVMGNFFYILTILIFLSINGHHVLLNALMKSYDILPLGG----AGLHDSFLEGML 165

Query: 177 TTFMIM----LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPY 219
            +F  M    +++S P +    + + ++G++ + VPQ+ ++ +  P+
Sbjct: 166 KSFFEMFAAGVKMSIPVVAATFLADFALGVIARTVPQMNVFIVGLPF 212


>gi|238751769|ref|ZP_04613257.1| Flagellar biosynthetic protein fliR [Yersinia rohdei ATCC 43380]
 gi|238710040|gb|EEQ02270.1| Flagellar biosynthetic protein fliR [Yersinia rohdei ATCC 43380]
          Length = 260

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P LS   I  +V++  A+  + ++ P L   +++  F     +  +
Sbjct: 17  FWPLIRILALITTAPVLSEKQINRKVKVGLAVLITFLIAPSL-PPVNIPLFSTAGLW--V 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G   GL ++     ++  G VI   +GL+  T    S       L   + I+ 
Sbjct: 74  AAQQILIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLARFLNILA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     D H  +   L  S+ T+PI  E   GN F +        F+  L L+ P +  
Sbjct: 134 MLLFLCFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTQAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++G+LN++ PQ+ ++ I  P  + +G + + L + ++     H F
Sbjct: 194 LLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISIGLIMPLLAPFTEHLF 244


>gi|292487980|ref|YP_003530857.1| flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|292899200|ref|YP_003538569.1| flagellar biosynthetic protein FliR [Erwinia amylovora ATCC 49946]
 gi|291199048|emb|CBJ46159.1| flagellar biosynthetic protein FliR [Erwinia amylovora ATCC 49946]
 gi|291553404|emb|CBA20449.1| Flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|312172105|emb|CBX80362.1| Flagellar biosynthetic protein FliR [Erwinia amylovora ATCC
           BAA-2158]
          Length = 261

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 111/233 (47%), Gaps = 3/233 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            LF  + RV + IM  P LS   I  +V++   +  + VL+P L  T ++  F    ++ 
Sbjct: 15  QLFWPLARVLALIMTAPLLSEKSISRKVKIGLGVMITWVLIPSLPPT-NVTLFSVGGFW- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   + +
Sbjct: 73  -LLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARFLDM 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + +L     + H  +   + +S+ T+PIG E   GN F +        F+  +RL+ P +
Sbjct: 132 LAMLLFLSFNGHLWLISMVAESFQTLPIGGEPLNGNAFMALTESANLIFLNGMRLALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F
Sbjct: 192 TLLLTLNLALGLLNRVSPQLSVFAIGFPVTLSVGMIFIILMMPLLAPFCEHLF 244


>gi|288573011|ref|ZP_06391368.1| type III secretion system inner membrane R protein
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568752|gb|EFC90309.1| type III secretion system inner membrane R protein
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 260

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 84/174 (48%), Gaps = 15/174 (8%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL- 134
           EL +G     L       LQ  G +I T +GL + +   + D ++++  +S+IG + +L 
Sbjct: 78  ELLVGASIAFLASAPFYALQIAGRMIGTRMGLAMVS---VLDPISQSQ-DSIIGQLQILI 133

Query: 135 ALWVI---DFHHQVFYALVKSYGTIPIGQELNFGNIFSS---FVNMLQTTFMIMLRLSSP 188
            LW     + H  +  AL++S+  +P+G+    G   SS       L   F++  + + P
Sbjct: 134 GLWFFLYWNGHILLVRALMESFRLLPLGE---MGLAVSSDLGLAEWLGKLFVMAFKFAIP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           F    ++ +I +G L + VPQ+ ++ +  P  IGLG LFL + +  +     H 
Sbjct: 191 FYGALLLADIGLGFLARTVPQMNVFILGLPLKIGLG-LFLLMVVLPMTVDIMHD 243


>gi|315636294|ref|ZP_07891544.1| flagellar biosynthetic protein FliR [Arcobacter butzleri JV22]
 gi|315479383|gb|EFU70066.1| flagellar biosynthetic protein FliR [Arcobacter butzleri JV22]
          Length = 249

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 103/239 (43%), Gaps = 13/239 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+ + ++ +P    + I + VR+ FA   SI + PF    +D+   +N+  +   +
Sbjct: 18  LLLARILAFVVFMPVFGHTAINVTVRIAFAFYLSIFIYPF----VDIVTSINQNNFIISL 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ LG V  +L+ +    ++  G  +  +  L++      + +  E  +  L+  I L
Sbjct: 74  ISEITLGLVAAMLVNIIFSAVRIIGEFVEYSTALSMAMMFDPTTNSQEGLVAKLLFWISL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSS-----FVNMLQTTFMIMLRLSSP 188
           +  +    +      L KS+  I +G      NIFS       ++ ++  F      + P
Sbjct: 134 MLFFQTGMYEMTLVILAKSFTMIHLGS----FNIFSYDGIQLAIDEIKRMFSFAFAFALP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             F   + ++  G   K +P    + I+      L  +FL L +EI    F++ F+  F
Sbjct: 190 LFFIGFIMDVYYGYGTKSMPAFSPFIITFQLKFALIFVFLILGMEIFADTFTNYFINKF 248


>gi|207728356|ref|YP_002256750.1| flagellar biosynthetic protein flir [Ralstonia solanacearum MolK2]
 gi|206591602|emb|CAQ57214.1| flagellar biosynthetic protein flir [Ralstonia solanacearum MolK2]
          Length = 262

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 90/210 (42%), Gaps = 12/210 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  S + IP  +++ F +  ++ L P L     +   V+   Y  L   ++
Sbjct: 22  RVLAFIAMAPPFSNTEIPTSIKVAFGVVLTVALAPML----PVPQGVSVGSYEGLWITLL 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G  +++    +   G ++S  IGL   T +    + +   L   I +  + A
Sbjct: 78  QVAIGMALGFCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGRFISLTAITA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + +AL  S+  +P+      G  + +        F + +R++ P +   +V
Sbjct: 138 FIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGSAIFALAVRIALPIIAIMMV 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGS 225
            N++  +L++    +       P+ +G+ +
Sbjct: 198 VNLAFAVLSRTAQAL------NPFAVGIAA 221


>gi|308173600|ref|YP_003920305.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606464|emb|CBI42835.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553468|gb|AEB23960.1| flagellar biosynthesis protein FliR [Bacillus amyloliquefaciens
           TA208]
 gi|328911741|gb|AEB63337.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens LL3]
          Length = 259

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 109/236 (46%), Gaps = 14/236 (5%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAY 68
           +  L+  R+ +  + +P      +P   R+ FA   S++    L     ID+        
Sbjct: 10  AFLLVFIRISAFFVTVPVFGHRNLPAVHRIGFAFFLSVICFSTLKHAPAIDIGE-----Q 64

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSL 127
           Y  LV+ E  +G   GL+  +    +Q  GS I   +G ++   +    S  ++PL    
Sbjct: 65  YMLLVIKEAVVGLSLGLIAFMMMAAIQIAGSFIDFQMGFSIANVID-PQSGTQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNI-FSSFV-NMLQTTFMIMLR 184
           +  + LL +  ++ H+ +   +  S+  IP+ Q   +FGN  F  F+       F+I  +
Sbjct: 124 VYTLALLFMLSVNAHYLLLDGIYYSFQYIPLDQAFPSFGNDRFGLFIAKSFNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +    L +C+++  ++ +
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMAVMFVIVR 239


>gi|168334563|ref|ZP_02692719.1| flagellar biosynthesis protein FliR [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 262

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 100/206 (48%), Gaps = 13/206 (6%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQNFVNRAYYSKL 72
           LI  R+ + + L P +  + +P  V    A+  + IV       TI   N      YS L
Sbjct: 16  LIFVRIVAVLSLFPIILETKVPATVVAMLAIILTMIVFFTIPQGTISYAN--TWLGYSIL 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNL----QTSMGISDSLAETPLNSLI 128
           V+ E+ +G V G  + ++   L FTG + S   GL++      ++G     A+ P+    
Sbjct: 74  VIKEMLVGMVLGFGVLIFFQVLNFTGQLWSNQGGLSMSQFYDPALG-----AQIPVLGRF 128

Query: 129 GIIGLLALWVIDF-HHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +G   ++V+   +H    AL+K++  IP+G +    +I  + ++ +   F +  +L++
Sbjct: 129 LTLGFSTIFVLSGGYHYFISALIKTFEYIPLGTQFFNPSISITILDAVAIFFELGFKLAT 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIY 213
           P L   ++ ++ +G+L + VPQ+ ++
Sbjct: 189 PILGTILLIDVGLGILARTVPQMNMF 214


>gi|22124446|ref|NP_667869.1| type III secretion system component [Yersinia pestis KIM 10]
 gi|45440282|ref|NP_991821.1| putative type III secretion apparatus protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51594684|ref|YP_068875.1| type III secretion apparatus protein EscT/SsaT/YscT [Yersinia
           pseudotuberculosis IP 32953]
 gi|108810000|ref|YP_653916.1| putative type III secretion apparatus protein [Yersinia pestis
           Antiqua]
 gi|108813555|ref|YP_649322.1| type III secretion apparatus protein [Yersinia pestis Nepal516]
 gi|145600945|ref|YP_001165021.1| type III secretion apparatus protein [Yersinia pestis Pestoides F]
 gi|150260679|ref|ZP_01917407.1| putative type III secretion apparatus protein [Yersinia pestis
           CA88-4125]
 gi|153948893|ref|YP_001402766.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419337|ref|YP_001608226.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis Angola]
 gi|165926709|ref|ZP_02222541.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165936527|ref|ZP_02225095.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166010567|ref|ZP_02231465.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166213916|ref|ZP_02239951.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167402194|ref|ZP_02307667.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167418924|ref|ZP_02310677.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167426142|ref|ZP_02317895.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|186893687|ref|YP_001870799.1| type III secretion protein SpaR/YscT/HrcT [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927479|ref|YP_002345354.1| putative type III secretion apparatus protein [Yersinia pestis
           CO92]
 gi|229836527|ref|ZP_04456693.1| putative type III secretion apparatus protein [Yersinia pestis
           Pestoides A]
 gi|229840135|ref|ZP_04460294.1| putative type III secretion apparatus protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229842216|ref|ZP_04462371.1| putative type III secretion apparatus protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229904045|ref|ZP_04519158.1| putative type III secretion apparatus protein [Yersinia pestis
           Nepal516]
 gi|270488970|ref|ZP_06206044.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis KIM D27]
 gi|294502344|ref|YP_003566406.1| putative type III secretion apparatus protein [Yersinia pestis
           Z176003]
 gi|21957233|gb|AAM84120.1|AE013654_9 putative type III secretion system component [Yersinia pestis KIM
           10]
 gi|45435138|gb|AAS60698.1| putative type III secretion apparatus protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51587966|emb|CAH19569.1| putative type III secretion apparatus protein EscT/SsaT/YscT
           [Yersinia pseudotuberculosis IP 32953]
 gi|108777203|gb|ABG19722.1| type III secretion apparatus protein [Yersinia pestis Nepal516]
 gi|108781913|gb|ABG15971.1| putative type III secretion apparatus protein [Yersinia pestis
           Antiqua]
 gi|115346090|emb|CAL18958.1| putative type III secretion apparatus protein [Yersinia pestis
           CO92]
 gi|145212641|gb|ABP42048.1| type III secretion apparatus protein [Yersinia pestis Pestoides F]
 gi|149290087|gb|EDM40164.1| putative type III secretion apparatus protein [Yersinia pestis
           CA88-4125]
 gi|152960388|gb|ABS47849.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352152|gb|ABX86100.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis Angola]
 gi|165915643|gb|EDR34252.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165921332|gb|EDR38556.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165990657|gb|EDR42958.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166204891|gb|EDR49371.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166962918|gb|EDR58939.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167048375|gb|EDR59783.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167054853|gb|EDR64655.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|186696713|gb|ACC87342.1| type III secretion protein SpaR/YscT/HrcT [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679815|gb|EEO75918.1| putative type III secretion apparatus protein [Yersinia pestis
           Nepal516]
 gi|229690526|gb|EEO82580.1| putative type III secretion apparatus protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229696501|gb|EEO86548.1| putative type III secretion apparatus protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229706211|gb|EEO92219.1| putative type III secretion apparatus protein [Yersinia pestis
           Pestoides A]
 gi|262364374|gb|ACY60931.1| putative type III secretion apparatus protein [Yersinia pestis
           D182038]
 gi|270337474|gb|EFA48251.1| type III secretion apparatus protein SpaR/YscT/HrcT [Yersinia
           pestis KIM D27]
 gi|294352803|gb|ADE63144.1| putative type III secretion apparatus protein [Yersinia pestis
           Z176003]
          Length = 264

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 15/152 (9%)

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT----SMGISDSLAETPLNSLIGI 130
            EL +G V G +  +    +   G +I T  G  + T     MG+  SL       ++ +
Sbjct: 74  TELLIGVVMGFVAALPFWAMNMAGFLIDTLRGATMSTLFNPGMGVESSLFGVLFTQILTV 133

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL----S 186
           + L++       +QV  AL  SY ++PIGQ +      +  +  LQT + +M  L    +
Sbjct: 134 LFLIS----GGFNQVLAALYGSYDSLPIGQGIQPA---ADLLLFLQTEWQMMFELCLCFA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            P L   ++ ++S+GL+N+   Q+ ++F++ P
Sbjct: 187 LPALLVMVLADLSLGLINRSARQLNVFFLAMP 218


>gi|310767332|gb|ADP12282.1| flagellar biosynthesis protein FliR [Erwinia sp. Ejp617]
          Length = 261

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 110/233 (47%), Gaps = 3/233 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            LF  + RV + IM  P LS   +  +V++   +  + VL+P L  T ++  F    ++ 
Sbjct: 15  QLFWPLARVLALIMTAPLLSEKSVSRKVKIGLGVMITWVLIPSLPPT-NVTLFSVGGFW- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   + +
Sbjct: 73  -LLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARFLDM 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + +L     + H  +   +  S+ T+PIG E   GN F +        F+  +RL+ P +
Sbjct: 132 LAMLLFLSFNGHLWLISMVADSFQTLPIGGEPLNGNAFMALTKAANIIFLNGMRLALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F
Sbjct: 192 TLLLTLNLALGLLNRVSPQLSVFAIGFPVTLSVGMIFIILMMPLLAPFCEHLF 244


>gi|170026113|ref|YP_001722618.1| type III secretion protein SpaR/YscT/HrcT [Yersinia
           pseudotuberculosis YPIII]
 gi|169752647|gb|ACA70165.1| type III secretion protein SpaR/YscT/HrcT [Yersinia
           pseudotuberculosis YPIII]
          Length = 264

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 15/152 (9%)

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT----SMGISDSLAETPLNSLIGI 130
            EL +G V G +  +    +   G +I T  G  + T     MG+  SL       ++ +
Sbjct: 74  TELLIGVVMGFVAALPFWAMNMAGFLIDTLRGATMSTLFNPGMGVESSLFGVLFTQILTV 133

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL----S 186
           + L++       +QV  AL  SY ++PIGQ +      +  +  LQT + +M  L    +
Sbjct: 134 LFLIS----GGFNQVLAALYGSYDSLPIGQGIQPA---ADLLLFLQTEWQMMFELCLCFA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            P L   ++ ++S+GL+N+   Q+ ++F++ P
Sbjct: 187 LPALLVMVLADLSLGLINRSARQLNVFFLAMP 218


>gi|289208349|ref|YP_003460415.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. K90mix]
 gi|288943980|gb|ADC71679.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. K90mix]
          Length = 253

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 108/237 (45%), Gaps = 14/237 (5%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVL------LPFLWDTIDLQNFVNRAYYS 70
            R+G+ ++++P      +   VR+ FA+  +I +      LP + D I ++  V   +  
Sbjct: 16  ARIGAMLLVMPVFGGDQLTATVRILFALVLAIFVAMQGPALPAV-DPISIEGVVVTVH-- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
                ++ +G V G ++++    L   G VI+ ++GL   + +  +  +    ++++  I
Sbjct: 73  -----QILIGLVMGFILQMVFSALTQAGEVIALSMGLGFASIVDPAQGVQVPVVSTIFVI 127

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    ++ H      L+ S+ T+P+          +S +      F   + ++ P +
Sbjct: 128 MATLIFLAMNGHLIALELLLTSFETLPVAPSGLDAEALASLIAFGSVMFQGAVLVAIPAV 187

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
              ++ N+S+G++ +  PQ+ I+ +  P +I +G + L L++  +  +       GF
Sbjct: 188 ASLLLVNLSMGVITRASPQLNIFAVGFPMMILMGFILLMLTMPGLPERLGDLLFDGF 244


>gi|89072286|ref|ZP_01158865.1| putative flagellar biosynthetic protein FliR [Photobacterium sp.
           SKA34]
 gi|89051818|gb|EAR57270.1| putative flagellar biosynthetic protein FliR [Photobacterium sp.
           SKA34]
          Length = 258

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 100/226 (44%), Gaps = 7/226 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+G+ ++ +P    + IP+ VR   A+A S +  P +    T DL +        +  + 
Sbjct: 21  RIGAAMLAMPFFGDALIPIWVRALLALAISFIAAPLMPAMPTTDLLSLSALMLAFEQAIW 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            +  G +   L  + TL     G +IS  +GL +       + ++   L  +  +   L 
Sbjct: 81  GVLFGLIIHFLFSIMTL----LGQIISLQMGLGMAIMNDPVNGVSVAILGRMFLLFSTLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              +D H  V   LV+S+ + P+G  L   ++    + +    F   L ++ P +   ++
Sbjct: 137 FLALDGHLLVIDILVQSFTSWPVGSGLALSSV-KQILTLFGWMFSSALAIALPAIVSMLL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            NIS G++N+  P + +Y +  P  + LG   + +S+  +  +++ 
Sbjct: 196 ANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVSGVPTRYAE 241


>gi|115377838|ref|ZP_01465026.1| flagellar biosynthesis protein FliR, putative [Stigmatella
           aurantiaca DW4/3-1]
 gi|115365170|gb|EAU64217.1| flagellar biosynthesis protein FliR, putative [Stigmatella
           aurantiaca DW4/3-1]
          Length = 222

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 85/185 (45%), Gaps = 12/185 (6%)

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT----SMGISDSLAETPL 124
           Y  L++ E+F+G     ++ +     +  G+++ T  G N        +G   SL     
Sbjct: 29  YIALLLKEVFIGVSLAFIVNIIFDAARVAGTLVDTMAGSNNAQLYVPQLGQQVSL----F 84

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF----M 180
           +SL   + ++    +D HH V  AL  S+  +P+     F     +F  ++   F     
Sbjct: 85  SSLKVQLSVVLFLTLDGHHIVISALADSFAIVPLDSFPKFSKGTWAFFEVISRAFANLLA 144

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I L L++P +    + ++++G +N++ P + ++FI+      +  L   L++ +++ +F 
Sbjct: 145 ISLSLAAPQMLSAFLTDLAMGAVNRVAPNLQVFFIAMAIKPMVSVLIAALALHMLIGRFQ 204

Query: 241 HSFLY 245
             F++
Sbjct: 205 SEFVH 209


>gi|57238051|ref|YP_179300.1| flagellar biosynthesis protein FliR [Campylobacter jejuni RM1221]
 gi|148926184|ref|ZP_01809869.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|57166855|gb|AAW35634.1| flagellar biosynthetic protein FliR [Campylobacter jejuni RM1221]
 gi|145845355|gb|EDK22448.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|315058611|gb|ADT72940.1| Flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 255

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 96/212 (45%), Gaps = 6/212 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +      ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITAQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFF 192
           +     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L  
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFTMSFPILGI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 192 SLLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|238758101|ref|ZP_04619281.1| Flagellar biosynthetic protein fliR [Yersinia aldovae ATCC 35236]
 gi|238703639|gb|EEP96176.1| Flagellar biosynthetic protein fliR [Yersinia aldovae ATCC 35236]
          Length = 260

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%)

Query: 140 DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
           D H  +   L  S+ TIPI  E   GN F +   +    FM  L L+ P +   +  N++
Sbjct: 141 DGHLWLISLLADSFHTIPIQLEPLNGNGFLALTQVGSLIFMSGLMLALPMITLLLTLNMA 200

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +G+LN++ PQ+ ++ I  P  + +G + + L + ++     H F
Sbjct: 201 LGMLNRMTPQLSVFVIGFPLTLTIGIISMGLMMPLLAPFAEHLF 244


>gi|167464150|ref|ZP_02329239.1| flagellar biosynthesis protein FliR [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 259

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 93/212 (43%), Gaps = 11/212 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN-RAYYSKL 72
           L+ CR+ +  +++P  S   +P Q    F +  S+V+   ++  + + N V     Y   
Sbjct: 12  LVFCRITAFFVVVPTFSSRNVPSQ----FKIGLSLVITLIVFTALGMNNPVTMDGTYLLA 67

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E+ +G   G +  ++   +Q  GS I   +G  +   +      +   L +   +I 
Sbjct: 68  IFREILVGITLGFVAYLFFTAVQIAGSFIDIQMGFGIANVIDPMTGASAPILGNFKYMIA 127

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSS-----FVNMLQTTFMIMLRLSS 187
            L     + HH +  A++ SY  +P+  E+ F  +F        V    T F +  +L++
Sbjct: 128 TLLFLSFNGHHLLLQAIMNSYDWVPMTNEV-FARVFEGQVSEWIVRSFTTMFGLAFQLAA 186

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPY 219
           P      + ++ +GLL ++ PQ  I+ +  P+
Sbjct: 187 PIAAALFLTDLGLGLLTRVAPQFNIFVVGAPF 218


>gi|88858096|ref|ZP_01132738.1| flagellar biosynthesis protein [Pseudoalteromonas tunicata D2]
 gi|88819713|gb|EAR29526.1| flagellar biosynthesis protein [Pseudoalteromonas tunicata D2]
          Length = 259

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 106/242 (43%), Gaps = 16/242 (6%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M    L + R+ + +M++ G+ +  +P +++   A+  ++V++P L        F N   
Sbjct: 12  MADFLLPLTRISAMLMVMVGIGVRTVPTRIKAALAVMVTLVVIPVL----PPAEFTNLFS 67

Query: 69  YSKLVMV--ELFLGCVHG----LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
           +  +++V  +  +G   G    L++  + +     G +++   GL   T +  ++     
Sbjct: 68  FEMVLVVLQQTLIGVAMGFASVLMLNTFVMA----GQLLAMQSGLGFATMIDPTNGQNVP 123

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMI 181
            +     I+  L  W  D H  +   LV S+ TIPI G   +  N F          F  
Sbjct: 124 AVGQFYLILATLLFWTYDGHLIMVKMLVLSFTTIPIDGNWWHVAN-FREVAVWGGWLFAT 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L LS   L   ++ +IS G++ +  PQ+ I+ I  P+ + +G + +  ++   V QF  
Sbjct: 183 ALVLSLAPLTAMLITSISFGVMTRAAPQLNIFSIGFPFTLMMGLIIIWATMGNFVVQFDF 242

Query: 242 SF 243
            +
Sbjct: 243 QW 244


>gi|315648121|ref|ZP_07901222.1| flagellar biosynthetic protein FliR [Paenibacillus vortex V453]
 gi|315276767|gb|EFU40110.1| flagellar biosynthetic protein FliR [Paenibacillus vortex V453]
          Length = 262

 Score = 45.1 bits (105), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 94/206 (45%), Gaps = 11/206 (5%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFS-IVLLPFLWDTIDLQNFVNRAYYSKL 72
           LI CR+ S  ++ P  +   +P   ++  +   + IV   F    +  Q+        + 
Sbjct: 13  LIFCRITSFFVISPVFTSRSVPTSYKIALSAIIALIVYFSFGLGEVVPQDLSYVILIVQE 72

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGII 131
           V+V L LG    L++ V    +Q  G++I   IG ++   +      A TPL  +    +
Sbjct: 73  VLVGLLLGFTAYLIMAV----VQTAGALIDIQIGFSMANVIDPFTG-ASTPLIGNFKYYL 127

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQE----LNFGNIFSSFVNMLQTTFMIMLRLSS 187
            LL    ++ HH +  A++ SY  IPI  +    ++ GN+    V     +F++ L++++
Sbjct: 128 ALLVFLSMNGHHYLLDAIMYSYDWIPITGDVFGKIHDGNVTDFLVRTFSHSFVLALQMAA 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIY 213
           P +    + ++ +G L +  PQ  ++
Sbjct: 188 PLVAALFLTDVGLGFLARTAPQFNVF 213


>gi|291484191|dbj|BAI85266.1| hypothetical protein BSNT_02670 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 194

 Score = 45.1 bits (105), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 84/169 (49%), Gaps = 7/169 (4%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLL 134
           E  +G   GL+  +    +Q  GS I   +G ++   +    + A++PL    I  + LL
Sbjct: 7   EALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVID-PQTGAQSPLIGQFIYTMALL 65

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGN-IFSSFV-NMLQTTFMIMLRLSSPFLF 191
            +  ++ HH +   +  S+  I + Q   NFG+  F+ F+       F+I  ++S+P + 
Sbjct: 66  FMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFIIAFQMSAPVVA 125

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG--SLFLCLSIEIIVYQ 238
              + ++++G++ + VPQ+ ++ +  P  I +    L +C+S+  +V +
Sbjct: 126 SLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVR 174


>gi|317153079|ref|YP_004121127.1| flagellar biosynthetic protein FliR [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943330|gb|ADU62381.1| flagellar biosynthetic protein FliR [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 261

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 96/210 (45%), Gaps = 1/210 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M+S FL + R+   + L+P    + IP  V+    +  S+ + P L     +    N   
Sbjct: 11  MLSFFLTLFRISVVLFLMPFFGGNSIPTLVKGALVLVLSLAVWPQLSFPGSMLP-ANGLD 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + + + E+ LG + GL +      +QF G +I   +G  + + +              +
Sbjct: 70  ITIMFLGEVLLGLILGLTVNFLFGAIQFGGQIIGFQMGFAMVSVVDPISGTTNAVTAHFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +  +L   V++ H Q+  AL  S+  IP G  L   ++ + F+++    F + +R+++P
Sbjct: 130 YMCTMLTFLVLNGHLQLINALGMSFQYIPPGGLLITPSLATQFLSLSAIMFTLAIRIAAP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            +    + ++++ L+++  PQ+ +  +  P
Sbjct: 190 VMAALFLVDLALALISRAAPQMHVLILGFP 219


>gi|188534132|ref|YP_001907929.1| flagellar biosynthesis protein FliR [Erwinia tasmaniensis Et1/99]
 gi|188029174|emb|CAO97046.1| Flagellar biosynthesis protein [Erwinia tasmaniensis Et1/99]
          Length = 263

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 109/233 (46%), Gaps = 3/233 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            LF  + RV + IM  P LS   I  +V++   +  + VL+P L  T  +  F    ++ 
Sbjct: 15  QLFWPLARVLALIMTAPLLSEKAISRKVKIGLGVMITWVLVPSLPPT-HVTLFSVGGFW- 72

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   + +
Sbjct: 73  -LLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARFLDM 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + +L     + H  +   +  S+ T+PIG E   GN F +        F+  +RL+ P +
Sbjct: 132 LAMLLFLSFNGHLWLISMVADSFHTLPIGAEPLNGNAFMALTKAANLIFLNGMRLALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F
Sbjct: 192 TLLLTLNLALGLLNRVSPQLSVFAIGFPVTLSIGMIFIILMMPLLAPFCEHLF 244


>gi|90406807|ref|ZP_01214999.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
 gi|90312044|gb|EAS40137.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
          Length = 264

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/241 (19%), Positives = 113/241 (46%), Gaps = 23/241 (9%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL---WDTIDLQNFVNRAYYSKLV 73
           CR+ + +M++  +     P+++RL +A+A +I +LP L      I+L +  +     + +
Sbjct: 20  CRIAAMLMVMVAVGSRTTPVRIRLFYALAITIAVLPVLPIVQTNIELFSLGSAFIILQQL 79

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS----LIG 129
           ++ + +G +   +++ + +     G +I+      +QTS+G + S+A+ P+N     ++G
Sbjct: 80  LIGIAIGTISVFVVQTFVVA----GQIIA------MQTSLGFA-SMAD-PMNGQSSPVVG 127

Query: 130 ----IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L  + +D H  +   +++S+ T+P+         +          F   L  
Sbjct: 128 QFYVLLVTLLFFGVDGHLLMIEFIIRSFDTLPVSMHGLLATDYKKLAGWFSVMFSAALAF 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S   +   ++ N+S G++ K  PQ+ I+ +     +  G   L +++  +   F + +L 
Sbjct: 188 SLASMVAMLLVNLSFGIMTKAAPQLNIFSLGFSISMVFGLFVLWVTLVNVPAHFENQWLR 247

Query: 246 G 246
           G
Sbjct: 248 G 248


>gi|194292001|ref|YP_002007908.1| sctt: non flagellar t3S system conserved inner membrane protein.
           flir/mope/spar family. [Cupriavidus taiwanensis LMG
           19424]
 gi|193225905|emb|CAQ71852.1| SctT: non flagellar T3S system conserved inner membrane protein.
           fliR/mopE/spaR family [Cupriavidus taiwanensis LMG
           19424]
          Length = 271

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 107/233 (45%), Gaps = 9/233 (3%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++M + +++ R+ +   +LP LS   IP   R    +A ++ + P     IDL + V   
Sbjct: 21  VIMPIVMVMPRLLTAFTVLPFLSQQAIPGVARNGIVLAIALFVSP--GARIDL-DAVAGG 77

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L+  E F+G + G+   ++ + LQ  G +I    G    T         + P+ +L
Sbjct: 78  LWLVLIFKEAFIGLLLGMAFGLFFVALQMIGELIDFQTGSGNATFFDPVTQQEDGPMENL 137

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPI---GQELNFGNIFSSFVNMLQTT-FMIML 183
           +   G+     +     +   +V+S+   P+   G E++  ++   F N+   T F  ++
Sbjct: 138 LSHFGIALFAALGGFIAMTGVIVESFAFWPVMSFGPEMSLASM--GFANLYAGTLFSWVV 195

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
           +L++P L   ++  +   L+ + VPQ  ++  + P  I +  L L L + ++V
Sbjct: 196 KLAAPILLLLVIVELGFALIARFVPQFDVFQFAQPVKISVAFLMLVLMLAVMV 248


>gi|119775420|ref|YP_928160.1| flagellar biosynthesis protein FliR [Shewanella amazonensis SB2B]
 gi|119767920|gb|ABM00491.1| flagellar biosynthetic protein FliR [Shewanella amazonensis SB2B]
          Length = 262

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 108/233 (46%), Gaps = 20/233 (8%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           R+ +  M++P    +  P++VRL  ++A +  + P L      + F   + +  ++ V++
Sbjct: 21  RISAMFMVMPVFGANTTPVRVRLLLSVAVTFAVSPMLPPMPQGELFALSSVFISAQQVLI 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS-----DSLAETP-LNSLIG 129
            + +G V  ++++++ L    TG +I       +QTS+G S      S  +TP L +   
Sbjct: 81  GVAMGLVALMMLQIFVL----TGQII------GMQTSLGFSFMVDPGSGQQTPVLGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           ++  L    +D H  +   LV S+ T+P+    +   N + S        F   L +S  
Sbjct: 131 LLATLIFLAVDGHLTMIRMLVMSFDTLPVSMTGITLAN-YHSLALWGSYMFGAALTMSLS 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            +   ++ N+S G++ +  PQ+ I+ I  P ++  G   L L++  ++  F  
Sbjct: 190 AIVALLLINLSFGVMTRAAPQLNIFAIGFPVVMISGLFILWLTLAPVMSHFGE 242


>gi|15605293|ref|NP_220079.1| Yop proteins translocation protein T [Chlamydia trachomatis
           D/UW-3/CX]
 gi|76789301|ref|YP_328387.1| SctT [Chlamydia trachomatis A/HAR-13]
 gi|166154779|ref|YP_001654897.1| type III secretion system, membrane protein [Chlamydia trachomatis
           434/Bu]
 gi|166155654|ref|YP_001653909.1| type III secretion system, membrane protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|237802993|ref|YP_002888187.1| type III secretion system, membrane protein [Chlamydia trachomatis
           B/Jali20/OT]
 gi|237804915|ref|YP_002889069.1| type III secretion system, membrane protein [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|255311383|ref|ZP_05353953.1| type III secretion system, membrane protein [Chlamydia trachomatis
           6276]
 gi|255317684|ref|ZP_05358930.1| type III secretion system, membrane protein [Chlamydia trachomatis
           6276s]
 gi|301336054|ref|ZP_07224298.1| type III secretion system, membrane protein [Chlamydia trachomatis
           L2tet1]
 gi|3329005|gb|AAC68166.1| Yop proteins translocation protein T [Chlamydia trachomatis
           D/UW-3/CX]
 gi|76167831|gb|AAX50839.1| SctT [Chlamydia trachomatis A/HAR-13]
 gi|165930767|emb|CAP04264.1| type III secretion system, membrane protein [Chlamydia trachomatis
           434/Bu]
 gi|165931642|emb|CAP07218.1| type III secretion system, membrane protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|231273215|emb|CAX10128.1| type III secretion system, membrane protein [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|231274227|emb|CAX11021.1| type III secretion system, membrane protein [Chlamydia trachomatis
           B/Jali20/OT]
 gi|296436098|gb|ADH18272.1| type III secretion system, membrane protein [Chlamydia trachomatis
           G/9768]
 gi|296437026|gb|ADH19196.1| type III secretion system, membrane protein [Chlamydia trachomatis
           G/11222]
 gi|296437958|gb|ADH20119.1| type III secretion system, membrane protein [Chlamydia trachomatis
           G/11074]
 gi|297140459|gb|ADH97217.1| type III secretion system, membrane protein [Chlamydia trachomatis
           G/9301]
 gi|297748694|gb|ADI51240.1| type III secretion inner membrane protein SctT [Chlamydia
           trachomatis D-EC]
 gi|297749574|gb|ADI52252.1| type III secretion inner membrane protein sctT [Chlamydia
           trachomatis D-LC]
          Length = 289

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/235 (19%), Positives = 106/235 (45%), Gaps = 7/235 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+ S + ++P L     P  +++  A+++  +LLP +     + ++ +   +  L+
Sbjct: 33  LLAARILSMLSIIPFLGAKLFPSPIKIGIALSWMGLLLPQVIQDSTIVHYQDLDIFYILL 92

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLN-LQTSMGISDSLAETPLNSLIGIIG 132
           + E+ +G + G L        Q  GS I+   G+  L+ +  +      +P         
Sbjct: 93  IKEILIGVLIGFLFSFPFYAAQSAGSFITNQQGIQGLEGATSLVSIEQTSPHGIFYHYFV 152

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELN------FGNIFSSFVNMLQTTFMIMLRLS 186
            +  W+   H  +   L++S   IP+              ++ + + M Q   ++ ++LS
Sbjct: 153 TIVFWLAGGHRIILSVLLQSLEIIPLHAVFPESMMSLRAPMWIAILKMCQLCLIMTIQLS 212

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +P     ++ ++ +G++N++ PQ+ + ++ +     +G LFL L+   IV Q  +
Sbjct: 213 APAAVAMLMSDLFLGIINRMAPQVQVIYLLSALKAFMGLLFLTLAWWFIVKQIDY 267


>gi|148546752|ref|YP_001266854.1| flagellar biosynthesis protein FliR [Pseudomonas putida F1]
 gi|148510810|gb|ABQ77670.1| flagellar biosynthetic protein FliR [Pseudomonas putida F1]
          Length = 258

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 102/212 (48%), Gaps = 13/212 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           RV + +M +P      +P +VRL  A+A ++V++P L     +D + L+  +       L
Sbjct: 22  RVTAVLMTMPIFGTRMLPARVRLYVAVAITVVIVPALPPLPEFDPLSLRGLL-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++  + ++ 
Sbjct: 75  CAEQIIVGALFGLALQLLFQAFVIAGQIVAVQMGMAFASMVDPANGVNVTVISQFMTMLV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L  P +  
Sbjct: 135 SVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFGAGLLLILPVIAA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +V NI+ G++ +  PQ+ I+ I  P  + +G
Sbjct: 194 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMG 225


>gi|92114090|ref|YP_574018.1| flagellar biosynthetic protein FliR [Chromohalobacter salexigens
           DSM 3043]
 gi|91797180|gb|ABE59319.1| flagellar biosynthetic protein FliR [Chromohalobacter salexigens
           DSM 3043]
          Length = 261

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 79/158 (50%), Gaps = 11/158 (6%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT--SMGISDSLAETPLNSLIGIIGL 133
           E+ +G   G+++RV    +Q  G  I   +GL   T  + G+ +S+    L+ +  +I L
Sbjct: 78  EMLIGIALGMVLRVTIAVVQAAGEFIGLQMGLAFATFFTPGVGNSMV---LSRIFQMITL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           L    ++ H      L  S+ T+P+G    + + G + + +   + T+ ++M   + P +
Sbjct: 135 LMFLALNGHLIALEILANSFQTLPVGGPRVDGSAGEVIARWGGEIFTSGVLM---ALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL 228
              ++ N+++G+LN+  PQ+ I+ I  P  +  G + L
Sbjct: 192 VSLLIINLTLGVLNRASPQLSIFSIGFPMTLTTGVVLL 229


>gi|242308811|ref|ZP_04807966.1| flagellar biosynthesis protein FliR [Helicobacter pullorum MIT
           98-5489]
 gi|239524650|gb|EEQ64516.1| flagellar biosynthesis protein FliR [Helicobacter pullorum MIT
           98-5489]
          Length = 242

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 89/211 (42%), Gaps = 2/211 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R    +   P      I  Q++  F    +I+ +P L  T+   N     +    +
Sbjct: 17  LLLLRFAGIVAFFPFFENQLINTQIKGIFIFWLTILFIP-LVTTLPPTNMTILEFIIAGI 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E+ LG +    +++    + F G +IS A+GL +  +        +  +  L+ ++ L
Sbjct: 76  -TEIMLGFLASFALQIVFGMISFGGELISFAMGLTIANAYDPVTGAQKPIVGQLLSLLAL 134

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + +  +D+HH   Y +  S   IP+G  +   N     +      F+I L +S P +   
Sbjct: 135 MIVLALDYHHLFLYFVADSIKEIPLGGFIYSNNYILYTIKAFSNLFLIGLTMSFPIIALI 194

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++ +I  G++ K  PQ  +  I  P  I + 
Sbjct: 195 LLSDIIFGMIMKAHPQFNLLAIGFPVKIAVA 225


>gi|283954736|ref|ZP_06372252.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283793576|gb|EFC32329.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 255

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 99/213 (46%), Gaps = 8/213 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS-LIGIIG 132
           + E+  G + GL++++    +   G  I+  +G  + + +   +S    P+ S ++ ++ 
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILD-PNSGTSMPITSQILNLLA 131

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLF 191
           L+     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L 
Sbjct: 132 LMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFTMSFPILG 190

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 191 ISLLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|88704275|ref|ZP_01101989.1| flagellar biosynthetic protein FliR [Congregibacter litoralis KT71]
 gi|88701326|gb|EAQ98431.1| flagellar biosynthetic protein FliR [Congregibacter litoralis KT71]
          Length = 259

 Score = 44.7 bits (104), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 82/161 (50%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L + E+ +G V G ++++    +   G  ++ ++GL    S+   + +    ++ L  ++
Sbjct: 76  LALREVAIGLVMGFVMQLVFAAVVVAGHSVAMSMGLGFAMSVDPQNGVQVPVVSQLNVVL 135

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L    ID H  +  A+V S+G +P+G  ++   +FS+  ++    F   L L+ P L 
Sbjct: 136 ATLLFLAIDGHLILISAVVDSFGLVPVGSAISPEGMFSNVASLGTQLFASALLLALPTLT 195

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
             ++ N++ G++ +  PQ+ I+ +  P  I  G +F+ L++
Sbjct: 196 AILMINVAFGVITRAAPQLNIFAVGFPVTIIAGFVFMLLAL 236


>gi|239907022|ref|YP_002953763.1| flagellar biosynthetic protein FliR [Desulfovibrio magneticus RS-1]
 gi|239796888|dbj|BAH75877.1| flagellar biosynthetic protein FliR [Desulfovibrio magneticus RS-1]
          Length = 259

 Score = 44.7 bits (104), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/238 (19%), Positives = 108/238 (45%), Gaps = 16/238 (6%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L   R+   + +LP    + IP  V+  F +  S+ L P L        F   A  +
Sbjct: 13  SFLLTFMRLSVVVFMLPFYGATLIPNVVKASFCLVLSMALWPRL-------AFAGTALPA 65

Query: 71  K------LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                  + + E+ +G +  +L+R+     Q  G+++  ++G +L  S+      +E+ L
Sbjct: 66  SPWTIGLMFLGEVLIGLMLDILVRLLFSAAQAAGAIMGFSMGFSLMNSVDPMTGASESGL 125

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
             L+  +  +    ++ H  +  AL +S+  +P G  L    +    +      F++ ++
Sbjct: 126 GHLMSQVATMLFLCLNGHLFLLSALAQSFEMVPPGGLLINAAVGEHLIVFTGQLFVMAIK 185

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL---SIEIIVYQF 239
           +++P L    + ++++ L+ +  PQ+ + FI  P  + +G LF+ +   ++ +++  F
Sbjct: 186 IAAPILASIFLVDLALALVARAAPQMNVLFIGFPLKVSVGFLFMTMVFAAMTVVIENF 243


>gi|325273554|ref|ZP_08139784.1| flagellar biosynthesis protein FliR [Pseudomonas sp. TJI-51]
 gi|324101314|gb|EGB98930.1| flagellar biosynthesis protein FliR [Pseudomonas sp. TJI-51]
          Length = 258

 Score = 44.7 bits (104), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 101/212 (47%), Gaps = 13/212 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-----WDTIDLQNFVNRAYYSKL 72
           RV + +M +P      +P +VRL  A+A ++V++P L     +D + L+  +       L
Sbjct: 22  RVTAVLMTMPIFGTRMLPARVRLYVAVAITVVIVPALPPLPEFDPLSLRGLL-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G + GL +++        G +++  +G+   + +   + +  T ++  + ++ 
Sbjct: 75  CAEQIIVGTLFGLALQLLFQAFVIAGQIVAVQMGMAFASMVDPGNGVNVTVISQFMTMLV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L  P +  
Sbjct: 135 SVLFLLMNGHLVVFEVLTESFSTLPVGNALVV-NHFWELAGRMGWVFGAGLLLILPVIAA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +V NI+ G++ +  PQ+ I+ I  P  + +G
Sbjct: 194 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMG 225


>gi|51596027|ref|YP_070218.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis IP
           32953]
 gi|153948291|ref|YP_001401273.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis IP
           31758]
 gi|170024629|ref|YP_001721134.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis
           YPIII]
 gi|186895132|ref|YP_001872244.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis
           PB1/+]
 gi|51589309|emb|CAH20930.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis IP
           32953]
 gi|152959786|gb|ABS47247.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis IP
           31758]
 gi|169751163|gb|ACA68681.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis
           YPIII]
 gi|186698158|gb|ACC88787.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis
           PB1/+]
          Length = 260

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 108/232 (46%), Gaps = 5/232 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   I  +V++   +  + ++ P L   +++  F + A +  +
Sbjct: 17  FWPLVRVLALIGTAPLLSEKQINKKVKIGLGVLITFLIAPSL-PPVNIPLFSSAALW--V 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G+ ++     ++ +G VI   +GL+  T    S       L+ L+ I+ 
Sbjct: 74  AIQQILIGVALGVTMQFAFAAVRLSGEVIGLQMGLSFATFFDPSGGPNMPVLSRLLNILV 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L     D H  +   L  S+ T+PI    LN GN F +        FM  L L+ P + 
Sbjct: 134 TLLFLSFDGHLWLISLLADSFHTLPIQFAPLN-GNGFLTLAQSGSMIFMNGLMLALPLIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F
Sbjct: 193 LLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLF 244


>gi|22126371|ref|NP_669794.1| flagellar biosynthesis protein FliR [Yersinia pestis KIM 10]
 gi|45441392|ref|NP_992931.1| flagellar biosynthesis protein FliR [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108812466|ref|YP_648233.1| flagellar biosynthesis protein FliR [Yersinia pestis Nepal516]
 gi|149366234|ref|ZP_01888269.1| flagellar biosynthetic protein FliR [Yersinia pestis CA88-4125]
 gi|162100178|ref|YP_651106.2| flagellar biosynthesis protein FliR [Yersinia pestis Antiqua]
 gi|165926001|ref|ZP_02221833.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938779|ref|ZP_02227334.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010957|ref|ZP_02231855.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210878|ref|ZP_02236913.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401187|ref|ZP_02306690.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167420441|ref|ZP_02312194.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425768|ref|ZP_02317521.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467508|ref|ZP_02332212.1| flagellar biosynthesis protein FliR [Yersinia pestis FV-1]
 gi|218928939|ref|YP_002346814.1| flagellar biosynthesis protein FliR [Yersinia pestis CO92]
 gi|229896263|ref|ZP_04511433.1| flagellar biosynthetic protein FliR [Yersinia pestis Pestoides A]
 gi|229897200|ref|ZP_04512356.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897927|ref|ZP_04513078.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902842|ref|ZP_04517959.1| flagellar biosynthetic protein FliR [Yersinia pestis Nepal516]
 gi|270486629|ref|ZP_06203703.1| flagellar biosynthetic protein FliR [Yersinia pestis KIM D27]
 gi|294504014|ref|YP_003568076.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|21959356|gb|AAM86045.1|AE013852_7 flagellar biosynthesis protein [Yersinia pestis KIM 10]
 gi|45436252|gb|AAS61808.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776114|gb|ABG18633.1| flagellar biosynthetic protein FliR [Yersinia pestis Nepal516]
 gi|115347550|emb|CAL20459.1| flagellar biosynthetic protein FliR [Yersinia pestis CO92]
 gi|149292647|gb|EDM42721.1| flagellar biosynthetic protein FliR [Yersinia pestis CA88-4125]
 gi|165913393|gb|EDR32015.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922205|gb|EDR39382.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990301|gb|EDR42602.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166208058|gb|EDR52538.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166962136|gb|EDR58157.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049576|gb|EDR60984.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055167|gb|EDR64964.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229680289|gb|EEO76388.1| flagellar biosynthetic protein FliR [Yersinia pestis Nepal516]
 gi|229688968|gb|EEO81033.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693537|gb|EEO83586.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701186|gb|EEO89215.1| flagellar biosynthetic protein FliR [Yersinia pestis Pestoides A]
 gi|262361800|gb|ACY58521.1| flagellar biosynthesis protein [Yersinia pestis D106004]
 gi|262366064|gb|ACY62621.1| flagellar biosynthesis protein [Yersinia pestis D182038]
 gi|270335133|gb|EFA45910.1| flagellar biosynthetic protein FliR [Yersinia pestis KIM D27]
 gi|294354473|gb|ADE64814.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|320015444|gb|ADV99015.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 260

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 108/232 (46%), Gaps = 5/232 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   I  +V++   +  + ++ P L   +++  F + A +  +
Sbjct: 17  FWPLVRVLALIGTAPLLSEKQINKKVKIGLGVLITFLIAPSL-PPVNIPLFSSAALW--V 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G+ ++     ++ +G VI   +GL+  T    S       L+ L+ I+ 
Sbjct: 74  AIQQILIGVALGVTMQFAFAAVRLSGEVIGLQMGLSFATFFDPSGGPNMPVLSRLLNILV 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L     D H  +   L  S+ T+PI    LN GN F +        FM  L L+ P + 
Sbjct: 134 TLLFLSFDGHLWLISLLADSFHTLPIQFAPLN-GNGFLTLAQSGSMIFMNGLMLALPLIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F
Sbjct: 193 LLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLF 244


>gi|145598594|ref|YP_001162670.1| flagellar biosynthesis protein FliR [Yersinia pestis Pestoides F]
 gi|108779103|gb|ABG13161.1| flagellar biosynthetic protein FliR [Yersinia pestis Antiqua]
 gi|145210290|gb|ABP39697.1| flagellar biosynthetic protein FliR [Yersinia pestis Pestoides F]
          Length = 284

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 108/232 (46%), Gaps = 5/232 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   I  +V++   +  + ++ P L   +++  F + A +  +
Sbjct: 41  FWPLVRVLALIGTAPLLSEKQINKKVKIGLGVLITFLIAPSL-PPVNIPLFSSAALW--V 97

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G+ ++     ++ +G VI   +GL+  T    S       L+ L+ I+ 
Sbjct: 98  AIQQILIGVALGVTMQFAFAAVRLSGEVIGLQMGLSFATFFDPSGGPNMPVLSRLLNILV 157

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L     D H  +   L  S+ T+PI    LN GN F +        FM  L L+ P + 
Sbjct: 158 TLLFLSFDGHLWLISLLADSFHTLPIQFAPLN-GNGFLTLAQSGSMIFMNGLMLALPLIT 216

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F
Sbjct: 217 LLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLF 268


>gi|332284030|ref|YP_004415941.1| flagellar biosynthetic protein FliR [Pusillimonas sp. T7-7]
 gi|330427983|gb|AEC19317.1| flagellar biosynthetic protein FliR [Pusillimonas sp. T7-7]
          Length = 262

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 96/207 (46%), Gaps = 14/207 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV--MV 75
           R+ + I   P L  S IP++ ++ FA   ++ + P L    D    +  A ++ L   + 
Sbjct: 22  RILALIGAAPLLGESSIPIRAKVGFAALVTVAIAPAL----DPMPDIPTASFAGLWIGLQ 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   GL++R+    +Q  G  I   +GL+  +    +       L  ++ ++  L 
Sbjct: 78  QVLIGMALGLVMRIVFAAVQTAGEFIGLQMGLSFASFFDPATGANTAVLARIMNVVATLL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPI---GQELN-FGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
              ++ H  +   +++S+  +P+   G + N +G +F     ++ +  M+ L    P + 
Sbjct: 138 FLALNGHLMMLAGIMRSFDVLPVRVGGLDPNGWGVLFEWSSEVMVSGMMLAL----PLII 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTP 218
             +  N+++G+LN+   Q+ ++ +  P
Sbjct: 194 VLLTINLALGILNRTAQQLSVFAVGFP 220


>gi|1066865|gb|AAB81321.1| fliR [Salmonella enterica subsp. enterica serovar Typhimurium]
          Length = 264

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRVRALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|86150984|ref|ZP_01069200.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124645|ref|YP_004066649.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85842154|gb|EAQ59400.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018367|gb|ADT66460.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 255

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 97/212 (45%), Gaps = 6/212 (2%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFF 192
           +     D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L  
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMH-YLNMGMFNIFIIGFTMSFPILGI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 192 SLLADVIFGLLMKTMPQFNLLVIGYPIKIVLG 223


>gi|329901239|ref|ZP_08272764.1| Flagellar biosynthesis protein FliR [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549171|gb|EGF33763.1| Flagellar biosynthesis protein FliR [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 258

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/213 (19%), Positives = 93/213 (43%), Gaps = 12/213 (5%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+   I + P    + +P ++++   +  ++++ P +     L+    +     +  + 
Sbjct: 21  TRILGLIAVAPVFGNASVPRRIKVGLGILIAMIVAPLVQVPSGLEPMSMQGLLILVQQL- 79

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT-----SMGISDSLAETPLNSLIGII 131
             +G   G  +R+    ++  G V S  +GL   T     S G S+++++      + +I
Sbjct: 80  -LIGIAMGFSMRIIFSAVEMAGEVASMTMGLGFATFFDPQSRGRSNAVSQ-----FLSLI 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+     + H  +   LV S+ T+PI      GNI    V      F   L+L+ P + 
Sbjct: 134 VLMVYLAANVHLALLSTLVDSFTTMPITVGPLAGNIAEQVVRWASRLFSAGLQLALPIVA 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             ++ N+++G+L +  P + ++ I  P  + +G
Sbjct: 194 ALLITNVALGILTRAAPSLNLFGIGFPITLTIG 226


>gi|285018168|ref|YP_003375879.1| flagellar biosynthetic protein flir [Xanthomonas albilineans GPE
           PC73]
 gi|283473386|emb|CBA15891.1| probable flagellar biosynthetic protein flir [Xanthomonas
           albilineans]
          Length = 263

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+ +M++P +    IP ++R+  A   ++ L P L    D   F      S  V  EL
Sbjct: 27  RIGAMLMVMPLVGTRAIPARIRVILAATLAMALAPLLPPVPDWNGFDATVVLS--VAREL 84

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL---- 133
            +G   G ++R+        G +IS + GL       ++D L    +NS  G+IG     
Sbjct: 85  AVGASMGFMLRMIFEAGAMAGEMISQSTGLGFAQ---MADPL--RGVNS--GVIGQWFYL 137

Query: 134 ---LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR----LS 186
              L  +  + H  V   LV SY  +PIG  L       + + +    FM M+R    L+
Sbjct: 138 AFGLLFFTANGHLAVVALLVDSYKALPIGSALPDAQ---AMITVAPDFFMSMMRGALTLA 194

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
            P +   +  N++ G L K  P +    I  P  + LG   L +
Sbjct: 195 LPVIVAMLAVNLAFGALAKAAPALNPIQIGLPVAMVLGLALLAI 238


>gi|77918768|ref|YP_356583.1| flagellar biosynthetic protein FliR [Pelobacter carbinolicus DSM
           2380]
 gi|77544851|gb|ABA88413.1| flagellar biosynthetic protein FliR [Pelobacter carbinolicus DSM
           2380]
          Length = 258

 Score = 44.3 bits (103), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/231 (19%), Positives = 98/231 (42%), Gaps = 3/231 (1%)

Query: 15  IVC--RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           +VC  RV S    LP    +  P+++R+  ++  ++V+ P L + +             L
Sbjct: 15  LVCAARVTSLFSALPIFGSAQTPVRIRIALSVTIALVVYPLLPELLPATPLTPIGL-GIL 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  E  +G + G + R+  + ++F GS+I   +G               + ++    +  
Sbjct: 74  IAQETMVGLMIGFIARLVFIAVEFGGSIIGYQMGFAAANVFDPQSQHQVSLISQFQNVFA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     D HH     +  SY  +P G     G        +    F + ++ S+P L  
Sbjct: 134 ILLFLAFDVHHLFLRLIADSYRLLPAGDAKLGGEAVLFLSRLTGEMFTLAVKFSAPVLIV 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            ++  + +G+++++  Q+  + +S P  IG+  L + L+++++       F
Sbjct: 194 LLLSGLVLGIMSRMFQQLNAFMLSFPINIGVSFLSIGLTMQLLAVMLQREF 244


>gi|238755317|ref|ZP_04616660.1| Flagellar biosynthetic protein fliR [Yersinia ruckeri ATCC 29473]
 gi|238706453|gb|EEP98827.1| Flagellar biosynthetic protein fliR [Yersinia ruckeri ATCC 29473]
 gi|328496287|gb|AEB21291.1| FliR [Yersinia ruckeri]
          Length = 260

 Score = 44.3 bits (103), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 108/232 (46%), Gaps = 5/232 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P L+   I  +V++  A+  +I++ P L   I +  F   A +  +
Sbjct: 17  FWPLVRVLALISTAPVLNEKSINRKVKVGLAVMITILIAPSL-PPIAIPVFSVGAIW--V 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +M ++ +G   GL ++     ++  G +I   +GL+  T    S       L  L+ ++ 
Sbjct: 74  LMQQVLIGIAIGLTMQFAFAAIRLAGEIIGLQMGLSFATFFDPSGGPNMPVLARLLNLLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           +L    ++ H  +   L  S+ T+PI    LN G  F +   +    F+  L L+ P + 
Sbjct: 134 MLLFLSLNGHLWMISMLADSFHTLPIQFAPLNGGG-FRALTEIGSLIFLSGLMLALPMIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  N+++G+LN++ PQ+ ++ I  P  + +G L L L +  +     H F
Sbjct: 193 ILLTLNMALGMLNRMTPQLSVFVIGFPLTLTIGMLTLGLIMPALAPYCEHLF 244


>gi|254254349|ref|ZP_04947666.1| Type III secretory pathway component EscT [Burkholderia dolosa
           AUO158]
 gi|124898994|gb|EAY70837.1| Type III secretory pathway component EscT [Burkholderia dolosa
           AUO158]
          Length = 198

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 150 VKSYGTIPIGQ-ELNFGNIFSSF-VNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLV 207
            +SY   PIG    +F ++  +F V    T F  M++L++P +   ++  + IGL+ + V
Sbjct: 83  AQSYAWWPIGSLGPDFSSMLQTFIVRQTDTIFEWMVKLAAPVIIVLVLVELGIGLVGRAV 142

Query: 208 PQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           PQ+ I+  S P    L  L + L +  +VY   HS L
Sbjct: 143 PQLNIFVFSQPVKSALAVLMMVLFLP-VVYASLHSLL 178


>gi|52080240|ref|YP_079031.1| flagellar biosynthesis protein FliR [Bacillus licheniformis ATCC
           14580]
 gi|52785617|ref|YP_091446.1| flagellar biosynthesis protein FliR [Bacillus licheniformis ATCC
           14580]
 gi|52003451|gb|AAU23393.1| flagellar protein [Bacillus licheniformis ATCC 14580]
 gi|52348119|gb|AAU40753.1| FliR [Bacillus licheniformis ATCC 14580]
          Length = 258

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 78/158 (49%), Gaps = 5/158 (3%)

Query: 93  GLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLLALWVIDFHHQVFYALVK 151
            +Q  GS I   +G  +   +    + A++PL    +  + LL +  ++ HH +   +  
Sbjct: 88  AVQIAGSFIDFQMGFAVANVID-PQTGAQSPLVGQFLYTMALLLMLSLNAHHLLLDGIYY 146

Query: 152 SYGTIPIGQ-ELNFGNI-FSSFV-NMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVP 208
           SY  IP+ +  L+FG+  F+ F+     T F+   +LS+P +    + ++++G++ + VP
Sbjct: 147 SYQYIPVDKMALSFGSEEFAEFIAKSFNTMFITAFQLSAPVVACLFLVDLALGIVARTVP 206

Query: 209 QIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           Q+ ++ +  P  I +  + L + + ++     H F + 
Sbjct: 207 QLNVFVVGLPLKIAITFIMLIICMAVMFSMMQHVFEFA 244


>gi|319645981|ref|ZP_08000211.1| flagellar biosynthetic protein fliR [Bacillus sp. BT1B_CT2]
 gi|317391731|gb|EFV72528.1| flagellar biosynthetic protein fliR [Bacillus sp. BT1B_CT2]
          Length = 258

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 78/158 (49%), Gaps = 5/158 (3%)

Query: 93  GLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLLALWVIDFHHQVFYALVK 151
            +Q  GS I   +G  +   +    + A++PL    +  + LL +  ++ HH +   +  
Sbjct: 88  AVQIAGSFIDFQMGFAVANVID-PQTGAQSPLVGQFLYTMALLLMLSLNAHHLLLDGIYY 146

Query: 152 SYGTIPIGQ-ELNFGNI-FSSFV-NMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVP 208
           SY  IP+ +  L+FG+  F+ F+     T F+   +LS+P +    + ++++G++ + VP
Sbjct: 147 SYQYIPVDKMALSFGSEEFAEFIAKSFNTMFITAFQLSTPVVACLFLVDLALGIVARTVP 206

Query: 209 QIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           Q+ ++ +  P  I +  + L + + ++     H F + 
Sbjct: 207 QLNVFVVGLPLKIAITFIMLIICMAVMFSMMQHVFEFA 244


>gi|148553142|ref|YP_001260724.1| flagellar biosynthetic protein FliR [Sphingomonas wittichii RW1]
 gi|148498332|gb|ABQ66586.1| flagellar biosynthetic protein FliR [Sphingomonas wittichii RW1]
          Length = 260

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 95/239 (39%), Gaps = 19/239 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLL---PFLWDT---IDLQNFVNRAYYSK 71
           R G+  +  P      +PMQ+R   A+A  I  L   PF+      + ++ F+       
Sbjct: 22  RPGAAFIAAPVFGAPQVPMQLRAVVALAIGIPALANTPFVMPVGGIVTIEGFL------- 74

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV  E+  G   G  +++        G VI  A+GL      G+ D    +P  ++   +
Sbjct: 75  LVAGEILAGLALGFAVQIGFSAALVAGEVIGNAMGLGFA---GMMDPATGSPSPAVSQYL 131

Query: 132 GLLALW---VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            LLA +       H Q+   +V+SY  +P G+                  F   L ++ P
Sbjct: 132 SLLATFLFLATGGHLQLAAIIVESYRALPPGEAWLGARSIQGLALFGGDLFAAGLAIALP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             F  I+  + + +L +  PQ+ I+ +  P  +  G + L ++  ++    + +   G 
Sbjct: 192 VGFALILVQLVMAMLARSAPQMNIFSVGLPATLMAGLVLLAIAAPVMADGITAAIQRGL 250


>gi|57168057|ref|ZP_00367196.1| flagellar biosynthetic protein FliR [Campylobacter coli RM2228]
 gi|57020431|gb|EAL57100.1| flagellar biosynthetic protein FliR [Campylobacter coli RM2228]
          Length = 234

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 91/206 (44%), Gaps = 8/206 (3%)

Query: 21  SCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL-WDTIDLQNFVNRAYYSKLVMVELFL 79
             I+  P  S + IPM ++  FA+  ++ L P    + + L +F      S++V      
Sbjct: 3   GLIVFFPFFSHNSIPMIIKTTFALFLTMYLFPLAKLEILHLDSFFIIQLLSEIV-----F 57

Query: 80  GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVI 139
           G + GL++++    +   G  I+  +G  + + +  S        + ++ +I LL     
Sbjct: 58  GMIAGLMLQIVFAIVMMAGEQIAFTMGFTMASVLDPSSGTNMPITSQILHLIALLFFLAF 117

Query: 140 DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFLFFYIVFNI 198
           D HH +   L  S G I +G      N+   ++NM +   F+I   +S P L   ++ + 
Sbjct: 118 DGHHLMLLFLSHSLGYINLGGFYPHENLMH-YLNMGMLNIFIIGFTMSFPILGISLLADT 176

Query: 199 SIGLLNKLVPQIPIYFISTPYLIGLG 224
             GLL K +PQ  +  I  P  I LG
Sbjct: 177 IFGLLMKTMPQFNLLVIGYPIKIALG 202


>gi|146294568|ref|YP_001184992.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens CN-32]
 gi|145566258|gb|ABP77193.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens CN-32]
          Length = 259

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 105/227 (46%), Gaps = 7/227 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT--IDLQNFVNRAYYSKLVM 74
           CR+    M++P L  +Y+P+ VR+  A++ + +L P L     +D  +  +     + ++
Sbjct: 21  CRIMGAFMIMPLLGNAYVPVMVRIFLALSIAALLAPMLPPVPPVDAISLASLFLAIEQLL 80

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
           +   L     LLI V T+     G+++S  +GL +      ++  +   ++    I G L
Sbjct: 81  IGFMLALFLTLLIHVMTM----LGNIMSMQMGLAMAVMNDPANGDSSPIISEWFQIFGTL 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               ++ H      +V S+   PIG  + F       V+ L   F   L L+ P +   +
Sbjct: 137 IFLALNGHLVAINIIVDSFRLWPIGHGI-FELPLMGLVSRLAWLFAASLMLAIPAVLAML 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + NI+ G+L++  P + I+ +  P  + +G L + LS+  I  ++S 
Sbjct: 196 MVNITFGVLSRSAPSLNIFSLGFPMTMLMGLLCVFLSLSGIPSRYSD 242


>gi|226944500|ref|YP_002799573.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
 gi|226719427|gb|ACO78598.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
          Length = 264

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 96/211 (45%), Gaps = 4/211 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++ F   CR+ + ++  P    S +P +V++  A+  S++L P L    ++  F   ++
Sbjct: 13  LLAFFWPFCRITAFLLATPLFGHSGVPARVKIALAVLLSVLLGPNLPPLPEVALF---SW 69

Query: 69  YSKLVMVE-LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               + VE + +G   G+++RV     Q  G +I   +GL   T            L+ L
Sbjct: 70  PGLGITVEQMLIGLAIGMVMRVTFAAAQTAGDIIGLQMGLGFATFFSPDTGTNSMVLSRL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +  I LL     D H      L  ++ ++PIG      + +        T F+  L L+ 
Sbjct: 130 LYTIALLLFLAFDGHLLELELLAGTFASLPIGLPRLDPSAWEMLARYGGTLFVSGLLLAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           P +   ++ N+++G+LN+  PQ+ ++ +  P
Sbjct: 190 PLVASLLIVNLAMGILNRSAPQLTVFSVGFP 220


>gi|296124297|ref|YP_003632075.1| type III secretion system inner membrane R protein [Planctomyces
           limnophilus DSM 3776]
 gi|296016637|gb|ADG69876.1| type III secretion system inner membrane R protein [Planctomyces
           limnophilus DSM 3776]
          Length = 334

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 78/173 (45%), Gaps = 9/173 (5%)

Query: 79  LGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI---GIIGLLA 135
           +G   GL +++   GLQ  G +I    G  L         +  +    L+   G +  L 
Sbjct: 144 IGLFLGLGVQMVLAGLQMAGQIIDQQGGFGLGEVFNPDLQMNASQSGQLLFWLGTVIFLV 203

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
           L  +  H  +  ++V+S+ +IP+G+            N++Q +F + +R ++P +    +
Sbjct: 204 LEPLGGHLVMLKSMVESFQSIPVGRAFWEPGTVELLNNLMQASFSLAIRFAAPIMLVMCL 263

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI-----EIIVYQFSHSF 243
            + +IG L+  VPQI I  +    L  + SL L +++      +IV  F  +F
Sbjct: 264 VDAAIGFLSHTVPQINIQAVGF-SLKAMVSLLLLITLFSTSPAVIVNAFQETF 315


>gi|153951433|ref|YP_001397725.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152938879|gb|ABS43620.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 255

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 92/211 (43%), Gaps = 4/211 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    +++   +
Sbjct: 17  LLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPL----ARLESLHLDSFFVLQL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+  G + GL++++    +   G  I+  +G  + + +  S   +      ++ ++ L
Sbjct: 73  ISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITAQILNLLAL 132

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           +     D HH +   L  S G I +G      N+       +   F+I   +S P L   
Sbjct: 133 MFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNIGMFNIFIIGFTMSFPILGIS 192

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++ ++  GLL K +PQ  +  I  P  I LG
Sbjct: 193 LLADVIFGLLMKTMPQFNLLVIGYPIKIALG 223


>gi|154249643|ref|YP_001410468.1| type III secretion system inner membrane R protein
           [Fervidobacterium nodosum Rt17-B1]
 gi|154153579|gb|ABS60811.1| type III secretion system inner membrane R protein
           [Fervidobacterium nodosum Rt17-B1]
          Length = 255

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 95/189 (50%), Gaps = 10/189 (5%)

Query: 34  IPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTL- 92
           +P+++ +   +A S V LP +   + +   ++    S  ++   F+G V GL+   YT+ 
Sbjct: 36  LPLEIMVVLLLALSYVTLPMVNIMVPITLPISTLVIS--LLFNFFIGFVIGLM--AYTIV 91

Query: 93  GLQFTGSVI-STAIGLNLQTSMGISDSLAETPLNS-LIGIIGLLALWVIDFHHQVFYALV 150
           G  + GS I     G N+  S+    ++ E+P+ S  + +I +     +  H  ++ ++V
Sbjct: 92  GAVYIGSEIFGIQSGFNVSGSL--DPTMEESPITSEFVYLISVYVFVSLKGHLIIYSSVV 149

Query: 151 KSYGTIP-IGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQ 209
           KS    P +  ++ F  I S +  +    F+  L+++ P +    + N+  G+L++LVPQ
Sbjct: 150 KSIEKFPLVITDIPFKEINSQYFELFMDAFIFSLQIALPLIGLMFLINVLFGILSRLVPQ 209

Query: 210 IPIYFISTP 218
           + ++ ++ P
Sbjct: 210 MNVFMVAMP 218


>gi|262276383|ref|ZP_06054192.1| flagellar biosynthesis protein FliR [Grimontia hollisae CIP 101886]
 gi|262220191|gb|EEY71507.1| flagellar biosynthesis protein FliR [Grimontia hollisae CIP 101886]
          Length = 237

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 92/192 (47%), Gaps = 22/192 (11%)

Query: 32  SYIPMQVRLCFAMAFSIVLLPFLW---DTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIR 88
            ++P++VRL  ++A +  ++P L    +T++L +F      ++ +++ + +G V   +I+
Sbjct: 7   RFVPVRVRLYLSLAITFAVMPALPRVPETVELVSFGGFVILAQQILIGIAMGTVTQFVIQ 66

Query: 89  VYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWV-------IDF 141
            + L  Q  G          +Q+S+G + S+ +        ++G   L+V        D 
Sbjct: 67  TFVLLGQIIG----------MQSSLGFA-SMVDPANGQNTPLLGQFYLFVATMIFLSTDG 115

Query: 142 HHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIG 201
           H Q+   +V S+ T+P+G  L   + + +  +     F + L ++   +   +  N+S G
Sbjct: 116 HLQMLNLVVMSFKTLPVGDMLGAAD-YRAMASWFGIMFSVALGMALAGIIALLTVNLSFG 174

Query: 202 LLNKLVPQIPIY 213
           ++ +  PQ+ I+
Sbjct: 175 VMTRAAPQLNIF 186


>gi|187733359|ref|YP_001879729.1| flagellar biosynthesis protein FliR [Shigella boydii CDC 3083-94]
 gi|187430351|gb|ACD09625.1| flagellar biosynthetic protein FliR [Shigella boydii CDC 3083-94]
          Length = 261

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 100/212 (47%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  + V+ P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFVIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLPLNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|296534147|ref|ZP_06896643.1| flagellar biosynthetic protein FliR [Roseomonas cervicalis ATCC
           49957]
 gi|296265523|gb|EFH11652.1| flagellar biosynthetic protein FliR [Roseomonas cervicalis ATCC
           49957]
          Length = 258

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 95/201 (47%), Gaps = 1/201 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+C M+LPGL    +P+ VRL  A+A   +LLP L   +  +   + A   +L+ +E+
Sbjct: 23  RMGACGMVLPGLGEQEVPVTVRLALALAVVALLLPVLGPQLPPEP-QDMAGLVRLIALEV 81

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G L R+    +Q  G  I   IGL+   S   +     T L    G+  +  L 
Sbjct: 82  AIGFWIGWLARLMVYAVQVAGQAIGLMIGLSSVLSQDPTMGEGSTALGRFFGLAAVSLLL 141

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
               +     AL +SY  +P+G  L  G    +       +F + LRL++P +   ++  
Sbjct: 142 ASGLYALPLRALAESYALLPVGAPLPAGPAAEAVAQASAASFALALRLAAPLILLTLLLQ 201

Query: 198 ISIGLLNKLVPQIPIYFISTP 218
           +  GLL ++ PQ  +Y ++ P
Sbjct: 202 MGSGLLARIAPQAQVYILALP 222


>gi|254785482|ref|YP_003072911.1| flagellar biosynthetic protein FliR [Teredinibacter turnerae T7901]
 gi|237685643|gb|ACR12907.1| flagellar biosynthetic protein FliR [Teredinibacter turnerae T7901]
          Length = 257

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 105/239 (43%), Gaps = 10/239 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           FL   R+G   +++P      +  +VRL  A   +++++P L     +     +A +   
Sbjct: 16  FLPFVRIGVMFLVMPVFGSRIVSPRVRLVLAFLITVLVVPLLPALPSVPPLSWQALF--F 73

Query: 73  VMVELFLGCVHGLLIRV----YTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           V  E+ LG   G   +V    + LG QF    ++  +GL   +    ++ +  T L+   
Sbjct: 74  VAQEVVLGAAVGFTFQVVFQMFVLGGQF----MAMKMGLGFASMNDPTNGVQTTVLSQFF 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    ++ H  +   +V S+ T+  G+ +   + F   V +    F   L ++ P
Sbjct: 130 LMLVTLMFVAVEGHLVLISLIVDSFHTLQPGRFVFASSNFYEIVKLGSWMFAAALLMALP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +   +  NI+ G++++  PQ+ I+ +  P+ +  G L + L +      F  +  YGF
Sbjct: 190 VITSLLFVNIAFGIMSRAAPQLNIFAVGFPFTLMCGLLLIWLGLTHFSEIFETAITYGF 248


>gi|300693347|ref|YP_003749320.1| flir: flagellar biosynthesis inner membrane protein. flir/mope/spar
           family [Ralstonia solanacearum PSI07]
 gi|299075384|emb|CBJ34679.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum PSI07]
          Length = 262

 Score = 43.9 bits (102), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 84/190 (44%), Gaps = 6/190 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  + + IP  +++ F +  ++ L P L     +   V+   Y  L   ++
Sbjct: 22  RVLAFIAVAPPFANTEIPSSIKVAFGVVLTVALAPML----PVPPGVSVGSYEGLWITLL 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G+ +++    +   G ++S  IGL   T +    + +   L   I +  + A
Sbjct: 78  QVAIGMALGVCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSMLLGRFISLTAITA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + +AL  S+  +P+      G  + +        F + +R++ P +   +V
Sbjct: 138 FIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGTAVFALAVRIALPIIAIMMV 197

Query: 196 FNISIGLLNK 205
            N++  +L++
Sbjct: 198 VNLAFAVLSR 207


>gi|127512309|ref|YP_001093506.1| flagellar biosynthesis protein FliR [Shewanella loihica PV-4]
 gi|126637604|gb|ABO23247.1| flagellar biosynthetic protein FliR [Shewanella loihica PV-4]
          Length = 265

 Score = 43.9 bits (102), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 110/235 (46%), Gaps = 24/235 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV S +M++     +  P +VRL  ++A +  + P L    +++ F   A +  +  +++
Sbjct: 21  RVSSMLMVMAVFGANTTPTRVRLLLSVAITFAIAPMLPVNTEVELFSLGAVFVTVQQILI 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  L+++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTLLIMQTFVL----TGQII------GMQTSLGFASMVDPGSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  +    +D H  +   LV S+ TIP+  +   G   +S+  + +     F   L +S
Sbjct: 131 LLTTMIFLAVDGHLVMIRMLVASFDTIPVSMQ---GISIASYRRLAEWGAYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F  
Sbjct: 188 ISAIVALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLIILWLTLTPIMAHFDE 242


>gi|90411035|ref|ZP_01219049.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
 gi|90328248|gb|EAS44559.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
          Length = 260

 Score = 43.9 bits (102), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 106/243 (43%), Gaps = 25/243 (10%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRL------CFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
            R+ S +M +      ++  ++RL       FA+  S+  +P   + + LQ F+  A   
Sbjct: 20  TRISSMMMTMTFFGARFVSPRIRLYLGLTVTFAVMPSLPAVPANIELLSLQGFLITAQ-- 77

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETP-L 124
                ++ +G   GL+ +  T      G +      L +Q+S+G +  +       TP L
Sbjct: 78  -----QIVIGVSIGLVTQFVTQTFVLVGQI------LGMQSSLGFASMVDPANGQNTPVL 126

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
             L   + ++     D H ++   +V S+ T+PIGQE+   + +          F   L 
Sbjct: 127 GQLYLFLAIMLFLATDGHLEMLNVIVLSFKTLPIGQEMFRPDDYYQLAGWFGHMFKGALN 186

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++   +   +  N+S G++ +  PQ+ I+ +   + + LG L     +  ++ Q+ H++ 
Sbjct: 187 MALAGVIALLTVNLSFGVMTRAAPQLNIFALGFSFALLLGLLISWYLVMGMLPQYQHAWD 246

Query: 245 YGF 247
           +GF
Sbjct: 247 FGF 249


>gi|120554899|ref|YP_959250.1| flagellar biosynthesis protein FliR [Marinobacter aquaeolei VT8]
 gi|120324748|gb|ABM19063.1| flagellar biosynthetic protein FliR [Marinobacter aquaeolei VT8]
          Length = 261

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 94/203 (46%), Gaps = 6/203 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           R+ S +M++P      +P +VRL  A+  +I++ P +     ++     A    L  +++
Sbjct: 24  RLASFLMVIPIFGTQLVPARVRLGLALLMTILIAPMIPPVPQVEALSADAVVITLQQILI 83

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            + LG     L +++ +     G +I+  +GL   + +  ++ +    L  +  I   L 
Sbjct: 84  GIGLGFALTALWQLFVI----AGQMIAMQMGLGFASMVDPANGVNVPVLAQIYTITITLL 139

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
             V++ H   F   ++S+ T+PIG E    +   +  + +   F   + L+ P +   ++
Sbjct: 140 FLVMNGHLVAFEVFIESFYTLPIGLEGLGQDGVWALAHRISWMFASAMLLALPAVTAVLI 199

Query: 196 FNISIGLLNKLVPQIPIYFISTP 218
            NIS G++ +  PQ+ I+ +  P
Sbjct: 200 VNISFGVMTRAAPQMNIFALGFP 222


>gi|149189858|ref|ZP_01868138.1| putative flagellar biosynthetic protein FliR [Vibrio shilonii AK1]
 gi|148836344|gb|EDL53301.1| putative flagellar biosynthetic protein FliR [Vibrio shilonii AK1]
          Length = 258

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 102/218 (46%), Gaps = 9/218 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           R+G+  + +P    + IP+ VR   A++  ++  P +     +DL +  +     +  M 
Sbjct: 21  RIGAAFLAMPFFGDALIPVWVRALLALSIVVITAPLMPAMPAVDLLSMTSLFLAFEQAMW 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            LF G +  L   ++T+     G ++S  +GL +       + L+   L  +  ++  L 
Sbjct: 81  GLFFGLILHLFFTIFTM----LGQIVSLQMGLGMAIMNDPVNGLSVAILGRIFLLLCTLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H  V   LV+S+   P+G  +   ++  + V++    F   L L+ P +   ++
Sbjct: 137 FLALEGHLLVIDILVQSFVVWPVGSGITIASL-DNIVSLFGWMFASALALALPAIVSMLL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
            NIS G++N+  P + +Y +  P   L+GL S+ L +S
Sbjct: 196 ANISFGVMNRAAPSLNVYALGFPMTMLLGLFSILLTVS 233


>gi|157376186|ref|YP_001474786.1| flagellar biosynthesis protein FliR [Shewanella sediminis HAW-EB3]
 gi|157318560|gb|ABV37658.1| flagellar biosynthetic protein FliR [Shewanella sediminis HAW-EB3]
          Length = 265

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 107/232 (46%), Gaps = 18/232 (7%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           RV S +M++     +  P++VRL  +MA +  + P L    +++ F   + +  ++ +++
Sbjct: 21  RVSSMLMVMAVFGANTTPVRVRLLLSMAITFAIAPVLPPVENIELFALSSVFVTAQQILI 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  L+++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 81  GVAMGFVTLLVMQTFVL----TGQII------GMQTSLGFASMVDPSSGQQTPVIGNFFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++  +    +D H  +   LV S+ TIPI  +      +          F   L +S   
Sbjct: 131 LLTTMIFLSVDGHLVLIRMLVVSFETIPISDQGLSITSYKLLAEWGAYMFGAALTMSITA 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F  
Sbjct: 191 IVALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLIILWLTLTPIMEHFGE 242


>gi|167841179|ref|ZP_02467863.1| type III secretion system EscT protein [Burkholderia thailandensis
           MSMB43]
          Length = 261

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 86/188 (45%), Gaps = 19/188 (10%)

Query: 40  LCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGS 99
           L  A++  ++ L  LW  +D     + A Y  L   EL +G V G    V    L   G 
Sbjct: 44  LVLAISLPVLALHDLWPAVD--GARSWAAYLWLACGELSIGLVIGFCAAVPFWALDMAGF 101

Query: 100 VISTAIGLNLQTSMGISDSLAETPL----NSLIGII--GLLALWVIDFH--HQVFYALVK 151
           +I T  G ++ + +         PL    +S++GI+   + +L  + F   H +  AL  
Sbjct: 102 LIDTMRGASMASVL--------NPLLGQQSSMMGIVFSQVFSLLFMMFGGFHALLEALYA 153

Query: 152 SYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQI 210
           SY T+P G    F      F+    Q  + + LR + P +   ++ ++++GL+N+   Q+
Sbjct: 154 SYLTLPPGAAFRFRPAALDFLGQQWQLMYTLCLRFAMPAIVAILLVDMALGLVNRSAQQL 213

Query: 211 PIYFISTP 218
            ++F++ P
Sbjct: 214 NVFFVAMP 221


>gi|238920323|ref|YP_002933838.1| flagellar biosynthesis protein FliR [Edwardsiella ictaluri 93-146]
 gi|238869892|gb|ACR69603.1| flagellar biosynthetic protein FliR, putative [Edwardsiella
           ictaluri 93-146]
          Length = 261

 Score = 43.5 bits (101), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 99/215 (46%), Gaps = 3/215 (1%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P L    IP +VR+  A   + +L P L  T D+    + A +  L + ++ +GC  GL 
Sbjct: 31  PMLGEKVIPRKVRIALAALTAFLLAPQLPPT-DITLASDGALW--LAIQQILIGCAIGLT 87

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           +++    ++  G VI   +GL+  T    S       L  L+ ++ LL     + H    
Sbjct: 88  MQLAFAAVRLAGEVIGMQMGLSFATFFDPSGGPNMPVLARLLNLLALLLFLCANGHLWTI 147

Query: 147 YALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKL 206
             L  S+ T+P+      GN F +     +  F+  + L+ P +   +  NI++GLLN++
Sbjct: 148 SLLADSFHTLPLSTHPLNGNGFLALAQSGKLIFLSGMMLALPLITLLLTLNIALGLLNRM 207

Query: 207 VPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            PQ+ I+ I  P  + +G + L + + ++     H
Sbjct: 208 TPQLSIFVIGFPLTLTIGMMTLSMLMPMLAPFVDH 242


>gi|167770200|ref|ZP_02442253.1| hypothetical protein ANACOL_01543 [Anaerotruncus colihominis DSM
           17241]
 gi|167667522|gb|EDS11652.1| hypothetical protein ANACOL_01543 [Anaerotruncus colihominis DSM
           17241]
          Length = 254

 Score = 43.5 bits (101), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 90/205 (43%), Gaps = 9/205 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-DTIDLQNFVNRAYYSKL 72
           L+  R+ + I   P LS   +P  VR       + ++ P L    +D    V       L
Sbjct: 14  LVFVRMAAMIGTNPLLSRRNVPAAVRAGLTALLTFLIAPGLTVAPMDQMTLV-------L 66

Query: 73  VMVELFL-GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            M++ FL G   G + +++   L F G V+    GL++        ++  +   + + I+
Sbjct: 67  AMLKEFLVGFACGYVFQIFYYMLFFAGDVMDMQFGLSMAKVFDPGTNMQVSVSGNFLNIL 126

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L ++  + H  +      S+  +P G      ++     ++    F + LRL+ PF+ 
Sbjct: 127 FSLFIFATNSHLLLVRIFATSFQIVPAGFTPFSPHVSGYIADLFIEAFSLALRLALPFIA 186

Query: 192 FYIVFNISIGLLNKLVPQIPIYFIS 216
              V  +S+G+L KL+PQI ++ I+
Sbjct: 187 VEFVLEVSLGILMKLIPQIHVFVIN 211


>gi|299068760|emb|CBJ40000.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum CMR15]
          Length = 262

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/210 (18%), Positives = 91/210 (43%), Gaps = 12/210 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  + + IP  +++ F +  ++ L P L     + + +    Y  L   ++
Sbjct: 22  RVLAFIAVAPPFANTEIPTSIKVAFGVVLTVALAPML----PVPSGIAVGSYEGLWITLL 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G+ +++    +   G ++S  IGL   T +    + +   L   I +  + A
Sbjct: 78  QVAIGMALGVCVQMVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGRFISLTAITA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + +AL  S+  +P+      G  + +        F + +R++ P +   +V
Sbjct: 138 FIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGAAVFALAVRIALPIIAIMMV 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGS 225
            N++  +L++    +       P+ +G+ +
Sbjct: 198 VNLAFAVLSRTAQAL------NPFAVGIAA 221


>gi|54308127|ref|YP_129147.1| flagellar biosynthesis protein FliR [Photobacterium profundum SS9]
 gi|46912553|emb|CAG19345.1| putative polar flagellar assembly protein FliR [Photobacterium
           profundum SS9]
          Length = 260

 Score = 43.5 bits (101), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 105/243 (43%), Gaps = 25/243 (10%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL------WDTIDLQNFVNRAYYS 70
            R+ S +M +      ++  ++RL   +  +  ++P L       + + LQ F+  A   
Sbjct: 20  TRISSMMMTMTFFGARFVSPKIRLYLGLTVTFAVMPALPAVPANIELLSLQGFLITAQ-- 77

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETP-L 124
                ++ +G   GL+ +  T      G +      L +Q+S+G +  +       TP L
Sbjct: 78  -----QIVIGVSIGLVTQFVTQTFVLVGQI------LGMQSSLGFASMVDPANGQNTPVL 126

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
             L   + ++     D H ++   +V S+ T+PIGQE+   + +          F   L 
Sbjct: 127 GQLYLFLAIMLFLATDGHLEMLNIIVLSFKTLPIGQEMFRPDDYYQLAGWFGHMFKGALN 186

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++   +   +  N+S G++ +  PQ+ I+ +   + + LG L     +  ++ Q+ H++ 
Sbjct: 187 MALAGVIALLTVNLSFGVMTRAAPQLNIFALGFSFALLLGLLISWYLVMGMLPQYQHAWD 246

Query: 245 YGF 247
           +GF
Sbjct: 247 FGF 249


>gi|297538206|ref|YP_003673975.1| flagellar biosynthetic protein FliR [Methylotenera sp. 301]
 gi|297257553|gb|ADI29398.1| flagellar biosynthetic protein FliR [Methylotenera sp. 301]
          Length = 270

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 109/231 (47%), Gaps = 17/231 (7%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++SL   + R+   I   P  + + IP QV+L   +  ++++ P L      + F   ++
Sbjct: 13  IVSLLWPLTRILGVIAAAPIFNHTAIPNQVKLGLGIMLTLIIAPTLPAMPHFEIF---SF 69

Query: 69  YSKLVMVE-LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
              L++V+ L +G   G  +R+    ++  G +I  ++GL              T +N  
Sbjct: 70  QGLLILVQQLVIGLAIGFSMRLVFSAVELAGQLIGMSMGLGFAGFYDPQSQGQSTAVNQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNML------QTTFMI 181
           + ++ +L    +D H  +  A+  S+ T+PI        + SS ++ L      +T F +
Sbjct: 130 LVLLAMLIFLSLDGHLLIITAVANSFLTMPI-------TVGSSGIDPLKIAMWGETIFSV 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
            L L+ P +   ++ N+++G+L K  PQ+ ++ I  P  + +G + + LS+
Sbjct: 183 GLILALPAVAALLITNMALGILTKTAPQLNLFGIGFPVTLSIGLVVIALSL 233


>gi|283784008|ref|YP_003363873.1| flagellar biosynthetic protein [Citrobacter rodentium ICC168]
 gi|282947462|emb|CBG87009.1| flagellar biosynthetic protein [Citrobacter rodentium ICC168]
          Length = 260

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 98/214 (45%), Gaps = 9/214 (4%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +++ L+    R+ + I  +P    + + ++VR+  ++A +IV+ P +   +        +
Sbjct: 12  LVLGLWFPFVRIMAFIRYVPVFDNAALTIRVRIILSLALAIVITPMIPHPVPDSLLSMNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L   ++  G + GL+ +   L LQ  G ++S  +G+++          + T L  L
Sbjct: 72  LI--LTAEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPGSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS---SFVNMLQTTFMIMLR 184
           I +  ++  + +D H  +   L K +   PIG  L+  ++ +   +F  +L +  ++ L 
Sbjct: 130 INVYAVILFFAMDGHLLLVSVLYKGFTYWPIGNALHPQSLRTLALAFSWVLGSAMLLAL- 188

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
              P  F  ++     GLLN++ P + +Y +  P
Sbjct: 189 ---PTTFIMLIVQGCFGLLNRVAPPLNLYSLGFP 219


>gi|134294010|ref|YP_001117746.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia
           vietnamiensis G4]
 gi|134137167|gb|ABO58281.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia
           vietnamiensis G4]
          Length = 269

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 57/117 (48%), Gaps = 10/117 (8%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQELNFGNIFSSF-----VNMLQTTFMIMLRLSS 187
           LAL+V     QV   L  +SY   PIG   +FG   SS      V    T F  M++L++
Sbjct: 137 LALFVTAGGLQVLVQLFAQSYAWWPIG---SFGPDLSSMLQTFVVRQTDTIFEWMVKLAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           P +   ++  + IGL+ + VPQ+ ++  S P    L  L + L +  +VY   H+ L
Sbjct: 194 PVIIVLVLVELGIGLVGRAVPQLNVFVFSQPLKSALAVLMMVLFLP-VVYASLHALL 249


>gi|16765319|ref|NP_460934.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56413106|ref|YP_150181.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62180556|ref|YP_216973.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161613450|ref|YP_001587415.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167993556|ref|ZP_02574650.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234154|ref|ZP_02659212.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168239221|ref|ZP_02664279.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244832|ref|ZP_02669764.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259732|ref|ZP_02681705.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462477|ref|ZP_02696408.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168823024|ref|ZP_02835024.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444159|ref|YP_002041246.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449212|ref|YP_002046032.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472341|ref|ZP_03078325.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736717|ref|YP_002115015.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197265429|ref|ZP_03165503.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197362032|ref|YP_002141669.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207856506|ref|YP_002243157.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224583520|ref|YP_002637318.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912446|ref|ZP_04656283.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|20141401|sp|P54702|FLIR_SALTY RecName: Full=Flagellar biosynthetic protein fliR
 gi|16420516|gb|AAL20893.1| putative flagellar biosynthetic protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56127363|gb|AAV76869.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62128189|gb|AAX65892.1| putative flagellar biosynthetic protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161362814|gb|ABX66582.1| hypothetical protein SPAB_01167 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402822|gb|ACF63044.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407516|gb|ACF67735.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458705|gb|EDX47544.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194712219|gb|ACF91440.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634515|gb|EDX52867.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197093509|emb|CAR58970.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197243684|gb|EDY26304.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288058|gb|EDY27445.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|205328394|gb|EDZ15158.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331896|gb|EDZ18660.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336365|gb|EDZ23129.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340657|gb|EDZ27421.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350805|gb|EDZ37436.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708309|emb|CAR32612.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224468047|gb|ACN45877.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247147|emb|CBG24970.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993970|gb|ACY88855.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158495|emb|CBW18005.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912971|dbj|BAJ36945.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321224626|gb|EFX49689.1| Flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616974|gb|EFY13882.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618213|gb|EFY15105.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625884|gb|EFY22703.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626336|gb|EFY23146.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632751|gb|EFY29496.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639093|gb|EFY35786.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640409|gb|EFY37065.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647230|gb|EFY43729.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649885|gb|EFY46307.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655530|gb|EFY51838.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660308|gb|EFY56546.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662989|gb|EFY59196.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668174|gb|EFY64333.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674067|gb|EFY70161.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675581|gb|EFY71655.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683008|gb|EFY79024.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686702|gb|EFY82680.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322715032|gb|EFZ06603.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323130260|gb|ADX17690.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195410|gb|EFZ80590.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198062|gb|EFZ83179.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204466|gb|EFZ89472.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207556|gb|EFZ92504.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211005|gb|EFZ95865.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217541|gb|EGA02260.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220726|gb|EGA05170.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226687|gb|EGA10884.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231563|gb|EGA15676.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236006|gb|EGA20085.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240576|gb|EGA24619.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245468|gb|EGA29468.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247586|gb|EGA31537.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253951|gb|EGA37775.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255521|gb|EGA39282.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262119|gb|EGA45682.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266242|gb|EGA49732.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270649|gb|EGA54090.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|332988870|gb|AEF07853.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 264

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|157147127|ref|YP_001454446.1| hypothetical protein CKO_02904 [Citrobacter koseri ATCC BAA-895]
 gi|157084332|gb|ABV14010.1| hypothetical protein CKO_02904 [Citrobacter koseri ATCC BAA-895]
          Length = 257

 Score = 43.1 bits (100), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 105/226 (46%), Gaps = 4/226 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +M+L L   R+ + +   P L       ++++  A+A SI++ P L + + L   ++   
Sbjct: 12  LMALVLPFFRILAFLQFAPVLDNRAFSRRIKIAAALALSIIITPMLPNNVVLSELLSMRT 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L+  +L  G + G+ +++  + LQ  G ++S  +GL +       +  + T ++ +I
Sbjct: 72  V-LLIGEQLLWGFLFGMALQLVFVTLQTAGHILSMNMGLGMAMMNDPVNGSSTTVISQII 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +   L  +++D H  +   L K +   PIGQ +N   + +  V  L         ++ P
Sbjct: 131 YVFCALLFFIMDGHLLLVTILFKGFSYWPIGQAINQPTL-TLIVQGLGWIMASATLIALP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEI 234
             F  ++     GLLN++ P + ++ +  P  +  G   LC+S+ +
Sbjct: 190 TTFVMLIVQGGFGLLNRVSPTLNLFSLGFPISMLFG--LLCISMMV 233


>gi|254462422|ref|ZP_05075838.1| flagellar biosynthetic protein FliR [Rhodobacterales bacterium
           HTCC2083]
 gi|206679011|gb|EDZ43498.1| flagellar biosynthetic protein FliR [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 273

 Score = 43.1 bits (100), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 105/213 (49%), Gaps = 10/213 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--S 70
           FL   R+ +  +  P    + IP+QVR+  ++  S+      +  +++ +     +    
Sbjct: 30  FLHTIRLSAFFLSAPFFGAASIPVQVRVMVSILISVSF----FGKVEVPDPQTLPFLLLV 85

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIG 129
           +++MVE+ +G + GL++ V    +   G  ++++ GL     +   +   +TP ++ L+ 
Sbjct: 86  EVIMVEIAMGLLLGLILTVLFSSVALAGEKVASSAGLGFAAQVD-PNLGGQTPVISQLLN 144

Query: 130 IIGLLALWVIDFHHQVFYALVK-SYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           + G++    +D  H V  AL+K SY  +P+G+  NF  + +S +      F +   LS P
Sbjct: 145 LFGIVLFLAMD-GHLVCIALIKGSYDLMPLGRPFNFQALIASGLTSGGHMFSMASLLSFP 203

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
            +   ++ NI++G++ +  PQ+ ++    P  I
Sbjct: 204 IVAILLLANITVGVITRSAPQLNLFSFGFPLTI 236


>gi|16760925|ref|NP_456542.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141383|ref|NP_804725.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213025463|ref|ZP_03339910.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213163374|ref|ZP_03349084.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213417180|ref|ZP_03350324.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213424993|ref|ZP_03357743.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213612733|ref|ZP_03370559.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650741|ref|ZP_03380794.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855266|ref|ZP_03383506.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|25346403|pir||AF0753 flagellar biosynthetic protein FliR [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503222|emb|CAD05729.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137010|gb|AAO68574.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 264

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|213580028|ref|ZP_03361854.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 253

 Score = 43.1 bits (100), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 6   FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 62

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 63  AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 122

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 123 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 182

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 183 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 233


>gi|205352325|ref|YP_002226126.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205272106|emb|CAR36959.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627375|gb|EGE33718.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 264

 Score = 43.1 bits (100), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 ILLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|170737796|ref|YP_001779056.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia cenocepacia
           MC0-3]
 gi|254250202|ref|ZP_04943522.1| Type III secretory pathway, component EscT [Burkholderia
           cenocepacia PC184]
 gi|124876703|gb|EAY66693.1| Type III secretory pathway, component EscT [Burkholderia
           cenocepacia PC184]
 gi|169819984|gb|ACA94566.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia cenocepacia
           MC0-3]
          Length = 269

 Score = 43.1 bits (100), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSF-VNMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +F V    T F  M++L++P  
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFIVRQTDTIFEWMVKLAAPVT 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ I+  S P    L  L + L +  +VY   HS L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNIFVFSQPLKSALAVLMMILFLP-VVYASLHSLL 249


>gi|198244152|ref|YP_002215105.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197938668|gb|ACH76001.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
          Length = 264

 Score = 43.1 bits (100), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  TMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|17548594|ref|NP_521934.1| flagellar biosynthetic fliR transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17430842|emb|CAD17524.1| probable flagellar biosynthetic flir transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 262

 Score = 43.1 bits (100), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/210 (18%), Positives = 91/210 (43%), Gaps = 12/210 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  + + IP  +++ F +  ++ L P L     +   ++   Y  L   ++
Sbjct: 22  RVLAFIAVAPPFANTEIPTSIKVAFGVVLTVALAPML----PVPAGISVGSYEGLWITLL 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G+ +++    +   G ++S  IGL   T +    + +   L   I +  + A
Sbjct: 78  QVAIGMALGVCVQMVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGRFISLTAITA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  + +AL  S+  +P+      G  + +        F + +R++ P +   +V
Sbjct: 138 FIAGDGHLVLMHALFDSFTVLPVSAAPLAGGGWQTLAGGGAAVFALAVRIALPIIAIMMV 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGS 225
            N++  +L++    +       P+ +G+ +
Sbjct: 198 VNLAFAVLSRTAQAL------NPFAVGIAA 221


>gi|311695201|gb|ADP98074.1| flagellar biosynthesis protein FliR [marine bacterium HP15]
          Length = 261

 Score = 43.1 bits (100), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/201 (19%), Positives = 88/201 (43%), Gaps = 2/201 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ S +M++P      +P ++RL  A+  +I++ P +     ++     A    + + ++
Sbjct: 24  RLASFLMVIPIFGTQLVPARIRLGLALLMTILIAPMIPPVPQVEALSADAVV--ITLQQI 81

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G  +          G +I+  +GL   + +  ++ +    L+ +  I   L   
Sbjct: 82  LIGVGMGFALTALWQLFVIAGQMIAMQMGLGFASMVDPANGVNVPVLSQIYTITITLLFL 141

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H   F   ++S+ T+PIG E           + +   F   + L+ P +   ++ N
Sbjct: 142 AMNGHLVAFEVFIESFRTLPIGMEGLGQTGIWELAHRISWMFASAMLLALPAVTAVLIVN 201

Query: 198 ISIGLLNKLVPQIPIYFISTP 218
           IS G++ +  PQ+ I+ +  P
Sbjct: 202 ISFGVMTRAAPQMNIFALGFP 222


>gi|283782109|ref|YP_003372864.1| type III secretion system inner membrane R protein [Pirellula
           staleyi DSM 6068]
 gi|283440562|gb|ADB19004.1| type III secretion system inner membrane R protein [Pirellula
           staleyi DSM 6068]
          Length = 277

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 92/201 (45%), Gaps = 9/201 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L++ R+G  + +LP    S +PMQ R   A+A +++L P     +      N      ++
Sbjct: 17  LVLTRIGMLVFILPMFGSSSVPMQARAILAIAIALILTPVYAGALP-SPPENLMMLGLML 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E  LG   GL + +   G+Q  GS+IS   G+ L      +   +    + L+ ++ L
Sbjct: 76  ARESMLGLALGLAVMILLAGMQLAGSIISQMSGMTLADVANPTFDTSVPIFSQLLEMLSL 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT----TFMIMLRLSSPF 189
              + +  H  V  AL+ ++  +P GQ           V ML T    +F I +R ++P 
Sbjct: 136 AIFFSLGGHRLVMSALLDTFKFMPPGQ----ATFPEEAVEMLATIFTHSFEIGIRAAAPA 191

Query: 190 LFFYIVFNISIGLLNKLVPQI 210
           +   ++  + + L+++ +PQ+
Sbjct: 192 IISLLLAILVVALISRTLPQL 212


>gi|38639344|gb|AAR25810.1| BcscT [Burkholderia multivorans E243]
          Length = 269

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSFV-NMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +FV     T F  M++L++P +
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFVVRQTDTIFEWMVKLAAPVI 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ ++  S P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNVFVFSQPLKSALAVLMMVLFLP-VVYASLHALL 249


>gi|308048764|ref|YP_003912330.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
 gi|307630954|gb|ADN75256.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
          Length = 261

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 105/232 (45%), Gaps = 23/232 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           R+ + IM++  +  S +P +VRL  ++  +  + P L     ++      +   ++ V++
Sbjct: 21  RISAMIMVMVTIGGSSVPARVRLLLSVMITAAVAPILPAPPPVELLSAEGFLISAQQVVI 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS----LIG-- 129
            + +G V  L++  + L  Q  G          +QTS+G +  +   P N     L+G  
Sbjct: 81  GIAIGFVSVLVLNTFVLAGQIIG----------MQTSLGFASMV--DPSNGQQVPLVGQF 128

Query: 130 --IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L  + +D H  +   LV S+ T+PIG+ L+   +  + V      F   L LS 
Sbjct: 129 YLLLSTLLFFGVDGHLLMIRMLVASFETLPIGEGLSPSGL-DAIVKFGGLMFASALTLSL 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
                 ++ N S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F
Sbjct: 188 SAATALLLINFSFGVMTRAAPQLNIFAIGFPITMLSGLLILWLTLGGVLSHF 239


>gi|283832655|ref|ZP_06352396.1| flagellar biosynthetic protein FliR [Citrobacter youngae ATCC
           29220]
 gi|291072329|gb|EFE10438.1| flagellar biosynthetic protein FliR [Citrobacter youngae ATCC
           29220]
          Length = 261

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 96/212 (45%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P LS   IP +V+L   +  +IV+ P +    D+  F   A +   
Sbjct: 17  FWPLLRILALISTAPILSERAIPKRVKLGLGVIITIVIAPSI-PPADVPIFSIGALWQA- 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G +I   +GL+  T       L    L  LI ++ 
Sbjct: 75  -MQQILIGIALGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLARLIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGGNPVNSNAFLALARAGSLIFINGLMLALPVMTL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|149178712|ref|ZP_01857295.1| flagellar biosynthetic protein fliR/B [Planctomyces maris DSM 8797]
 gi|148842410|gb|EDL56790.1| flagellar biosynthetic protein fliR/B [Planctomyces maris DSM 8797]
          Length = 329

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 57  TIDLQNFVNRA-----YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNL-- 109
           T++   FV R       Y+  ++ EL LG   GL I +  L LQ  G +I    G+ L  
Sbjct: 122 TVNDYRFVTRMPNSLLDYAWSILGELTLGFSLGLGIYIILLSLQMAGQMIDQQAGMALGE 181

Query: 110 --QTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNI 167
                  ++ SL+   L   IGI   L +  ++ H  +  +L+ ++   P+G+ +   N 
Sbjct: 182 VFNPGFDMNASLSGQYL-YFIGISVFLLMEPVNGHLLMLSSLIDTFQVFPVGEGIVSTNT 240

Query: 168 FSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
                 ++  + ++ +++++P L    + +IS+G L   VPQI +  I  P
Sbjct: 241 LDLLQTLMHQSLVLSIKVAAPLLAISALISISMGYLGHTVPQINVLVIGFP 291


>gi|157145256|ref|YP_001452575.1| flagellar biosynthesis protein FliR [Citrobacter koseri ATCC
           BAA-895]
 gi|157082461|gb|ABV12139.1| hypothetical protein CKO_00993 [Citrobacter koseri ATCC BAA-895]
          Length = 264

 Score = 42.7 bits (99), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 104/231 (45%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L      ++++ P L    ++  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERTVPKRVKLGLGFMITLIIAPSL-PANNVPVFSTEALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AMQQIMIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSRLNMPVLARILDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG +    N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGGDPVNSNAFLALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+S+GLLN++ PQ+ ++ I  P  + +G L +   + +I     H F
Sbjct: 194 LLTLNLSLGLLNRMAPQLSVFVIGFPLTLSVGILLITALMPLIAPFCEHLF 244


>gi|221209599|ref|ZP_03582580.1| type III secretion apparatus protein SpaR/YscT/HrcT [Burkholderia
           multivorans CGD1]
 gi|221170287|gb|EEE02753.1| type III secretion apparatus protein SpaR/YscT/HrcT [Burkholderia
           multivorans CGD1]
          Length = 270

 Score = 42.7 bits (99), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSFV-NMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +FV     T F  M++L++P +
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFVVRQTDTIFEWMVKLAAPVI 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ ++  S P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNVFVFSQPLKSALAVLMMVLFLP-VVYASLHALL 249


>gi|331005444|ref|ZP_08328823.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC1989]
 gi|330420720|gb|EGG95007.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC1989]
          Length = 255

 Score = 42.7 bits (99), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 41/223 (18%), Positives = 99/223 (44%), Gaps = 9/223 (4%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ---NFVNRAYYS 70
           L+  R  +  ++ P  S++ +P ++++   +  S +L+     +++LQ     +N A   
Sbjct: 15  LVFIRCSALFLMSPLFSIARVPTRIKVFLLIIISAILV----SSLNLQLPDTSINSAQLV 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
                EL +G      I          G ++   +G  + + +  S +     + +L+ +
Sbjct: 71  YYAFGELVIGAAMAFGIFAAFASFSLGGRILDFQMGFGVASLIDPSTNAQAPMIGTLLKM 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + ++  +++D HH +   +  +    P G               L   + +ML  ++P +
Sbjct: 131 LAVMIFFLVDGHHLLIRGIAYTLAHYPPGTMPKIDIQIIIKQFGLMFVYGVML--AAPVI 188

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIE 233
           F  ++ +IS+G+  + +PQ+ ++ +  P  IG+G   L LS++
Sbjct: 189 FIILLIDISMGIAARTMPQVNMFIVMLPLKIGVGLFVLMLSLQ 231


>gi|221200563|ref|ZP_03573605.1| type III secretion apparatus protein SpaR/YscT/HrcT [Burkholderia
           multivorans CGD2M]
 gi|221209220|ref|ZP_03582211.1| type III secretion apparatus protein SpaR/YscT/HrcT [Burkholderia
           multivorans CGD2]
 gi|221170910|gb|EEE03366.1| type III secretion apparatus protein SpaR/YscT/HrcT [Burkholderia
           multivorans CGD2]
 gi|221179904|gb|EEE12309.1| type III secretion apparatus protein SpaR/YscT/HrcT [Burkholderia
           multivorans CGD2M]
          Length = 270

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSFV-NMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +FV     T F  M++L++P +
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFVVRQTDTIFEWMVKLAAPVI 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ ++  S P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNVFVFSQPLKSALAVLMMVLFLP-VVYASLHALL 249


>gi|320085401|emb|CBY95182.1| Flagellar biosynthetic protein fliR [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 290

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 43  FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 99

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 100 AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 159

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 160 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 219

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 220 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 270


>gi|257457601|ref|ZP_05622768.1| flagellar biosynthetic protein FliR [Treponema vincentii ATCC
           35580]
 gi|257444987|gb|EEV20063.1| flagellar biosynthetic protein FliR [Treponema vincentii ATCC
           35580]
          Length = 266

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 98/212 (46%), Gaps = 14/212 (6%)

Query: 7   IIMMSLFLIVC-RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFV 64
           ++   LF +VC R+ + I   P LS   +P   ++  A     +++P  + + +D+Q F 
Sbjct: 10  LVKAPLFFLVCVRIFAMISTTPLLSTRAVPRIAKISLAGLIGFLVMPVAYGSPLDVQGF- 68

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
               Y+ LV+ E  LG + G  I +        G   S  +G  +     + D+LA+   
Sbjct: 69  -NLDYALLVVGEALLGVLTGFFISIIFASFSTAGQFFSYQMGFGVSE---VYDALAQIE- 123

Query: 125 NSLIG-----IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSF-VNMLQTT 178
           N L+G     I  L+ L +  F       +++S+ +I     L    + +SF V  L + 
Sbjct: 124 NPLMGQFLNFIAVLIFLQIKGFQTLFLGGVLRSFQSINCFMFLEKRELVASFLVTNLGSL 183

Query: 179 FMIMLRLSSPFLFFYIVFNISIGLLNKLVPQI 210
           F+  + ++ P +    + ++S+GLL+K  PQ+
Sbjct: 184 FLNAMMIAMPVMGTLFLVHVSMGLLSKAAPQM 215


>gi|161520298|ref|YP_001583725.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia multivorans
           ATCC 17616]
 gi|189353523|ref|YP_001949150.1| type III secretion protein SctT [Burkholderia multivorans ATCC
           17616]
 gi|160344348|gb|ABX17433.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia multivorans
           ATCC 17616]
 gi|189337545|dbj|BAG46614.1| type III secretion protein SctT [Burkholderia multivorans ATCC
           17616]
          Length = 270

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSFV-NMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +FV     T F  M++L++P +
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFVVRQTDTIFEWMVKLAAPVI 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ ++  S P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNVFVFSQPLKSALAVLMMVLFLP-VVYASLHALL 249


>gi|107025877|ref|YP_623388.1| Type III secretion protein SpaR/YscT [Burkholderia cenocepacia AU
           1054]
 gi|116692939|ref|YP_838472.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia cenocepacia
           HI2424]
 gi|105895251|gb|ABF78415.1| Type III secretion protein SpaR/YscT [Burkholderia cenocepacia AU
           1054]
 gi|116650939|gb|ABK11579.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia cenocepacia
           HI2424]
          Length = 269

 Score = 42.7 bits (99), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSF-VNMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +F V    T F  M++L++P  
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFIVRQTDTIFEWMVKLAAPVT 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + +GL+ + VPQ+ I+  S P    L  L + L +  +VY   HS L
Sbjct: 197 IVLVLVELGVGLVGRAVPQLNIFVFSQPLKSALAVLMMILFLP-VVYASLHSLL 249


>gi|197250835|ref|YP_002146042.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|200389554|ref|ZP_03216165.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|197214538|gb|ACH51935.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|199601999|gb|EDZ00545.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 264

 Score = 42.7 bits (99), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRILALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|330940693|gb|EGH43705.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 143

 Score = 42.7 bits (99), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 1/103 (0%)

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  V   LV+S+ T+P+G  L   N F    N L       +RL  P +   ++ N
Sbjct: 25  AMNGHLVVLEILVESFTTMPVGSGLLVNN-FWELANGLGWVLASGMRLVLPAITALLIIN 83

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I+ G++ +  PQ+ I+ I  P  + +G + L +++  I+ Q+ 
Sbjct: 84  IAFGVMTRAAPQLNIFSIGFPLTLVMGMVILWMTMGDILNQYQ 126


>gi|303247999|ref|ZP_07334265.1| flagellar biosynthetic protein FliR [Desulfovibrio fructosovorans
           JJ]
 gi|302490556|gb|EFL50461.1| flagellar biosynthetic protein FliR [Desulfovibrio fructosovorans
           JJ]
          Length = 259

 Score = 42.4 bits (98), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 103/220 (46%), Gaps = 1/220 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L + R+   + LLP    + +P  V+  F +  ++ + P L     +    N    S
Sbjct: 13  SFVLTLMRISLVVFLLPFFGANLLPNMVKAAFCLMLTLAVFPMLSFPGTMMP-ANVWSLS 71

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            +++ E+ +G +  +L+      +Q  G+++  ++G +L  SM      +E+ L  L+  
Sbjct: 72  LMLLGEVVMGLLLNILVLFLFAAVQCAGAIMGFSMGFSLMNSMDPLTGASESGLGHLMSQ 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  +    ++ H  +   L +S+  +P G  L    +    +      F++ L++++P +
Sbjct: 132 VTTMLFLSLNGHLVLLGGLAQSFKLVPPGGLLISPALGEHLIVFSGQMFVMALKIAAPIM 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
               + ++++ L+ +  PQ+ + FI  P  IG+G LF+ L
Sbjct: 192 ASIFLVDLALALVARAAPQMNVLFIGFPLKIGVGFLFMTL 231


>gi|88813213|ref|ZP_01128453.1| Flagellar biosynthesis pathway, component FliR [Nitrococcus mobilis
           Nb-231]
 gi|88789535|gb|EAR20662.1| Flagellar biosynthesis pathway, component FliR [Nitrococcus mobilis
           Nb-231]
          Length = 258

 Score = 42.4 bits (98), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 39/201 (19%), Positives = 88/201 (43%), Gaps = 2/201 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + ++  P  S   IP+++R+   +  ++ +LP + +   L           +   ++
Sbjct: 21  RVSAVLLTAPLFSNILIPVRLRVLLGVGLTVAVLPAVGNVPQLDPLSPEGVL--VAGQQV 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   GLL+ +    +   G  +S  +GL   T +     ++ + ++  + I+ +L   
Sbjct: 79  LIGAAIGLLLAMAFQAVAIAGETLSITMGLGFATMISPQTGVSSSVISQFLLILAMLLFL 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            +  H  +   L +S+ T+PI      G    + V      F   + L+ P +   ++ N
Sbjct: 139 AVGAHLMLIQLLAESFRTLPIAASGLGGQDVYALVGWAGEMFAGGVLLALPAVAVLLIVN 198

Query: 198 ISIGLLNKLVPQIPIYFISTP 218
           + IG++ +  PQ+ I+ +  P
Sbjct: 199 LIIGVMTRTAPQMNIFSVGLP 219


>gi|115358969|ref|YP_776107.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           AMMD]
 gi|170702399|ref|ZP_02893288.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           IOP40-10]
 gi|171322218|ref|ZP_02911065.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           MEX-5]
 gi|172063761|ref|YP_001811412.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           MC40-6]
 gi|115284257|gb|ABI89773.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           AMMD]
 gi|170132693|gb|EDT01132.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           IOP40-10]
 gi|171092455|gb|EDT37800.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           MEX-5]
 gi|171996278|gb|ACB67196.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia ambifaria
           MC40-6]
          Length = 269

 Score = 42.4 bits (98), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSFV-NMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +FV     T F  M++L++P +
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLETFVVRQTDTIFEWMVKLAAPVI 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ I+  + P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNIFVFAQPVKSALAVLMMVLFLP-VVYASLHALL 249


>gi|294636882|ref|ZP_06715212.1| flagellar biosynthetic protein FliR [Edwardsiella tarda ATCC 23685]
 gi|291089912|gb|EFE22473.1| flagellar biosynthetic protein FliR [Edwardsiella tarda ATCC 23685]
          Length = 261

 Score = 42.4 bits (98), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 99/216 (45%), Gaps = 5/216 (2%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYYSKLVMVELFLGCVHGL 85
           P L    IP +VR+  A   + ++ P L  T I L +    A +  L + ++ +GC  GL
Sbjct: 31  PLLGEKAIPRKVRIALAALTAFLIAPQLPPTTITLAS--GGALW--LAIQQILIGCAIGL 86

Query: 86  LIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQV 145
            +++    ++  G VI   +GL+  T    S       L  L+ ++ LL     + H  +
Sbjct: 87  TMQLAFAAVRLAGEVIGMQMGLSFATFFDPSGGPNMPVLARLLNLLMLLLFLCFNGHLWI 146

Query: 146 FYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNK 205
              L  S+ T+P+      GN F +        F+  + L+ P +   +  N+++GLLN+
Sbjct: 147 ISLLADSFHTLPLSTAPLAGNGFLALAQSGHLIFLNGMMLALPLITLLLTLNMALGLLNR 206

Query: 206 LVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + PQ+ I+ +  P  + +G L L + I ++     H
Sbjct: 207 MTPQLSIFVVGFPLTLTIGMLTLGMLIPMLAPFTEH 242


>gi|220934506|ref|YP_002513405.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995816|gb|ACL72418.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. HL-EbGR7]
          Length = 257

 Score = 42.4 bits (98), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 109/233 (46%), Gaps = 8/233 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R+ + ++  P      + ++VRL  A   ++V+ P     I L   V     + LV+   
Sbjct: 21  RISAMLLAAPLYGAGTVTVRVRLAIAFILALVVAPL----IPLPPAVEPLSLAGLVVSVQ 76

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLL 134
           ++ +G   G ++++    L   G  I+ ++GL    SM    S  + P+ +S   I+  L
Sbjct: 77  QILIGLTIGFVLQMVFAALTQAGEAIALSMGLGF-ASMVDPQSGVQVPVVSSYFVIMSTL 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               ++ H  +    + S+  +P+G E        + V+   T F+  L ++ P +   +
Sbjct: 136 LFLALNGHVALIELTLLSFQALPVGVEGVTREGLWALVSWGSTMFLYALLVALPAVASML 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           + N+S+G++ +  PQ+ I+ +  P +I LG + L L+  +++ +F+     GF
Sbjct: 196 LVNLSMGVITRAAPQLNIFAVGFPMMIMLGFILLLLTTPVLLPKFTELLASGF 248


>gi|330809226|ref|YP_004353688.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377334|gb|AEA68684.1| Flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 247

 Score = 42.4 bits (98), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 105/232 (45%), Gaps = 21/232 (9%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+   +++ P L  S IP+ VRL  A+A S VL+     ++ L +     +   +V
Sbjct: 11  LVSVRLIPLVVVSPILFFSRIPLTVRLILALALSGVLV----GSMTLTH--APVFTLPVV 64

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + EL LG +          G+   G +I T IGLN   + G+ D       +++ G++  
Sbjct: 65  LGELLLGVLMAFGFHAAHAGVDMAGKLIDTQIGLN---AAGVFDPGT----SNMTGLMAE 117

Query: 134 LALW-------VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L +W       V++ HH +     +    +P G         S    M Q  F++   + 
Sbjct: 118 LLVWSLGALFVVLNLHHDLLRVFAQLLVAVPPGSVSLSTLSVSLATVMTQQ-FLLAFMIV 176

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
            P +    + +++   L++ +PQ  +YF+S P  +G+G     L++ +IV +
Sbjct: 177 VPVILGLWLIDVAFAFLSRSMPQANVYFLSLPLKLGVGMFIFILTLPMIVQR 228


>gi|290475716|ref|YP_003468605.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           bovienii SS-2004]
 gi|289175038|emb|CBJ81841.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           bovienii SS-2004]
          Length = 260

 Score = 42.4 bits (98), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 97/207 (46%), Gaps = 9/207 (4%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P  S    P++VR+  A+A + +L+P   +    Q  V       +++ ++ +G   GL 
Sbjct: 31  PIFSEKQTPIKVRMSLALAITFLLVP---NIPSPQIPVFSVAGVWVMIQQVLIGVALGLT 87

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           +++    ++  G ++   +GL+  T    +       L  ++ ++ +L    +D H  + 
Sbjct: 88  MQIAFAAIRHAGEILGLQMGLSFATFFDPTGGPNMPILARILNLLMMLMFLALDGHLWLL 147

Query: 147 YALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR---LSSPFLFFYIVFNISIGLL 203
             L  ++ +IPI Q +        F+ + Q+  +I +    L+ P +   +V N ++G+L
Sbjct: 148 SILAGTFDSIPI-QPMQLNP--KGFLLLAQSAHLIFINGMMLAMPLITLLLVLNFALGML 204

Query: 204 NKLVPQIPIYFISTPYLIGLGSLFLCL 230
           N++ PQ+ ++ I  P  + +G   L L
Sbjct: 205 NRMTPQLSVFVIGFPLTLTVGIFTLSL 231


>gi|222824090|ref|YP_002575664.1| flagellar biosynthesis protein FliR [Campylobacter lari RM2100]
 gi|222539312|gb|ACM64413.1| flagellar biosynthesis protein FliR [Campylobacter lari RM2100]
          Length = 256

 Score = 42.0 bits (97), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 107/227 (47%), Gaps = 7/227 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+   I+  P  S + IP+ V+   A+  ++    FL+    L+N    +++   +
Sbjct: 17  LLFARMSGLIVFFPFFSHNSIPLVVKTTLALFLTM----FLYPLAKLENNTPDSFFILYL 72

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIG 132
           + E+  G V GL++++    LQ  G  IS  +G ++ + +  +   A TP ++ ++ ++ 
Sbjct: 73  LSEVLFGMVAGLILQMIFAILQMAGEQISFTMGFSMASILDPATG-ANTPVISQVLNLLA 131

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     D HH +   +  S   I +G      N+       +   F++   ++ P L  
Sbjct: 132 LLVFLAFDGHHLILLFISNSLEYISLGGFYPHENLMLYLNKAMVNIFVLGFSMAFPILAI 191

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            ++ ++  G+L K +PQ  +  +  P  I L S  + ++I +I+ Q+
Sbjct: 192 SLLSDVIFGMLMKTMPQFNLLVVGYPIKIFL-SFAVLIAILLIMMQY 237


>gi|253681513|ref|ZP_04862310.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
 gi|253561225|gb|EES90677.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
          Length = 610

 Score = 42.0 bits (97), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 107/229 (46%), Gaps = 7/229 (3%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           + +FLI  R+ S + ++P       P  V++ F +  S +++P     ID  N  N    
Sbjct: 8   LGIFLISLRMFSFVEVVPIFFPKGTPNVVKIMFTVILSFMIIP----GIDYSNISNINGN 63

Query: 70  SKLVM---VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +L+M   +E+  G   G +  +    +++ G+ +   +G  + T    + +   T +  
Sbjct: 64  LQLIMYCLIEITTGLTFGFITNICFSCIRYAGAFMDLQVGFAMITMFDPNSNSNVTLIER 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+    L+   ++D    +    ++S+  I IG+ +   N     +N+    F + +R++
Sbjct: 124 LLYWFSLIVFIIVDGPRMIIKIFIESFNVIHIGKFILNQNSAMHVINVFVKYFQLGIRIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            P +   I+ ++++GL+ K VPQ+ I  +  P  I LG   + LS+ +I
Sbjct: 184 IPIVLIIILTDLTMGLVAKTVPQLNIMILGMPVKIILGLSVIALSLPVI 232


>gi|325527470|gb|EGD04804.1| type III secretion protein SpaR/YscT/HrcT [Burkholderia sp. TJI49]
          Length = 269

 Score = 42.0 bits (97), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSF-VNMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +F V    T F  M++L++P  
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFIVRQTDTIFEWMVKLAAPVT 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + IGL+ + VPQ+ I+  + P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGIGLVGRAVPQLNIFVFAQPVKSALAVLMMALFLP-VVYASLHALL 249


>gi|32490797|ref|NP_871051.1| hypothetical protein WGLp048 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166003|dbj|BAC24194.1| fliR [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 258

 Score = 42.0 bits (97), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 73/165 (44%), Gaps = 11/165 (6%)

Query: 93  GLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKS 152
            ++F+G +I   +GL+               ++    +I +L     D H  V   L  S
Sbjct: 96  SIKFSGELIGLQMGLSFAVFFDHISGPNSPIISRFFNLILILIFLSFDAHLTVLDILFNS 155

Query: 153 YGTIPIGQELNFGN-IFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIP 211
           +  IPIG    F + IF S +N     F   L LS P +   +  NI  G+LN+  PQ  
Sbjct: 156 FKLIPIGINFKFNDEIFFSIINFSGIIFANGLFLSIPSITMLLSLNILFGILNRFTPQFS 215

Query: 212 IYFI--STPYLIGLGSLFLC------LSIEIIVYQFSHSFLYGFF 248
           I+ I  S   LIGL S+++       LS ++I   F +  +Y FF
Sbjct: 216 IFVIGFSLTLLIGLLSIYIILNNFQKLSTDLIFNTFKY--IYNFF 258


>gi|91223203|ref|ZP_01258469.1| putative flagellar biosynthetic protein FliR [Vibrio alginolyticus
           12G01]
 gi|91192016|gb|EAS78279.1| putative flagellar biosynthetic protein FliR [Vibrio alginolyticus
           12G01]
          Length = 258

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 98/216 (45%), Gaps = 5/216 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RVG+  + +P    + IP+ VR   A++  ++  P +     ++ F   + +  L   + 
Sbjct: 21  RVGAVFISMPFFGDAIIPVWVRTLLALSIVVITGPLMPPMPQVELFSMTSLF--LAFEQA 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G + GL++ +        G VIS  +GL +       + L+   L  +  I   L   
Sbjct: 79  IWGVMFGLILHMLFNVFTMLGQVISLQMGLGMAMMNDPINGLSVAILGRIFLIFSTLLFL 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  V   +++S+   P+G  +   ++    VN+    F   L L+ P +   ++ N
Sbjct: 139 ALEGHLLVIDIVIQSFVVWPVGSGITSLSL-QGVVNIFGWMFASSLALALPAIVSMLLAN 197

Query: 198 ISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
           IS G++N+  P + +Y +  P   L+GL S+ + +S
Sbjct: 198 ISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVS 233


>gi|300722652|ref|YP_003711942.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629159|emb|CBJ89755.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           nematophila ATCC 19061]
          Length = 260

 Score = 42.0 bits (97), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 110/227 (48%), Gaps = 11/227 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ +   + P  S   +P++VR+  A+  + +L+P +  +  +  F     +  +
Sbjct: 17  FWPLVRLLALFSIAPIFSEKQMPIKVRIGLALVITALLVPSI-PSPHIPIFSIAGIW--V 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           ++ ++ +G   GL I++    ++  G ++   +GL+  T    +       L+ ++ ++ 
Sbjct: 74  LIQQILIGVALGLTIQIAFAVVRHAGEILGLQMGLSFATFFDPTGGPNMPILSRILNMLM 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLR---LSSP 188
           +L     D H  +   LV ++ TIPI   +LN       F+ + Q+  MI +    L+ P
Sbjct: 134 MLLFLAFDGHLWLLSILVDTFHTIPIQVTQLNP----KGFLLLAQSASMIFVNGMMLAMP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            +   ++ N ++G+LN++ PQ+ ++ +  P  + +G   L L I ++
Sbjct: 190 MITLLLILNFALGMLNRMTPQLSVFVVGFPLTLTVGIFTLSLLIPML 236


>gi|253688964|ref|YP_003018154.1| flagellar biosynthetic protein FliR [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755542|gb|ACT13618.1| flagellar biosynthetic protein FliR [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 261

 Score = 42.0 bits (97), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 77/172 (44%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   + I+
Sbjct: 73  LLIQQVLIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVIARFLNIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L     D H  +   L  S+ T+PI       + F +        F+  L L+ P + 
Sbjct: 133 AILLFLTFDGHLWMISLLADSFYTLPISTNPINSHAFLALARAGGLIFINGLMLALPIIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             +  N+++G+LN++ PQ+ I+ +  P  + +G + L L I +I     H F
Sbjct: 193 LLLTINLALGMLNRVAPQLSIFVVGFPITLTVGIMTLGLLIPLIPPFAEHLF 244


>gi|206563887|ref|YP_002234650.1| type III secretion system protein [Burkholderia cenocepacia J2315]
 gi|18092676|gb|AAL59405.1| BcscT [Burkholderia cenocepacia]
 gi|28394257|gb|AAO31732.1| BcscT [Burkholderia cenocepacia]
 gi|198039927|emb|CAR55905.1| type III secretion system protein [Burkholderia cenocepacia J2315]
          Length = 269

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 134 LALWVIDFHHQVFYAL-VKSYGTIPIGQ-ELNFGNIFSSF-VNMLQTTFMIMLRLSSPFL 190
           +AL+V     QV   L  +SY   PIG    +F ++  +F V    T F  M++L++P  
Sbjct: 137 IALFVTAGGLQVLVQLFAQSYAWWPIGSLGPDFSSMLQTFIVRQTDTIFEWMVKLAAPVT 196

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
              ++  + +GL+ + VPQ+ I+  S P    L  L + L +  +VY   H+ L
Sbjct: 197 IVLVLVELGVGLVGRAVPQLNIFVFSQPLKSALAMLMMILFLP-VVYASLHALL 249


>gi|167572949|ref|ZP_02365823.1| type III secretion system EscT protein [Burkholderia oklahomensis
           C6786]
          Length = 260

 Score = 42.0 bits (97), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +Y  L + EL +G + G    +    L   G +I TA G ++ + +        +P   +
Sbjct: 69  HYLWLALGELCVGALIGFCAAIPFWALDMAGFLIDTARGASMASVLNPLLGAQSSPFGMV 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTTFMIMLRLS 186
              +  L   V    + +   +  SY T+P G  L FG +  +         + + LR +
Sbjct: 129 FSQVFTLLFLVSGGFNTLIETIYASYVTLPPGAPLRFGPDALALLTQQWHLMYELCLRFA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            P L   ++ ++++GL+N+   Q+ ++F+S P
Sbjct: 189 MPALAAILLVDMALGLVNRSAQQLNVFFLSMP 220


>gi|326622853|gb|EGE29198.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 245

 Score = 42.0 bits (97), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 101/226 (44%), Gaps = 3/226 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L M ++
Sbjct: 3   RVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN-DTPLFSIAALW--LTMQQI 59

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ +L   
Sbjct: 60  LIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFL 119

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
             + H  +   LV ++ T+PIG      N F +        F+  L L+ P +   +  N
Sbjct: 120 TFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLN 179

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 180 LALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 225


>gi|77165625|ref|YP_344150.1| flagellar biosynthesis protein FliR [Nitrosococcus oceani ATCC
           19707]
 gi|76883939|gb|ABA58620.1| Flagellar biosynthesis protein FliR [Nitrosococcus oceani ATCC
           19707]
          Length = 236

 Score = 42.0 bits (97), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 94/205 (45%), Gaps = 11/205 (5%)

Query: 24  MLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVH 83
           M +P      +P+++RL  A+A ++V+ P +  T      V       LVM +  +G   
Sbjct: 1   MAMPLFGSKVVPVRIRLVLALALTVVIAPVIPATSVAALSVEGGL---LVMQQFLIGFAM 57

Query: 84  GLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            L++++        G +++T +GL   + M   + +A + ++ L  ++  L    ++ H 
Sbjct: 58  ALVLQMVFQAFAIGGQIVATQMGLGFASLMDPQNGVAVSMVSQLYTVLITLVFLGLNGHL 117

Query: 144 QVFYALVKSYGTIPIGQEL----NFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
            V   L +S+  +P+G E      F  +  +   ML  + +I L    P +    + N++
Sbjct: 118 VVIQVLAESFYVLPLGVERASLGGFWQLAGAGSWMLAGSVLIAL----PAIGALSLVNLT 173

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLG 224
            G++++  PQ+  + I  P  + LG
Sbjct: 174 FGVMSRAAPQLNPFSIGFPLTLILG 198


>gi|212634379|ref|YP_002310904.1| flagellar biosynthesis protein FliR [Shewanella piezotolerans WP3]
 gi|212555863|gb|ACJ28317.1| Flagellar biosynthetic protein FliR [Shewanella piezotolerans WP3]
          Length = 266

 Score = 41.6 bits (96), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 107/236 (45%), Gaps = 24/236 (10%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS--KLVM 74
            R+ S  M++     +  P +VRL  ++  +  ++P L    D++ F   A +   + ++
Sbjct: 20  TRISSMFMVMAVFGANTTPSRVRLLLSLTVTAAVVPVLPPMPDIELFSLSAVFVTFQQII 79

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETPL-NSLI 128
           + + +G    LL++ + L    TG +I       +QTS+G +      S  +TP+  +  
Sbjct: 80  IGVSMGFSTLLLMQTFVL----TGQII------GMQTSLGFASMIDPGSGQQTPVVANFF 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE---LNFGNIFSSFVNMLQTTFMIMLRL 185
            ++  +    +D H  +   +V S+ +IP+  E   L    +F+ FV  +   F   L +
Sbjct: 130 LLLTTMIFLAVDGHLILIKMVVASFDSIPVSMEGLSLASYRMFTEFVGYM---FGAALTM 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           S   +   +  N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F  
Sbjct: 187 SLSAIVALLTINLSFGVMTRASPQLNIFAIGFPVTMVSGLFILWLTLTPIMAHFDE 242


>gi|89075525|ref|ZP_01161936.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|89048797|gb|EAR54368.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
          Length = 260

 Score = 41.6 bits (96), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 105/239 (43%), Gaps = 44/239 (18%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD---TIDLQNFVNRAYYSKLV 73
            R+ S +M +      ++  ++RL  A+A +  +LP L      I+L +       ++ +
Sbjct: 20  TRISSMVMAMTFFGARFVSPKIRLYLALAITFAVLPVLPKVPQDIELLSLAGFIVTTQQL 79

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETP-LNSL 127
           ++ + +G V   + +++ L  Q  G          +Q+S+G +  +       TP L   
Sbjct: 80  IIGVAMGLVTQFITQIFVLLGQILG----------MQSSLGFASMVDPANGQNTPVLGQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-----------NFGNIFSSFVNMLQ 176
              + +L     D H ++  A+V S+ T+PIG+ +            FG++F + VNM  
Sbjct: 130 YMFLAILLFLATDGHLEMLNAVVVSFKTLPIGEAMLQPKDYYQLAGWFGHMFKAGVNMAL 189

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG---SLFLCLSI 232
              + +L +           N+S G++ +  PQ+ I+ +   + + LG   S F+ L I
Sbjct: 190 AGVIALLTV-----------NLSFGVMTRAAPQLNIFSLGFSFALLLGLAISWFIVLGI 237


>gi|193222345|emb|CAL62040.2| Flagellar biosynthetic protein FliR [Herminiimonas arsenicoxydans]
          Length = 263

 Score = 41.6 bits (96), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%)

Query: 80  GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVI 139
           G   G  +R+   G++  G +    +GL   +          + ++  + ++ L+     
Sbjct: 82  GLTMGFAMRIVFAGVEMAGEITGMTMGLGFASFFDPQTRARSSAISQFLALLILMIYLST 141

Query: 140 DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
           + H  V   L +S+  +PI         F   V      F   ++LS P +   ++ NI+
Sbjct: 142 NLHLVVLSTLAQSFELLPISSNFVSTEGFFQVVKWGGRIFSAGVQLSLPMVAALLMTNIA 201

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLG 224
           +G+L +  PQ+ I+ I  P  IG+G
Sbjct: 202 LGILTRAAPQLNIFGIGFPITIGVG 226


>gi|134095089|ref|YP_001100164.1| flagellar biosynthetic protein fliR [Herminiimonas arsenicoxydans]
          Length = 222

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%)

Query: 80  GCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVI 139
           G   G  +R+   G++  G +    +GL   +          + ++  + ++ L+     
Sbjct: 41  GLTMGFAMRIVFAGVEMAGEITGMTMGLGFASFFDPQTRARSSAISQFLALLILMIYLST 100

Query: 140 DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
           + H  V   L +S+  +PI         F   V      F   ++LS P +   ++ NI+
Sbjct: 101 NLHLVVLSTLAQSFELLPISSNFVSTEGFFQVVKWGGRIFSAGVQLSLPMVAALLMTNIA 160

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLG 224
           +G+L +  PQ+ I+ I  P  IG+G
Sbjct: 161 LGILTRAAPQLNIFGIGFPITIGVG 185


>gi|157961201|ref|YP_001501235.1| flagellar biosynthesis protein FliR [Shewanella pealeana ATCC
           700345]
 gi|157846201|gb|ABV86700.1| flagellar biosynthetic protein FliR [Shewanella pealeana ATCC
           700345]
          Length = 266

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 105/236 (44%), Gaps = 24/236 (10%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVM 74
            R+ S  M++     +  P +VRL  ++  +  + P L     IDL +       ++ ++
Sbjct: 20  TRISSMFMVMAVFGATTTPTRVRLLLSVTVTAAVAPVLPAMPNIDLFSLSAAFVTAQQII 79

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETPL-NSLI 128
           + + +G    LL++ + L    TG +I       +QTS+G +      S  +TP+  +  
Sbjct: 80  IGVAMGFATLLLMQTFVL----TGQII------GMQTSLGFASMVDPSSGQQTPVVGNFF 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPI---GQELNFGNIFSSFVNMLQTTFMIMLRL 185
            ++  +    +D H  +   ++ S+ +IP+   G  L    +F+ FV  +   F   L +
Sbjct: 130 LLLTTMIFLAVDGHLLLIKMVIASFESIPVSMQGLSLASYRLFTEFVGYM---FGAALTM 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           S   +   +  N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F  
Sbjct: 187 SLSAIVALLTINLSFGVMTRASPQLNIFAIGFPVTMVAGLFILWLTLSPIMSHFDE 242


>gi|269967108|ref|ZP_06181175.1| flagellar biosynthetic protein FliR [Vibrio alginolyticus 40B]
 gi|269828245|gb|EEZ82512.1| flagellar biosynthetic protein FliR [Vibrio alginolyticus 40B]
          Length = 254

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 98/216 (45%), Gaps = 5/216 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           RVG+  + +P    + IP+ VR   A++  ++  P +     ++ F   + +  L   + 
Sbjct: 17  RVGAVFISMPFFGDAIIPVWVRTLLALSIVVITGPLMPPMPQVELFSMTSLF--LAFEQA 74

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
             G + GL++ +        G VIS  +GL +       + L+   L  +  I   L   
Sbjct: 75  IWGVMFGLILHMLFNVFTMLGQVISLQMGLGMAMMNDPINGLSVAILGRIFLIFSTLLFL 134

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
            ++ H  V   +++S+   P+G  +   ++    VN+    F   L L+ P +   ++ N
Sbjct: 135 ALEGHLLVIDIVIQSFVVWPVGSGITSLSL-QGVVNIFGWMFASSLALALPAIVSMLLAN 193

Query: 198 ISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
           IS G++N+  P + +Y +  P   L+GL S+ + +S
Sbjct: 194 ISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVS 229


>gi|51894125|ref|YP_076816.1| flagellar biosynthetic protein [Symbiobacterium thermophilum IAM
           14863]
 gi|51857814|dbj|BAD41972.1| flagellar biosynthetic protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 259

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 86/201 (42%), Gaps = 13/201 (6%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ-NFVNRAYYSKLVMVELFLGCVHGL 85
           P  S  ++P QVR+    A S VL  FL   I++        +     +VE+ +G V G 
Sbjct: 26  PVFSTRFVPFQVRV----ALSFVLGFFLMPAIEVAPGRTEGVHLLTAALVEMVVGLVIGF 81

Query: 86  LIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQV 145
           L  +    LQ  G+++   +G  L            T L +L     L+    +D HH +
Sbjct: 82  LCLMVISVLQIAGALMDLEMGFALAGLFDPITGQGATVLGNLFQTTALVFFIALDGHHWL 141

Query: 146 FYALVKSYGTIPIGQELNFGNIFSSFVNML-QTTFMIMLRLSSPFLFFYIVFNISIGLLN 204
             A  +SY  +P G  +  G     +V  L      + ++L  PF+   ++  ++  +LN
Sbjct: 142 IRAFAQSYALVPAGGPVE-GTASGLYVARLFGDLLALAVQLVLPFVAVMLLTMVAFAVLN 200

Query: 205 KLVPQIPIYFISTPYLIGLGS 225
           + V Q+ I      + IGLG+
Sbjct: 201 RAVAQLNI------FAIGLGT 215


>gi|204931027|ref|ZP_03221853.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204320071|gb|EDZ05276.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 264

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   IP +V+L   +  ++V+ P L    D   F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ 
Sbjct: 74  AIQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ P +  
Sbjct: 134 MLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|294140999|ref|YP_003556977.1| type III secretion system apparatus protein, SpaR/YscT family
           [Shewanella violacea DSS12]
 gi|293327468|dbj|BAJ02199.1| type III secretion system apparatus protein, SpaR/YscT family
           [Shewanella violacea DSS12]
          Length = 229

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 86/179 (48%), Gaps = 18/179 (10%)

Query: 51  LPFLWDTIDLQNFVNRAYYSKLVMV---ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGL 107
           LP L    D+Q  + +A    +V +   E+ +G + G    +    +   G VI T  G 
Sbjct: 16  LPTLHAMADMQEVILQADILGVVNLYGKEILVGFLLGFCAAIPFWAIDMAGFVIDTMRGA 75

Query: 108 NLQTS----MGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN 163
           ++ T     MG+  S+       ++ ++ L++     F+H +  A+ +SY  +P G ELN
Sbjct: 76  SMSTVLNPLMGLQSSIYGMLFTQVLTVLFLVS---GGFNH-LLTAMYQSYNELPPGFELN 131

Query: 164 FGNIFSSFVNMLQTTFMIMLRL----SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
                 +F N     +++M +L    + P +   I+ ++++GL+N+   Q+ ++F+S P
Sbjct: 132 LSQQLLTFFN---QEWLLMCQLCLSFAMPAMVIMILVDVALGLVNRSAQQLNVFFLSMP 187


>gi|332701285|ref|ZP_08421373.1| flagellar biosynthetic protein FliR [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332551434|gb|EGJ48478.1| flagellar biosynthetic protein FliR [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 263

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 109/236 (46%), Gaps = 19/236 (8%)

Query: 10  MSLFLIVCRVGSCIMLLP--GLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL---QNFV 64
           +S  L + R+   + ++P  G  ++ +P++  LC  +  +      LW T+     Q   
Sbjct: 12  LSFLLTLMRISLVLFIMPFFGGKVTPVPLKAALCLILTIA------LWPTLSFPGQQLPA 65

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           N      +++ E+ LG V G+++ V    +Q  GS+I   +G ++   + ++D +  T  
Sbjct: 66  NTWAIVVMLIGEITLGLVMGIVVNVLFAAVQTGGSLIGFQMGFSM---VNVADPMTGTN- 121

Query: 125 NSLIG----IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
            S+ G    ++  +   ++D H  +  AL +S+  IP G       +    + M    F+
Sbjct: 122 ESITGHFMYMVTFMTFLILDGHLLLLRALAESFQRIPPGGLYLSPALAREVLGMSSQIFV 181

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
           + +++++P +    + +++I L+ +  PQ+ I     P  I  G LFL L   I+ 
Sbjct: 182 LGIKIAAPVMVAVFLVDLAIALVGRAAPQMSILSFGFPLKIITGFLFLGLMFTIMA 237


>gi|56551545|ref|YP_162384.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56543119|gb|AAV89273.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 265

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 84/203 (41%), Gaps = 5/203 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R G+  +  P L  +  P+ VR+  A+A   V LP + D   +        ++ L +V  
Sbjct: 22  RPGAAFVAAPLLGANAFPVTVRVMLALA---VGLPSVMDAHLILPDSGLVSFTGLFLVVG 78

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G   G  +++       T  +I  A+GL   + +   +      L  +  I+G   
Sbjct: 79  EIITGIAIGFAVQIGYAAGYCTSELIGNAMGLGFASMIDPVNGSNSNVLTQIFTILGAFF 138

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  +   +V+SY T+P+G       +F          F I + ++ P  F  I+
Sbjct: 139 FLAADGHLLLIRIIVESYQTMPVGGPGLNNQLFLKLTQFAGQLFSIGMLIALPVTFSIIL 198

Query: 196 FNISIGLLNKLVPQIPIYFISTP 218
             + +G L++  P + ++ +  P
Sbjct: 199 IQVMMGFLSRTAPALNLFAVGMP 221


>gi|309779457|ref|ZP_07674218.1| flagellar biosynthetic protein FliR [Ralstonia sp. 5_7_47FAA]
 gi|308921698|gb|EFP67334.1| flagellar biosynthetic protein FliR [Ralstonia sp. 5_7_47FAA]
          Length = 264

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 85/191 (44%), Gaps = 8/191 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV + I + P  + + IP  +++ F +  ++ L P L     +   V+   Y  L   +V
Sbjct: 22  RVLAFIAIAPPFANTEIPTSIKVAFGVVITVALAPML----PVPAGVSVGSYEGLWITLV 77

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G V G  +++    +   G V+S  +GL   + +  + + +   L   + +  + A
Sbjct: 78  QVLIGLVLGFCVQLVFSAISGAGEVMSVQMGLGFASLLDPTQTESSMLLGRFLSLTAVTA 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNI-FSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               D H  + +AL  S+  +P+      GN  + +        F + LR++ P +   +
Sbjct: 138 FIAGDGHLVLLHALFDSFTALPV-SAAPLGNPGWQTLAGGGTIVFALALRIALPIIAIMM 196

Query: 195 VFNISIGLLNK 205
           + N+   +L++
Sbjct: 197 IVNLGFAVLSR 207


>gi|323491457|ref|ZP_08096641.1| flagellar biosynthesis protein FliR [Vibrio brasiliensis LMG 20546]
 gi|323314326|gb|EGA67406.1| flagellar biosynthesis protein FliR [Vibrio brasiliensis LMG 20546]
          Length = 260

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 98/221 (44%), Gaps = 20/221 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW---DTIDLQNFVNRAYYSKLVM 74
           R+ + +M++      ++  +VRL   +A +  ++P L    DTI+L +F       + ++
Sbjct: 21  RIAAMLMVMSVTGARFVFTRVRLYLGLAITFAVMPALPAVPDTIELVSFAGFMTLLEQII 80

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETPL-NSLI 128
           + + +G V   +I+ + +  Q  G          +Q+S+G +  +       TPL   L 
Sbjct: 81  IGVAMGTVTQFMIQTFVILGQILG----------MQSSLGFASMVDPANGQNTPLLGQLF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             +  L     D H ++   +V S+ +IPIG        F      L   F + L +S  
Sbjct: 131 MFLATLFFLATDGHLKMIMLVVMSFKSIPIGTGSLTTVDFRELALWLGIMFKVALSMSLS 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC 229
            +   +  N+S G++ +  PQ+ I+ +   + + +G L +C
Sbjct: 191 GIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVG-LLIC 230


>gi|241761182|ref|ZP_04759271.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374801|gb|EER64262.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 265

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 84/203 (41%), Gaps = 5/203 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R G+  +  P L  +  P+ VR+  A+A   V LP + D   +        ++ L +V  
Sbjct: 22  RPGAAFVAAPLLGANAFPVTVRVMLALA---VGLPSVMDAHLILPDSGLVSFTGLFLVVG 78

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           E+  G   G  +++       T  +I  A+GL   + +   +      L  +  I+G   
Sbjct: 79  EIITGIAIGFAVQIGYAAGYCTSELIGNAMGLGFASMIDPVNGSNSNVLTQIFTILGAFF 138

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D H  +   +V+SY T+P+G       +F          F I + ++ P  F  I+
Sbjct: 139 FLAADGHLLLIRIIVESYQTMPVGGPGLNNQLFLKLTQFAGQLFSIGMLIALPVTFSIIL 198

Query: 196 FNISIGLLNKLVPQIPIYFISTP 218
             + +G L++  P + ++ +  P
Sbjct: 199 IQVMMGFLSRTAPALNLFAVGMP 221


>gi|167552786|ref|ZP_02346537.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205322619|gb|EDZ10458.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 264

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 97/217 (44%), Gaps = 3/217 (1%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P LS   IP +V+L   +  ++V+ P L    D   F   A +  L M ++ +G   G  
Sbjct: 31  PILSERAIPKRVKLGLGIMITLVIAPSL-PANDTPLFSIAALW--LAMQQILIGIALGFT 87

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           ++     ++  G  I   +GL+  T +     L    L  ++ ++ +L     + H  + 
Sbjct: 88  MQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLI 147

Query: 147 YALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKL 206
             LV ++ T+PIG      N F +        F+  L L+ P +   +  N+++GLLN++
Sbjct: 148 SLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRM 207

Query: 207 VPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            PQ+ I+ I  P  + +G + +   + +I     H F
Sbjct: 208 APQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLF 244


>gi|313497811|gb|ADR59177.1| FliR [Pseudomonas putida BIRD-1]
          Length = 258

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 96/212 (45%), Gaps = 13/212 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRL---CFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKL 72
           RV + +M +P      +P ++RL          +  LP L  +D + L+  +       L
Sbjct: 22  RVTAVLMTMPIFGTRMLPARIRLYVAVAVTVVIVPALPPLPEFDPLSLRGML-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++  + ++ 
Sbjct: 75  CAEQIIVGALFGLALQLLFQAFVVAGQIVAVQMGMAFASMVDPANGVNVTVISQFMTMLV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L  P +  
Sbjct: 135 SVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFGAGLLLILPVIAA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +V NI+ G++ +  PQ+ I+ I  P  + +G
Sbjct: 194 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMG 225


>gi|291558214|emb|CBL35331.1| Flagellar biosynthesis pathway, component FliR [Eubacterium siraeum
           V10Sc8a]
          Length = 262

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 96/219 (43%), Gaps = 8/219 (3%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL- 72
           LI+CRV       P  S S  P+++R    +A +++    + D      +     +  L 
Sbjct: 19  LIMCRVSGIFSFNPIFSRSNFPVRLRAGTTIALAVLFASSMGDI----KYEPTGIFMMLF 74

Query: 73  -VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            +M EL LG + G ++ +        G +I    GL++  +M  +  ++     ++   +
Sbjct: 75  DMMKELGLGLILGFMVNLILAVTISAGELIDYQTGLSMARAMDPATGVSMPLFANVYYYM 134

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L  ++ + H         SY T+PIG      ++  + V    T   + ++L++P + 
Sbjct: 135 FILYFFLTNGHLSYIKLFHISYETLPIGFSGFTADVPWALVTYFSTVLTLAVKLAAPIIA 194

Query: 192 FYIVFNISIGLLNKLVPQIPIYF--ISTPYLIGLGSLFL 228
              +  I +G+L K VP I I+   I    LIGL ++ +
Sbjct: 195 IEFITEICLGVLMKAVPSIHIFALNIQLKVLIGLAAVLI 233


>gi|332305671|ref|YP_004433522.1| flagellar biosynthetic protein FliR [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173000|gb|AEE22254.1| flagellar biosynthetic protein FliR [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/243 (18%), Positives = 101/243 (41%), Gaps = 5/243 (2%)

Query: 1   MTISPEII---MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT 57
           M  S ++I   M  + L   R+   +  + GLS   +P  VR    +  ++++LP +   
Sbjct: 1   MEFSADVITQFMGDMLLPFMRISGMLATMVGLSAKTVPTTVRALLTLFITLIILPVI-PP 59

Query: 58  IDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD 117
           + +    +   +  LV+ +L +G   G +  +        G V++   GL   + +   +
Sbjct: 60  VQVDEVFSVGTF-MLVIQQLIIGISLGFISTMVLNTFVLAGQVVAMQTGLGFASIVDPVN 118

Query: 118 SLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT 177
            +    +     I+  L  W +D H  +   +V S+   P+G+       F    +    
Sbjct: 119 GINVPAVGQFYLILATLLFWALDGHLAMIRMVVMSFTAFPVGEAWLQPEQFREIAHWAGW 178

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
            F+  + LS   +   ++ N++ G++ K  PQ+ I+ +       +G + + ++++   Y
Sbjct: 179 MFISAVTLSLAPIVSLLIVNLAFGVMTKAAPQLNIFSLGFSIAQIMGLVIIWITMDNFTY 238

Query: 238 QFS 240
            F 
Sbjct: 239 HFE 241


>gi|239815245|ref|YP_002944155.1| type III secretion system inner membrane R protein [Variovorax
           paradoxus S110]
 gi|239801822|gb|ACS18889.1| type III secretion system inner membrane R protein [Variovorax
           paradoxus S110]
          Length = 239

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 83/194 (42%), Gaps = 8/194 (4%)

Query: 34  IPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLG 93
           +P  VR+   +  SI L   L   +      +   +S L   EL LG   GL I +    
Sbjct: 10  LPASVRMLLVLGLSIALAFGLSAPVGAWMGWSELLFSALA--ELALGATLGLGILLAFGA 67

Query: 94  LQFTGSVISTAIGLNLQTSMGISDSLAETP---LNSLIGIIGLLALWVIDFHHQVFYALV 150
               G ++   +G  +     + D + + P   L S    + +L  ++++ HH +   + 
Sbjct: 68  FSIAGQLLDVQLGFGIAQ---VIDPVTQRPIPVLTSAFNYLAVLVFFLLNGHHALLRGIS 124

Query: 151 KSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQI 210
            S    P+G   + G+  +  +      F +   L++P +F  ++   ++G++ + +PQ+
Sbjct: 125 YSLERFPVGASWSIGHAVAPVLKQAAGLFSLGFALAAPVVFCILLVEFALGVVGRNLPQM 184

Query: 211 PIYFISTPYLIGLG 224
            ++ +  P  I +G
Sbjct: 185 NMFTMGIPVKILVG 198


>gi|76874664|emb|CAI85885.1| flagellar biosynthetic protein [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 231

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 97/225 (43%), Gaps = 14/225 (6%)

Query: 26  LPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV--ELFLGCVH 83
           + GL    +P ++++  A+  + V +P L        F N   +  +++V  ++ +G   
Sbjct: 1   MAGLGAKNVPTRIKMGLAIVVTFVAVPML----PPATFTNLFSFEMILVVIQQMLIGIAI 56

Query: 84  G----LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVI 139
           G    LL+  + L     G +++   GL   + +  S+ L+   +     I+  L  +V 
Sbjct: 57  GFASTLLLNTFVLA----GQILAMQTGLGFASVVDPSNGLSVPAVGQFYLILATLLFFVF 112

Query: 140 DFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNIS 199
           + H  +   +V S+  +PI       + +   V      F   L LS   L   +V N+S
Sbjct: 113 NGHLMMIQMVVHSFEVLPIDGNWWSVDHYWDIVTWGGWMFTTALVLSLAPLTAMLVINMS 172

Query: 200 IGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
            G++ +  PQ+ I+ I  P+ +  G + +  ++   V QF   +L
Sbjct: 173 FGIMTRAAPQLNIFSIGFPFTLVAGLIIIWATLGNFVSQFEFQWL 217


>gi|26991042|ref|NP_746467.1| flagellar biosynthesis protein FliR [Pseudomonas putida KT2440]
 gi|24986074|gb|AAN69931.1|AE016632_2 flagellar biosynthetic protein FliR [Pseudomonas putida KT2440]
          Length = 258

 Score = 41.2 bits (95), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 96/212 (45%), Gaps = 13/212 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRL---CFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKL 72
           RV + +M +P      +P ++RL          +  LP L  +D + L+  +       L
Sbjct: 22  RVTAVLMTMPIFGTRMLPARIRLYVAVAVTVVIVPALPPLPEFDPLSLRGML-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++  + ++ 
Sbjct: 75  CAEQIIVGALFGLALQLLFQAFVVAGQIVAVQMGMAFASMVDPANGVNVTVISQFMTMLV 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L  P +  
Sbjct: 135 SVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFGAGLLLILPVIAA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +V NI+ G++ +  PQ+ I+ I  P  + +G
Sbjct: 194 LLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMG 225


>gi|259907618|ref|YP_002647974.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae Ep1/96]
 gi|224963240|emb|CAX54724.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae Ep1/96]
 gi|283477460|emb|CAY73376.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae DSM 12163]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 101/221 (45%), Gaps = 10/221 (4%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYYSK 71
           FL++ R+ + + + P  S   +  +VR+  A+  + ++   + D+ I L +F       K
Sbjct: 18  FLVMVRIAALLTVAPVFSEKSVNTRVRVGLALLIAALIGGNIPDSHIALYSFQGVWAVGK 77

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGI 130
               +L +G   GL +++  + ++  G +I   +GL+  T      S    P +   + +
Sbjct: 78  ----QLLIGAALGLSMQLLFVAVRMAGEIIGMQMGLSFATFF--DPSAGNVPVIARFLNL 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +  L   V + H  +   L +S+  +P+    L+ G +F   V      F   L L  P 
Sbjct: 132 LVTLLFLVFNGHLWLIALLAESFHQLPVDAAPLHNGGLFL-LVQQAGLVFREGLMLGLPI 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           +   +  N ++GLLN+L PQ+ I+ I  P  + +G + L L
Sbjct: 191 ISLLLCINFTLGLLNRLTPQLSIFVIGFPLTLTVGMVALSL 231


>gi|315127307|ref|YP_004069310.1| flagellar biosynthesis protein FliR [Pseudoalteromonas sp. SM9913]
 gi|315015821|gb|ADT69159.1| flagellar biosynthesis protein FliR [Pseudoalteromonas sp. SM9913]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 104/233 (44%), Gaps = 14/233 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R+ S IM++ G+    +P ++++  A+  + +++P L        F N   +  +++V  
Sbjct: 21  RISSMIMIMAGIGAKNVPARIKMGLAVVVTFLVVPVL----PAATFTNLFSFEMILVVLQ 76

Query: 76  ELFLGCVHG----LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           ++ +G   G    LL+  + L     G +++   GL   + +  S+ ++   +     I+
Sbjct: 77  QMLIGVAIGFASTLLLNTFVLA----GQILAMQTGLGFASVVDPSNGMSVPAVGQFYLIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L  +V + H  +   +V S+  +PI       + +   V      F   L LS   L 
Sbjct: 133 ATLLFFVFNGHLMMIQMVVHSFEVLPIDGNWWAVDHYWDIVTWGGWMFTTALVLSLAPLT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             +V N++ G++ +  PQ+ I+ I  P+ +  G + +  ++   V QF   +L
Sbjct: 193 AMLVINMAFGIMTRAAPQLNIFSIGFPFTLVAGLVIIWATLGNFVTQFEFQWL 245


>gi|85060036|ref|YP_455738.1| flagellar biosynthesis protein FliR [Sodalis glossinidius str.
           'morsitans']
 gi|84780556|dbj|BAE75333.1| flagellar biosynthetic protein FliR [Sodalis glossinidius str.
           'morsitans']
          Length = 262

 Score = 41.2 bits (95), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 75/154 (48%), Gaps = 2/154 (1%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L + ++ +G   GL +++    ++  G VI   +GL+  T    +  L  TPL + +  +
Sbjct: 73  LALKQILIGTALGLTMQLTFAAVRMAGEVIGLQMGLSFTTFFDPASGL-NTPLLARLLNL 131

Query: 132 GLLALWV-IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L +++ ++ H  +   L  S+  +P+  +L     F +        F+  + L+ P +
Sbjct: 132 LALLVFISLNGHLWLLSLLADSFHILPLDSQLMDPGAFMALARAGGIIFLNGMMLALPLI 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
              +  NI++GLLN++ PQ+ ++ I  P  + +G
Sbjct: 192 CMLMTLNIALGLLNRITPQLTVFVIGFPLTLTVG 225


>gi|312973833|ref|ZP_07788005.1| flagellar biosynthetic protein FliR [Escherichia coli 1827-70]
 gi|310332428|gb|EFP99663.1| flagellar biosynthetic protein FliR [Escherichia coli 1827-70]
          Length = 261

 Score = 41.2 bits (95), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  +  + P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     +Q  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVQTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|170725985|ref|YP_001760011.1| flagellar biosynthesis protein FliR [Shewanella woodyi ATCC 51908]
 gi|169811332|gb|ACA85916.1| flagellar biosynthetic protein FliR [Shewanella woodyi ATCC 51908]
          Length = 261

 Score = 41.2 bits (95), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 109/233 (46%), Gaps = 24/233 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMV 75
           RV S +M +  +  +  P+++RL  +M  +  + P L   + +DL +  +     + +++
Sbjct: 17  RVASMLMAMAIVGANTTPVRIRLLLSMTITFAIAPVLPPMENVDLFSLSSGFIIFQQIII 76

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-----SLAETP-LNSLIG 129
            + +G V  L+++ + L    TG +I       +QTS+G +      S  +TP + +   
Sbjct: 77  GVAMGFVTLLVMQTFVL----TGQII------GMQTSLGFASMVDPSSGQQTPVIGNFFL 126

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT---TFMIMLRLS 186
           ++  +    +D H  +   LV S+ TIPI  +   G   +S+  + +     F   L +S
Sbjct: 127 LLTTMIFLAVDGHLVLIRMLVVSFDTIPISDQ---GISIASYKLLAEWGAYMFGAALTMS 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F
Sbjct: 184 MTAIVALLMINLSFGVMTRASPQLNIFAIGFPVTMVTGLFILWLTLTPIMEHF 236


>gi|292489150|ref|YP_003532037.1| flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|292900268|ref|YP_003539637.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291200116|emb|CBJ47242.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291554584|emb|CBA22215.1| Flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|312173308|emb|CBX81563.1| Flagellar biosynthetic protein FliR [Erwinia amylovora ATCC
           BAA-2158]
          Length = 259

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 98/220 (44%), Gaps = 8/220 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYYSK 71
           FL++ R+ + + + P  S   +  +VR+  A+  +++L   + D+ I L +F       K
Sbjct: 18  FLVMVRIAALLTVAPVFSEKGVNTRVRVGLALLIAVLLGGNIPDSHIALYSFQGVWAVGK 77

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGI 130
               +L +G   GL +++  + ++  G ++   +GL+  T      +    P +   + +
Sbjct: 78  ----QLLIGAALGLSMQLLFVAVRMAGEIVGMQMGLSFATFF--DPNAGNVPVIARFLNL 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L   V + H  +   L +S+  +P+         F   V      F   L L  P +
Sbjct: 132 LVTLLFLVFNGHLWLIALLAESFHQLPVDAAPLHNGGFFLLVQQAGLVFREGLMLGLPII 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
              +  N ++GLLN+L PQ+ I+ I  P  + +G + L L
Sbjct: 192 SLLLCINFTLGLLNRLTPQLSIFVIGFPLTLTVGMVALSL 231


>gi|163750538|ref|ZP_02157776.1| flagellar biosynthesis protein [Shewanella benthica KT99]
 gi|161329693|gb|EDQ00682.1| flagellar biosynthesis protein [Shewanella benthica KT99]
          Length = 265

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 103/227 (45%), Gaps = 8/227 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RV S  M++     +  P++VR   +MA +  ++P L    ++  F   A +  L  +++
Sbjct: 21  RVSSMFMVMVVFGANTTPVRVRALLSMAITFAIVPVLPPVENVALFAASAIFITLQQLLI 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIGLL 134
            + +G V  ++++ + L  Q  G  + T++G     SM    S  +TP + +L  ++  +
Sbjct: 81  GISMGFVTLMVMQCFVLAGQIIG--MQTSLGF---ASMVDPSSGQQTPVIGNLFLLLTTM 135

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               +D H  +   LV S+ TIPI  +      +          F   L +S   +   +
Sbjct: 136 IFLAVDGHLVMIRMLVLSFETIPISDQGLSVTSYRLLAEWGGYMFGAALTMSMTPIVALL 195

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F  
Sbjct: 196 LINLSFGVMTRASPQLNIFAIGFPVTMVSGLVILWLTLTPIMEHFGE 242


>gi|119469998|ref|ZP_01612803.1| flagellar biosynthesis protein R [Alteromonadales bacterium TW-7]
 gi|119446708|gb|EAW27981.1| flagellar biosynthesis protein R [Alteromonadales bacterium TW-7]
          Length = 259

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 101/233 (43%), Gaps = 14/233 (6%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV-- 75
           R+ S IM++ GL    +P +++L      S+V+   +   +    F N   +  +++V  
Sbjct: 21  RISSMIMIMAGLGAKNVPTRIKL----GLSVVVTLLVVPVLPPATFTNLFSFEMILVVIQ 76

Query: 76  ELFLGCVHG----LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           ++ +G   G    LL+  + L     G +++   GL   + +  S+  +   +     I+
Sbjct: 77  QMLIGIAIGFASTLLLNTFVLA----GQILAMQTGLGFASVIDPSNGASVPAVGQFFLIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L  +V + H  +   +V S+  +PI       + +   V      F   L LS   L 
Sbjct: 133 ATLLFFVFNGHLMMIQMVVHSFEVLPIDGNWWSVDHYWDIVTWGGWMFTTALVLSLAPLT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             +V NIS G++ +  PQ+ I+ I  P+ +  G + +  ++   + QF   +L
Sbjct: 193 AMLVINISFGIMTRAAPQLNIFAIGFPFTLVAGLVIIWATLGNFILQFEFQWL 245


>gi|307293816|ref|ZP_07573660.1| flagellar biosynthetic protein FliR [Sphingobium chlorophenolicum
           L-1]
 gi|306879967|gb|EFN11184.1| flagellar biosynthetic protein FliR [Sphingobium chlorophenolicum
           L-1]
          Length = 260

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/233 (18%), Positives = 91/233 (39%), Gaps = 7/233 (3%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL---QNFVNRAYYSKLVM 74
           R G+  +  P      +P+Q+RL  ++A  +  L    +++ +    + V       LV 
Sbjct: 22  RPGAAFIAAPVFGAPAVPLQLRLILSLALGMAAL----NSVHIVLPADGVASFQGVMLVA 77

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            E+  G   G  +++        G  I   +GLN    +  S   A   +   + I+   
Sbjct: 78  GEVLAGLAIGFAVQIGYAAALVAGEAIGNTMGLNFAAMVDPSSGQATQAVGQFLSILSTF 137

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
            L  +D H  +   +V+SY  +P G  +   +     +          L ++ P  F  +
Sbjct: 138 LLLAMDGHLMLVSFVVQSYQALPPGGAMLGNDAIWHLIEFGGALLGAGLTIALPVGFALV 197

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           +  I +G+L +  P + ++ +  P  +  G + L ++  ++    + +   G 
Sbjct: 198 LVQIVMGMLARTAPALNLFSVGMPVALMAGLILLAVTAPVMGEGITAALKAGL 250


>gi|262360424|gb|ACY57145.1| type III secretion apparatus protein [Yersinia pestis D106004]
          Length = 185

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 7/80 (8%)

Query: 143 HQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL----SSPFLFFYIVFNI 198
           +QV  AL  SY ++PIGQ +      +  +  LQT + +M  L    + P L   ++ ++
Sbjct: 63  NQVLAALYGSYDSLPIGQGIQPA---ADLLLFLQTEWQMMFELCLCFALPALLVMVLADL 119

Query: 199 SIGLLNKLVPQIPIYFISTP 218
           S+GL+N+   Q+ ++F++ P
Sbjct: 120 SLGLINRSARQLNVFFLAMP 139


>gi|260776471|ref|ZP_05885366.1| flagellar biosynthesis protein FliR [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607694|gb|EEX33959.1| flagellar biosynthesis protein FliR [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 260

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 107/238 (44%), Gaps = 24/238 (10%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW---DTIDLQNFVNRAYYSKLVM 74
           R+ + +M++      ++  +VRL   +A +  ++P +    DTI+L +F       + ++
Sbjct: 21  RIAAMLMVMSVTGARFVSTRVRLYLGLAITFAVMPVIPAVPDTIELLSFQGFMTLLEQII 80

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETPL-NSLI 128
           + + +G +   +I+ + +  Q  G          +Q S+G +  +       TPL   L 
Sbjct: 81  IGVAMGTITQFMIQTFVILGQILG----------MQASLGFASMVDPANGQNTPLLGQLF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +  +     D H ++   +V S+ ++PIG   LN  + F      L   F + L +S 
Sbjct: 131 MFLATMFFLATDGHLKMIMLVVMSFKSLPIGSGSLNSVD-FRELALWLGIMFKVALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             +   +  N+S G++ +  PQ+ I+ +   + + +G L LC    II   FSH  L+
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALIVG-LLLCW--YIIAGLFSHYELF 244


>gi|224826620|ref|ZP_03699721.1| flagellar biosynthetic protein FliR [Lutiella nitroferrum 2002]
 gi|224601221|gb|EEG07403.1| flagellar biosynthetic protein FliR [Lutiella nitroferrum 2002]
          Length = 258

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 84/178 (47%), Gaps = 9/178 (5%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           +L +G   GL++RV    ++  G V+ T +GL   +     ++     +  ++ +   L 
Sbjct: 78  QLLIGLALGLVMRVVITAVEMAGFVMGTQMGLGFASFYDPINAAQVPTIARILTLFTFLL 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
             ++  H  V   L++S+ T+PIG  L   +   +        F   L L+ P +   +V
Sbjct: 138 FLLMGGHQVVIEILLESFRTLPIGMTLP-PDRLKALAEWGGHIFNWGLWLALPVVAALLV 196

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCL-----SIEIIVYQFSHSFLYG 246
            N++IG++ +  PQ  I+    P   L+G  +L+L +     +IE I Y+ + +F+ G
Sbjct: 197 TNLAIGVMTRASPQFNIFTFGFPLTLLVGFAALYLSVPLMVPAIESI-YREAFAFMQG 253


>gi|149377873|ref|ZP_01895602.1| Flagellar biosynthesis pathway, component FliR [Marinobacter
           algicola DG893]
 gi|149357815|gb|EDM46308.1| Flagellar biosynthesis pathway, component FliR [Marinobacter
           algicola DG893]
          Length = 260

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 93/202 (46%), Gaps = 4/202 (1%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+ S +M++P +    +P +VRL  A+  +I+++P +     +  F   A    + + ++
Sbjct: 23  RLVSFMMVIPFIGTQLVPARVRLGLALIITILVVPMIPPVPQVDAF--SADGVVITLQQI 80

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   G  +          G +I+  +GL   + +  ++ ++   L  +  I   L   
Sbjct: 81  LIGVGMGFALTALFQLFVVAGQMIAMQMGLGFASMVDPANGVSVPVLAQIYTITITLLYL 140

Query: 138 VIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
            ++ H   F   ++S+ T+PIG E L    ++    + +   F+  + L+ P +    + 
Sbjct: 141 AMNGHLVAFEVFIESFRTMPIGLEGLGQAGVWQ-LAHRISWIFVSAVLLALPAVTAVFIV 199

Query: 197 NISIGLLNKLVPQIPIYFISTP 218
           NIS G++ +  PQ+ I+ +  P
Sbjct: 200 NISFGVMTRAAPQMNIFALGFP 221


>gi|89094443|ref|ZP_01167383.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
 gi|89081335|gb|EAR60567.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
          Length = 256

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 95/209 (45%), Gaps = 6/209 (2%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY--SKLVMV 75
           R+GS  M +P L    +  ++RL  A+A + V+ P L +          +Y   ++ V+V
Sbjct: 22  RIGSFFMAVPLLGSQLVNARIRLMLALAVTAVIAPMLPEMPAFNGLSVESYLIIAQQVIV 81

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
              LG +  +  +V+ LG    G +I+  +GL   +    ++ ++   L      + ++ 
Sbjct: 82  GAMLGFLFQVFYQVFVLG----GQMIAMQMGLGFASMTDPANGISVVMLGQFYLTLIMMI 137

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H  +   +V+S+  +P+  +    + F          F   + ++ P +   +V
Sbjct: 138 FVALNGHLIMIEIVVRSFEVLPVSLQAIDRDSFMKVALSGTWMFSAAMLMALPAVTALLV 197

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            N++ G++++  PQ+ I  +  P+ + LG
Sbjct: 198 VNMAFGIMSRAAPQLNILAVGFPFTMVLG 226


>gi|90579939|ref|ZP_01235747.1| flagellar biosynthesis protein [Vibrio angustum S14]
 gi|90438824|gb|EAS64007.1| flagellar biosynthesis protein [Vibrio angustum S14]
          Length = 260

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 105/239 (43%), Gaps = 44/239 (18%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD---TIDLQNFVNRAYYSKLV 73
            R+ S +M +      ++  ++RL  A+A +  +LP L      I+L +       ++ +
Sbjct: 20  TRISSMMMAMTFFGARFVSPKIRLYLALAITFAVLPVLPKVPQDIELLSLAGFIVTTQQL 79

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETP-LNSL 127
           ++ + +G V   + +++ L  Q  G          +Q+S+G +  +       TP L   
Sbjct: 80  IIGVAMGLVTQFITQIFVLLGQILG----------MQSSLGFASMVDPANGQNTPVLGQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-----------NFGNIFSSFVNMLQ 176
              + +L     D H ++  A+V S+ T+PIG+ +            FG++F + VNM  
Sbjct: 130 YMFLAILLFLATDGHLEMLNAVVLSFKTLPIGEAMLQPKDYYQLAGWFGHMFKAGVNMAL 189

Query: 177 TTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG---SLFLCLSI 232
              + +L +           N+S G++ +  PQ+ I+ +   + + LG   S F+ L I
Sbjct: 190 AGVIALLTV-----------NLSFGVMTRAAPQLNIFSLGFSFALLLGLAISWFIVLGI 237


>gi|82543589|ref|YP_407536.1| flagellar biosynthesis protein FliR [Shigella boydii Sb227]
 gi|81245000|gb|ABB65708.1| flagellar biosynthesis [Shigella boydii Sb227]
 gi|332096912|gb|EGJ01901.1| flagellar biosynthetic protein FliR [Shigella boydii 3594-74]
          Length = 261

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 100/212 (47%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  + V+ P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFVIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|74312490|ref|YP_310909.1| flagellar biosynthesis protein FliR [Shigella sonnei Ss046]
 gi|73855967|gb|AAZ88674.1| flagellar biosynthesis [Shigella sonnei Ss046]
 gi|320184488|gb|EFW59292.1| Flagellar biosynthesis protein FliR [Shigella flexneri CDC 796-83]
 gi|323168929|gb|EFZ54609.1| flagellar biosynthetic protein FliR [Shigella sonnei 53G]
          Length = 261

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 100/212 (47%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  + V+ P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFVIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|310764876|gb|ADP09826.1| Flagellar biosynthetic protein FliR [Erwinia sp. Ejp617]
          Length = 259

 Score = 40.8 bits (94), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 97/220 (44%), Gaps = 8/220 (3%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-IDLQNFVNRAYYSK 71
           FL++ R+ + + + P  S   +  +VR+  A+  + ++   + D+ I L +F       K
Sbjct: 18  FLVMVRIAALLTVAPVFSEKSVNTRVRVGLALLIAALIGGNIPDSHIALYSFQGVWAVGK 77

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGI 130
               +L +G   GL +++  + ++  G +I   +GL+  T      S    P +   + +
Sbjct: 78  ----QLLIGAALGLSMQLLFVAVRMAGEIIGMQMGLSFATFF--DPSAGNVPVIARFLNL 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L   V + H  +   L +S+  +P+         F   V      F   L L  P +
Sbjct: 132 LVTLLFLVFNGHLWLIALLAESFHQLPVDAAPLHNGGFFLLVQQAGLVFREGLMLGLPII 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
              +  N ++GLLN+L PQ+ I+ I  P  + +G + L L
Sbjct: 192 SLLLCINFTLGLLNRLTPQLSIFVIGFPLTLTVGMVALSL 231


>gi|15616706|ref|NP_239918.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11386790|sp|P57186|FLIR_BUCAI RecName: Full=Flagellar biosynthetic protein fliR
 gi|25346394|pir||D84939 flagellar biosynthetic protein fliR [imported] - Buchnera sp.
           (strain APS)
 gi|10038769|dbj|BAB12804.1| flagellar biosynthetic protein fliR [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 258

 Score = 40.8 bits (94), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 2/166 (1%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ ++ +G V G   ++    +  +G +I   +GL+  T    +  +  + ++  + I+
Sbjct: 73  LILQQILIGIVLGFTAQLLFATINLSGEIIGLQMGLSFATFFNNNSQIGTSIISRFLNIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            L     ++ H  +   ++ S+ ++PI G  LN  NIF   +    + F+  L L  P +
Sbjct: 133 ALFVFITLNMHLYLISIVIDSFYSMPIDGYFLNV-NIFFILLKFSSSIFLNGLLLVLPIM 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
              +  +  + LLN+L PQI I+ I  P  + LG L L   I +++
Sbjct: 192 IILLSISFVMSLLNRLSPQISIFSIGFPLNLILGMLMLYFLIPVML 237


>gi|219681462|ref|YP_002467847.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682018|ref|YP_002468402.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471137|ref|ZP_05635136.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|219621751|gb|ACL29907.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624305|gb|ACL30460.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311085826|gb|ADP65908.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086399|gb|ADP66480.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311086978|gb|ADP67058.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 258

 Score = 40.8 bits (94), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 2/166 (1%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ ++ +G V G   ++    +  +G +I   +GL+  T    +  +  + ++  + I+
Sbjct: 73  LILQQILIGIVLGFTAQLLFATINLSGEIIGLQMGLSFATFFNNNSQIGTSIISRFLNIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            L     ++ H  +   ++ S+ ++PI G  LN  NIF   +    + F+  L L  P +
Sbjct: 133 ALFVFITLNMHLYLISIVIDSFYSMPIDGYFLNV-NIFFILLKFSSSIFLNGLLLVLPIM 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIV 236
              +  +  + LLN+L PQI I+ I  P  + LG L L   I +++
Sbjct: 192 IILLSISFVMSLLNRLSPQISIFSIGFPLNLILGMLMLYFLIPVML 237


>gi|237653574|ref|YP_002889888.1| flagellar biosynthetic protein FliR [Thauera sp. MZ1T]
 gi|237624821|gb|ACR01511.1| flagellar biosynthetic protein FliR [Thauera sp. MZ1T]
          Length = 265

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 88/195 (45%), Gaps = 8/195 (4%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           P  S   + +++RL   +  ++ +LP L     +     +  A +++    ++ +G   G
Sbjct: 31  PVFSNRGVSVRIRLAIGLGVAMAVLPVLPPMPQVPPGGGLGLAIFAQ----QILIGIAIG 86

Query: 85  LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP-LNSLIGIIGLLALWVIDFHH 143
            ++R+    +   G++I   +GL+        D+  +T  L+  + ++  L    ID H 
Sbjct: 87  FVMRIVFAAVDMAGALIGMQMGLSFAVFFD-PDAGGQTAVLSDFLNLLATLIFLAIDGHL 145

Query: 144 QVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLL 203
            +   LV+S+  +P+  +      ++       T F   L LS P +   +V NI++G+L
Sbjct: 146 LMIDLLVRSFEWLPVATDAVDAGGWAFLARSGITVFSAGLLLSLPVIAVLLVANIALGVL 205

Query: 204 NKLVPQIPIYFISTP 218
            +  PQ+ ++ +  P
Sbjct: 206 TRAAPQLNLFAVGFP 220


>gi|260778658|ref|ZP_05887550.1| type III secretion protein SpaR [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604822|gb|EEX31117.1| type III secretion protein SpaR [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 256

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 71/148 (47%), Gaps = 9/148 (6%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTS----MGISDSLAETPLNSLIGII 131
           EL +G + G    +    +   G VI T  G ++ T     MG+  S+       ++G++
Sbjct: 72  ELLIGLIVGFCAAIPFWAIDMAGFVIDTMRGASMSTVLNPLMGLQSSVFGMFFTQILGVL 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM-LQTTFMIMLRLSSPFL 190
            L++       + +  AL +SY  +P    L+F     SF++   Q    + L  + P +
Sbjct: 132 FLVS----GGFNALLTALYQSYTVLPPESALSFNQDLLSFISQQWQMMSDMCLSFALPAM 187

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTP 218
              I+ ++++GL+N+ V Q+ ++F+S P
Sbjct: 188 VVMIMVDVALGLVNRSVEQLNVFFLSMP 215


>gi|54307251|ref|YP_128271.1| flagellar biosynthetic protein FliR [Photobacterium profundum SS9]
 gi|46911671|emb|CAG18469.1| Hypothetical flagellar biosynthetic protein FliR [Photobacterium
           profundum SS9]
          Length = 259

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 101/229 (44%), Gaps = 13/229 (5%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-----DTIDLQNFVNRAYYSKL 72
           R+G+ ++++P    S IP QVR+  A   S++  P +      D + L   +       L
Sbjct: 22  RLGAAMLMMPVFGGSTIPTQVRVGLAFCISLLAAPLMPPMPSVDPLSLDALI-------L 74

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G + GL++ +        G ++S  +GL +  S    + ++   L     +  
Sbjct: 75  GVQQMIIGGIMGLMLELLFGVFTTMGQILSMQMGLGMAMSNDPINGVSIPTLGKYYQLYI 134

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL    +D H      +V+S+   P+G E+   +   S V  L         L+ P +  
Sbjct: 135 LLLFLALDGHLVALDVVVQSFNVWPVG-EMPSQDALYSVVMRLGWLIAAAFLLALPAVCA 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            ++ N + G++N+  PQ+ ++ +  P  + LG + L ++   I   F+ 
Sbjct: 194 MLLVNGAFGMMNRAAPQLNVFALGFPMTMLLGLMCLLITTSSIPENFTR 242


>gi|331006681|ref|ZP_08329959.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC1989]
 gi|330419513|gb|EGG93901.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC1989]
          Length = 258

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 94/212 (44%), Gaps = 14/212 (6%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDT-----IDLQNFVNRA 67
           FL + R+ S  M  P  S   +  ++RL   ++ +I+++P L        ID+  F+   
Sbjct: 17  FLPLVRLASFFMAAPIFSTRIVSTRIRLILTLSITILIVPILPPAPLVSGIDVSMFI--- 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +V  ++ +G   G   +V        G  I+  +GL   +    S+ ++ T ++  
Sbjct: 74  ----IVAQQILIGVALGFTFQVVFQLFVLAGQYIAMKLGLGFASMNDPSNGVSVTIVSQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLS 186
             +   L     + H  +   LV S+  IPIG   ++  NI+   V +    F   L +S
Sbjct: 130 YLLTTTLLFLSFNGHLILIQILVDSFTAIPIGTVGISTSNIY-RIVELGGWMFGSALVIS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            P L   +V N++ G++++  PQ+ I+ +  P
Sbjct: 189 MPVLTALLVVNVAFGVMSRSAPQMNIFAVGFP 220


>gi|134280964|ref|ZP_01767674.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 305]
 gi|125657195|gb|ABN48683.1| FliR [Burkholderia pseudomallei]
 gi|134247986|gb|EBA48070.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 305]
          Length = 258

 Score = 40.4 bits (93), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 39/200 (19%), Positives = 88/200 (44%), Gaps = 10/200 (5%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
           CR+ + +   P +  S +P ++R+  A+  +++ LP + D + +  F  R   +     +
Sbjct: 20  CRILAALSAAPFIGESTVPARMRVTIALFLALIALPAV-DPVAIPVFSARGALAA--AEQ 76

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG---IIGL 133
           + +G + G+L           G ++++ +GL +     ++D L     + + G   +  +
Sbjct: 77  ILIGLLFGMLFHFVQAVFMMLGYLVASQMGLAMAV---MNDPLNGATSDVVSGFMLVASI 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           L  + ID H  V   L  S+   P+G  ++  ++           F   + L++P +F  
Sbjct: 134 LLFFAIDAHLVVVQVLYTSFRVWPVGTPIDLPSL-KPLAYQAAWLFSTTMLLAAPLVFAT 192

Query: 194 IVFNISIGLLNKLVPQIPIY 213
           +V  I    L++  P I ++
Sbjct: 193 VVLQIGKSYLSRATPSINLF 212


>gi|347245|gb|AAC36861.1| fliR [Escherichia coli]
          Length = 261

 Score = 40.4 bits (93), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 99/212 (46%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  +  + P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLAVG 225


>gi|170737010|ref|YP_001778270.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           MC0-3]
 gi|169819198|gb|ACA93780.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           MC0-3]
          Length = 265

 Score = 40.4 bits (93), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 102/206 (49%), Gaps = 8/206 (3%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFL--WDTIDLQNFVNRAY 68
           ++F   CR+ + +   P L    +P+++RL  A+  ++ + P +     IDL      A 
Sbjct: 14  TIFWPFCRIAAALAASPILGDVMVPVRLRLLIALFLALAIQPGIPTMPVIDLLQLEGVAA 73

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNL-QTSMGISDSLAETPLNSL 127
            ++ V++   LG V  L++      LQ  G++ S+ +GL++ Q +  ++  +A+  L S+
Sbjct: 74  MAEQVLIGGLLGFVFHLVL----CALQIFGTIASSQLGLSMAQINDPMNGQMADV-LTSV 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L  + +D H  +   + +S+   P+G+     +        +   F   + L+ 
Sbjct: 129 MYVVFILLFFAVDGHLILTSVIARSFAVWPVGRFAFDLDALKHLAFAVGWIFSAAVALAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIY 213
           P +F  +V  + +GLLN++ P + I+
Sbjct: 189 PVMFATLVVQVGLGLLNRVAPALNIF 214


>gi|149195094|ref|ZP_01872186.1| Flagellar biosynthesis protein FliR [Caminibacter mediatlanticus
           TB-2]
 gi|149134807|gb|EDM23291.1| Flagellar biosynthesis protein FliR [Caminibacter mediatlanticus
           TB-2]
          Length = 254

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 93/219 (42%), Gaps = 7/219 (3%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           T+  ++ +++  L+  R+ S +  LP  +   IPM V+   ++  SI+  P +       
Sbjct: 4   TLLSDVNVVTFLLLFIRISSFLSFLPFFNYMNIPMNVKAALSIWLSILFFPIVPKVNFEI 63

Query: 62  NFVN--RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           N +N   A ++++     F+G    L+  +    L+F    IS  +G  +   +  +   
Sbjct: 64  NLINILLAIFNEIAF-AFFVGMALQLIFDI----LKFAAEQISFVMGFTMANVIDPNFGG 118

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
             T L+     I +L        H     L K    +P G   N+  I+  F+  +   F
Sbjct: 119 QSTILSQFFIWIAILVFLTFGGDHLEILLLSKFMSNLPFGAFFNYHKIYEYFLVYMGKYF 178

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           MI + L+ P +   ++ +I  G++ K +PQ  +  +  P
Sbjct: 179 MIGVGLAFPIIAISLMSDIIFGMIMKTMPQFNLLVVGFP 217


>gi|34498579|ref|NP_902794.1| flagellar biosynthetic protein FliR [Chromobacterium violaceum ATCC
           12472]
 gi|34104433|gb|AAQ60791.1| flagellar biosynthetic protein FliR [Chromobacterium violaceum ATCC
           12472]
          Length = 252

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 71/165 (43%), Gaps = 3/165 (1%)

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           +L +G   G ++R+    ++ TG +I    GL          +     L+ ++ +     
Sbjct: 72  QLLIGLSMGFVMRIVISAVELTGFIIGAQTGLGFAMFYDPVHAAQVPVLSQMLSLFTFFL 131

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               D HH V  AL  S+  +PIG  +    I  +        F   + L+ P +   ++
Sbjct: 132 FLAFDGHHVVLGALAHSFQVLPIGMPMPAQGI-KALTLWGAHLFEWGVWLAMPIIGALLI 190

Query: 196 FNISIGLLNKLVPQIPIYFISTPY--LIGLGSLFLCLSIEIIVYQ 238
            N++IG++ +  PQ  I+    P   +IG  +L+L L + I V +
Sbjct: 191 TNLAIGVMTRAAPQFNIFSFGFPLTIMIGFCTLYLTLPMMIPVIE 235


>gi|315654596|ref|ZP_07907502.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii ATCC
           51333]
 gi|315491060|gb|EFU80679.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii ATCC
           51333]
          Length = 248

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/148 (17%), Positives = 61/148 (41%)

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           +++  +G    +++R+    LQ  GS+I    G  +  +        +     +  +  +
Sbjct: 67  LIQALIGFAMAVMVRIIVATLQMAGSLIDFEGGFAMAQAFDPLTMTNQATFGRVYELSAM 126

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
             L+  + +  +   L +S+  +PIG   + GN     V       +  + ++ P L   
Sbjct: 127 AMLFATNGYQLLILGLARSFNAMPIGAAFDMGNYADRLVFRFGELMVASIEIAGPLLLVL 186

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLI 221
            + ++ +GLL K+ P +  + +  P  I
Sbjct: 187 FLTDMGLGLLTKVAPAMNAFTLGFPLKI 214


>gi|319944174|ref|ZP_08018450.1| flagellar biosynthesis protein FliR [Lautropia mirabilis ATCC
           51599]
 gi|319742469|gb|EFV94880.1| flagellar biosynthesis protein FliR [Lautropia mirabilis ATCC
           51599]
          Length = 253

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 82/176 (46%), Gaps = 5/176 (2%)

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
           +F + A++  L+  E+ +G   GL+ R+    ++  G +I   +G +       S     
Sbjct: 64  SFDDPAFF-VLMASEVMIGLAIGLVCRMLLASVEMAGEIIGLQMGFSFAAFFDPSTGSNS 122

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIP--IGQELNFGNIFSSFVNMLQTTF 179
             +  L   + L +  VI+    +  A + S   +P  +G +   G +    V  +   F
Sbjct: 123 NAIGRLFNTMSLTSFAVINGPLLLVAATMNSLERMPANMGTQQFLGRLDIGAV--ISQVF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
            + L ++ P++   +  N+S+GL++++ PQ+ ++ I  P  IG G + L L + ++
Sbjct: 181 ELGLLMALPYMALLLFVNLSLGLISRVAPQLNVFAIGFPITIGSGLMLLTLGMPML 236


>gi|261252334|ref|ZP_05944907.1| flagellar biosynthesis protein FliR [Vibrio orientalis CIP 102891]
 gi|260935725|gb|EEX91714.1| flagellar biosynthesis protein FliR [Vibrio orientalis CIP 102891]
          Length = 260

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 98/221 (44%), Gaps = 20/221 (9%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW---DTIDLQNFVNRAYYSKLVM 74
           R+ + +M++      ++  +VRL   +A +  ++P +    DTI+L +F       + ++
Sbjct: 21  RIAAMLMVMSVTGARFVSTRVRLYLGLAITFAVMPAIPAVPDTIELLSFAGFMTLLEQII 80

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL-----AETPL-NSLI 128
           + + +G V   +I+ + +  Q  G          +Q+S+G +  +       TPL   L 
Sbjct: 81  IGVAMGTVTQFMIQTFVILGQILG----------MQSSLGFASMVDPANGQNTPLLGQLF 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             +  L     D H ++   +V S+ ++PIG        F      L   F + L +S  
Sbjct: 131 MFLSTLFFLTTDGHLKMIMLVVMSFKSLPIGTGSLTTVDFRELALWLGIMFKVALSMSLS 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLC 229
            +   +  N+S G++ +  PQ+ I+ +   + + +G L +C
Sbjct: 191 GIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVG-LLIC 230


>gi|298346008|ref|YP_003718695.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii ATCC
           43063]
 gi|304390234|ref|ZP_07372188.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315657499|ref|ZP_07910381.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|298236069|gb|ADI67201.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii ATCC
           43063]
 gi|304326716|gb|EFL93960.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315491971|gb|EFU81580.1| flagellar biosynthesis protein FliR [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 248

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/148 (17%), Positives = 61/148 (41%)

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           +++  +G    +++R+    LQ  GS+I    G  +  +        +     +  +  +
Sbjct: 67  LIQALIGFAMAVMVRIIVATLQMAGSLIDFEGGFAMAQAFDPLTMTNQATFGRVYELSAM 126

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
             L+  + +  +   L +S+  +PIG   + GN     V       +  + ++ P L   
Sbjct: 127 AMLFATNGYQLLILGLARSFNAMPIGAAFDMGNYADRLVFRFGELMVASIEIAGPLLLVL 186

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLI 221
            + ++ +GLL K+ P +  + +  P  I
Sbjct: 187 FLTDMGLGLLTKVAPAMNAFTLGFPLKI 214


>gi|462612|sp|P34202|FLIR_PECCC RecName: Full=Flagellar biosynthetic protein fliR; AltName:
           Full=Flagellar biosynthetic protein mopE
 gi|397347|emb|CAA51478.1| mopE [Pectobacterium carotovorum]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 69/153 (45%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   + I+
Sbjct: 73  LLIQQILIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVVARFLNIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L     D H  +   L  S+ T+PI       + F +        F+  L L+ P + 
Sbjct: 133 AILLFLTFDGHLWMISLLADSFYTLPISANPIISHAFLALARAGGLIFINGLMLALPIIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             +  N+++G+LN++ PQ+ I+ +  P  + +G
Sbjct: 193 LLLTINLALGMLNRVAPQLSIFVVGFPITLTVG 225


>gi|194429944|ref|ZP_03062454.1| flagellar biosynthetic protein FliR [Escherichia coli B171]
 gi|194412033|gb|EDX28345.1| flagellar biosynthetic protein FliR [Escherichia coli B171]
 gi|323158571|gb|EFZ44585.1| flagellar biosynthetic protein FliR [Escherichia coli E128010]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 100/212 (47%), Gaps = 3/212 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   +P +V+L  AM  +  + P L    D+  F   A +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSL-PANDVPVFSFFALW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  ++ ++ 
Sbjct: 74  AVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARIMDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL     + H  +   LV ++ T+PIG E    N F +     +  F+  L L+ P +  
Sbjct: 134 LLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGRLIFLNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
            +  N+++GLLN++ PQ+ I+ I  P  + +G
Sbjct: 194 LLTLNLALGLLNRMAPQLSIFVIGFPLTLTVG 225


>gi|261821161|ref|YP_003259267.1| flagellar biosynthesis protein FliR [Pectobacterium wasabiae
           WPP163]
 gi|261605174|gb|ACX87660.1| flagellar biosynthetic protein FliR [Pectobacterium wasabiae
           WPP163]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 69/153 (45%)

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   + I+
Sbjct: 73  LLIQQILIGITLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMPVIARFLNIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L     D H  +   L  S+ T+PI       + F +        F+  L L+ P + 
Sbjct: 133 AILLFLTFDGHLWLISLLADSFHTLPISTSPINSHAFLALARAGGLIFINGLMLALPIIT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
             +  N+++G+LN++ PQ+ I+ +  P  + +G
Sbjct: 193 LLLTINLALGMLNRMAPQLSIFVVGFPITLTVG 225


>gi|156933430|ref|YP_001437346.1| flagellar biosynthesis protein FliR [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531684|gb|ABU76510.1| hypothetical protein ESA_01248 [Cronobacter sakazakii ATCC BAA-894]
          Length = 262

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 104/231 (45%), Gaps = 3/231 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + RV + I   P LS   I ++V++  A+  +I L P +  + ++  F     +  L
Sbjct: 17  FWPLLRVLALISTAPILSERSISIRVKIGLALLITIALAPNIPGS-NVPIFSLEGLW--L 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + ++ +G   G  ++     ++  G +I   +GL+  T       L    L   I ++ 
Sbjct: 74  GLQQILIGVAIGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLARFIDMLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L    ++ H  +   L  ++ T+PIG E    N F +        F+  + L+ P +  
Sbjct: 134 MLLFLTVNGHLWLISILADTFHTLPIGGEAINSNAFMALTRAGGLIFINGVMLALPMITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +  N+++GLLN++ PQ+ ++ I  P  + +G + L   + +I     H F
Sbjct: 194 LLSLNLALGLLNRMAPQLTVFAIGFPLTLSIGIIVLAALMPLIAPFCEHLF 244


>gi|310659025|ref|YP_003936746.1| flir [Clostridium sticklandii DSM 519]
 gi|308825803|emb|CBH21841.1| FliR [Clostridium sticklandii]
          Length = 262

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 95/207 (45%), Gaps = 3/207 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           LI+ RV   I + P    + IP+ V++  ++  S ++LPFL    ++   +       + 
Sbjct: 18  LILSRVIGFISVAPVYGRNGIPLYVKIGLSIIVSYIILPFL--VFEISTPIGSPELIFMS 75

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
             E+  G   GL+ +++       G++I   +GL++            T  +  + I   
Sbjct: 76  FKEVITGLGLGLIAQLFFSIFASAGAIIDMELGLSMSQVYDPQIGGQVTVTSKFLDIFAY 135

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQT-TFMIMLRLSSPFLFF 192
           L    ID HH +  A++ S+  +P+G      + F +F + L +  F+  + ++ P +  
Sbjct: 136 LIFLYIDGHHYLMRAIINSFYILPLGSAQISNDNFINFTSKLVSYIFVSAITIAIPIIIS 195

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPY 219
             + N+ +  + K++PQ+ ++ +  P+
Sbjct: 196 IFLGNLLLAFMAKIMPQMNVFIVGMPF 222


>gi|34498064|ref|NP_902279.1| type III secretion system EscT protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34103919|gb|AAQ60279.1| type III secretion system EscT protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 257

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 143 HQVFYALVKSYGTIPIGQELNFG-NIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIG 201
           +++  A+ +SY T+P G  +++     S F    Q  + + LR S P +   ++ ++++G
Sbjct: 141 NELLEAIYQSYVTLPPGAAIHYSPEALSFFYRQWQLMYELCLRFSMPAIVVILLVDMALG 200

Query: 202 LLNKLVPQIPIYFISTP 218
           L+N+   Q+ ++F+S P
Sbjct: 201 LVNRSAQQLNVFFLSMP 217


>gi|296282254|ref|ZP_06860252.1| flagellar biosynthetic protein FliR [Citromicrobium bathyomarinum
           JL354]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 87/216 (40%), Gaps = 7/216 (3%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSI---VLLPFLWDTIDLQN 62
           E  +  +  ++ RVG+ ++  P    S +P+ VR+ F  A +I   + LP +     L  
Sbjct: 12  EADIWRVVFLMTRVGAALLAAPFFGASNVPVVVRISFTGAMAIFISIWLPEVATPPALLT 71

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
                  +   ++ L LG V  +     T+  +    VI  ++GL++ T+   +   + T
Sbjct: 72  LDGMLALAGEALIGLMLGFVLQIAFAAPTIAAE----VIGGSMGLSMATTTDPNGGGSTT 127

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
                  I+  L     + H      + +SY   P GQ       F +      T F   
Sbjct: 128 AFGQYFIIVLTLIFLATNAHLHWLALVTESYRAFPPGQTWIGPERFETIFMFGGTLFETA 187

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           LR++ P     ++  I  G+L++  P + ++ +  P
Sbjct: 188 LRIALPVTLILLLVQIVTGILSRSAPSLNLFALGLP 223


>gi|163800126|ref|ZP_02194027.1| putative flagellar biosynthetic protein FliR [Vibrio sp. AND4]
 gi|159175569|gb|EDP60363.1| putative flagellar biosynthetic protein FliR [Vibrio sp. AND4]
          Length = 258

 Score = 40.0 bits (92), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 100/218 (45%), Gaps = 9/218 (4%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL--VMV 75
           RVG+  + +P    + IP+ VR   A++  ++  P +    +++ F   + +  L   M 
Sbjct: 21  RVGAVFISMPFFGDALIPVWVRSLLALSIVVITAPLMPTMPEVELFSMTSIFLALEQAMW 80

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
            L  G +  +L  V+T+     G  IS  +GL +       + L+   L  +  I   L 
Sbjct: 81  GLMFGLILHMLFNVFTM----LGQTISLQMGLGMAVMNDPVNGLSVAILGRMFLIFSTLL 136

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
              ++ H  +   +++S+   P+G  +   ++    VN+    F   L L+ P +   ++
Sbjct: 137 FLALEGHLLIIDIVIQSFVVWPVGSGITALSL-QGVVNIFGWMFASALALALPAIASMLL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTP--YLIGLGSLFLCLS 231
            NIS G++N+  P + +Y +  P   L+GL S+ + +S
Sbjct: 196 ANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVS 233


>gi|238764400|ref|ZP_04625350.1| Flagellar biosynthetic protein fliR [Yersinia kristensenii ATCC
           33638]
 gi|238697426|gb|EEP90193.1| Flagellar biosynthetic protein fliR [Yersinia kristensenii ATCC
           33638]
          Length = 260

 Score = 40.0 bits (92), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 110/236 (46%), Gaps = 5/236 (2%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P LS   I  +V++  A+  + ++ P L   +++    + A +  +
Sbjct: 17  FWPLIRILALISTAPVLSEKQINRKVKVGLAILITFLIAPSL-PPVNIPLVSSGAVW--V 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
              ++ +G   GL ++     ++ +G VI   +GL+  T    S       L  L+ ++ 
Sbjct: 74  AGQQILIGAAIGLTMQFAFAAIRLSGEVIGLQMGLSFATFFDPSGGPNMPVLARLLNLLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           +L     D H  +   L  S+ T+PI  E   GN F +        FM  L L+ P +  
Sbjct: 134 MLLFLSFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALAQAGSLIFMNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
            +  N+++G+LN++ PQ+ ++ I  P  + +G + L L++ ++     H  L+G F
Sbjct: 194 LLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLAMPLLAPFTEH--LFGEF 247


>gi|253998480|ref|YP_003050543.1| flagellar biosynthetic protein FliR [Methylovorus sp. SIP3-4]
 gi|253985159|gb|ACT50016.1| flagellar biosynthetic protein FliR [Methylovorus sp. SIP3-4]
          Length = 256

 Score = 40.0 bits (92), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 104/223 (46%), Gaps = 18/223 (8%)

Query: 16  VCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV 75
           + R+ + I + P LS   I  +V++  A+  ++ LLP L     L  F   ++   LV+ 
Sbjct: 20  MTRILAMIAVAPVLSHRSISARVKISMALMMTLALLPSLPQPPLLDIF---SWRGMLVLA 76

Query: 76  E-LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQ-----TSMGISDSLAE--TPLNSL 127
           + + +G   G  +R+    ++  G +I   +GL         + G S+++++    L +L
Sbjct: 77  QQMVIGFAIGFSMRIVFAAVEMAGQMIGMTMGLGFAMFYDPQTQGQSNAISQFMVLLTTL 136

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I     L+L   D H  +  A+++S+   P+  E   G  F    N     F   L +S 
Sbjct: 137 I----FLSL---DGHLLMISAVMESFANFPLSAEWQGGLDFMKMANWGGKIFSAGLLISL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCL 230
           P +   ++ N+++G+L +  PQ+ ++ I  P  I +G + + L
Sbjct: 190 PAIAALLITNMALGILTRTAPQLNLFGIGFPVTIAIGYVVVAL 232


>gi|251789176|ref|YP_003003897.1| flagellar biosynthetic protein FliR [Dickeya zeae Ech1591]
 gi|247537797|gb|ACT06418.1| flagellar biosynthetic protein FliR [Dickeya zeae Ech1591]
          Length = 260

 Score = 40.0 bits (92), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 93/206 (45%), Gaps = 3/206 (1%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F  + R+ + I   P  S   I  +V+L   +  +I ++P +  T  +  F     +  +
Sbjct: 17  FWPLVRILALISTAPIFSERAITRRVKLGLGVLITIAIMPAIPHT-SIPIFSAAGIW--M 73

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +  ++ +G + G  +++    ++  G +I   +GL+  T    S       +   + ++ 
Sbjct: 74  LFQQVVIGVMLGFTMQLAFTAIRLAGEIIGLQMGLSFATFFDPSGGPNMPVIARFMNLLA 133

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           LL    ++ H  +   L  S+ TIPIG     GN+F S        F   L L+ P +  
Sbjct: 134 LLLFLTMNGHLWLISLLADSFHTIPIGAGPVSGNVFMSLAEAGGRIFSNGLMLALPLITL 193

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTP 218
            +  N+++GLL++L PQ+ I+ I  P
Sbjct: 194 LLTINMALGLLSRLAPQLTIFAIGFP 219


>gi|239826630|ref|YP_002949254.1| flagellar biosynthesis protein FliR [Geobacillus sp. WCH70]
 gi|239806923|gb|ACS23988.1| flagellar biosynthetic protein FliR [Geobacillus sp. WCH70]
          Length = 257

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 73/163 (44%), Gaps = 4/163 (2%)

Query: 84  GLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLIGIIGLLALWVIDFH 142
           GL   +    +Q  G +I   +G  +   +    + A++PL    +    LL L  +D H
Sbjct: 79  GLFAYMIVSAIQIVGGLIDFQMGFAIANVID-PQTGAQSPLVGQYLYTFALLLLLSVDGH 137

Query: 143 HQVFYALVKSYGTIPIGQ--ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISI 200
           H +   +  SY  IP+      + G++    V    T F+I  ++S P +    + ++++
Sbjct: 138 HLLLDGVFYSYRFIPLDHWPHFDHGHVAKYIVKSFSTMFIIAFQMSVPLVGSLFLVDVAL 197

Query: 201 GLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           G++ + VPQ+ I+ +  P  I    + L +++  +     H F
Sbjct: 198 GIVARTVPQLNIFVVGFPVKIAAAFILLIVTMATLFIAVRHLF 240


>gi|238785153|ref|ZP_04629147.1| Type III secretion protein SpaR/YscT/HrcT [Yersinia bercovieri ATCC
           43970]
 gi|238713968|gb|EEQ05986.1| Type III secretion protein SpaR/YscT/HrcT [Yersinia bercovieri ATCC
           43970]
          Length = 264

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 104/219 (47%), Gaps = 21/219 (9%)

Query: 11  SLFLIVCRVGSCIMLLP---GLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +L L + R    +++LP     S+    ++  L FA+A  I  L F    +  ++F   A
Sbjct: 10  ALGLAMMRPYGTLLILPLFTARSLGSALLRNALIFAIALPITPLFFSPSLMTHESFT--A 67

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQT----SMGISDSLAETP 123
           ++  L   EL +G + G +  +    +   G +I T  G  + T    SMG+  S+    
Sbjct: 68  WFG-LFCTELLIGVMIGFVAALPFWAIDMAGFLIDTLRGATMSTLFNPSMGMESSIFGVL 126

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
              L+ ++ L++       + V  AL  SY T+PIG  ++     S+ +  LQ+ + +M 
Sbjct: 127 FTQLLTVLFLIS----GGFNLVLGALYGSYDTLPIGSGIHPS---SAMLPFLQSEWQLMY 179

Query: 184 RL----SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
            L    + P +   ++ ++S+GL+N+   Q+ ++F++ P
Sbjct: 180 ELCLSFALPAMMVMVLADLSLGLINRSAQQLNVFFLAMP 218


>gi|269139499|ref|YP_003296200.1| flagellar biosynthesis pathway, component FliR [Edwardsiella tarda
           EIB202]
 gi|267985160|gb|ACY84989.1| flagellar biosynthesis pathway, component FliR [Edwardsiella tarda
           EIB202]
 gi|304559388|gb|ADM42052.1| Flagellar biosynthesis protein FliR [Edwardsiella tarda FL6-60]
          Length = 262

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 98/215 (45%), Gaps = 3/215 (1%)

Query: 27  PGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLL 86
           P L    +P ++R+  A   + +L P L  T D+      A +  L + ++ +GC  GL 
Sbjct: 31  PMLGEKAVPRKIRIALAALTAFLLAPQLPPT-DITLASGGALW--LAIQQILIGCAIGLT 87

Query: 87  IRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVF 146
           +++    ++  G VI   +GL+  T    S       L  L+ ++ LL    +