BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein
FliR [Candidatus Liberibacter asiaticus str. psy62]
         (248 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|15895417|ref|NP_348766.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           acetobutylicum ATCC 824]
 gi|15025140|gb|AAK80106.1|AE007715_11 FliR/FlhB fusion protein [Clostridium acetobutylicum ATCC 824]
 gi|325509563|gb|ADZ21199.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           acetobutylicum EA 2018]
          Length = 610

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 105/239 (43%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
               SLF++  RV +  + L  +    +P  V++  ++  S  ++P++ +   +    N 
Sbjct: 4   AYFTSLFMVFLRVFAFFIALQVMFPKSLPNTVKVMLSLCISFFVMPYI-NLSQVSALNNG 62

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             Y+   + E+  G + G    +  LG++  G  +   IG ++ T+   S     + +  
Sbjct: 63  FLYTWQCICEILTGLILGFFANLMFLGVKIGGQFLDFQIGYSMMTAYDPSSESNASLIER 122

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + +  ++  + I  H  V   LV S+ ++ +G  +          N+    F+I  +++
Sbjct: 123 FLNMFSVVLFFSIGGHEVVIKELVSSFNSVKLGTFVINDQSVMVAFNVFVQFFVIGFKIA 182

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   ++ +I +GL+++ VPQ+ +  +  P  I LG   L + + +I      SF  
Sbjct: 183 LPVVLVLLITDIVMGLMSRTVPQLNVMILGMPIKILLGLTCLMIILPLIAKVLITSFSS 241


>gi|300854222|ref|YP_003779206.1| bifunctional flagellar biosynthesis proteins FliR/FlhB [Clostridium
           ljungdahlii DSM 13528]
 gi|300434337|gb|ADK14104.1| fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium ljungdahlii DSM 13528]
          Length = 606

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 104/236 (44%), Gaps = 1/236 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
              +L L+  R+ S  +L+P    S IP  V++   +  + +L+P + D   + +  N  
Sbjct: 6   YFTALILVSIRIFSFFILVPIFFPSGIPNVVKVGLTVVMAYILMPGI-DYASISSIDNTM 64

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           ++    + E+  G   G L  +    ++  G+++   +G  + +    + +   T +  L
Sbjct: 65  FFVMNCLNEVAAGLTLGFLTSLCFSMVRIAGNLMDMQMGFAMVSMFDPTSNSNTTLIERL 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +    L+  +++D HH +  +L++S+  I +G         +         F I +++  
Sbjct: 125 LYWFSLVIFFIVDGHHMLIKSLIQSFSVIKLGSFFLNQASINIIFKAFIEYFGIAIQIGI 184

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   +  ++++ L+ + VPQ+ I  +  P  + +G    C ++ I +    H F
Sbjct: 185 PIVLILLFTDLTMSLIARTVPQLNIMILGLPVKVLIGFASFCFALPIFLKLIEHLF 240


>gi|302874605|ref|YP_003843238.1| flagellar biosynthetic protein FlhB [Clostridium cellulovorans
           743B]
 gi|307690784|ref|ZP_07633230.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           cellulovorans 743B]
 gi|302577462|gb|ADL51474.1| flagellar biosynthetic protein FlhB [Clostridium cellulovorans
           743B]
          Length = 607

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 102/239 (42%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              ++L LI  R+    +  PG+  +  P  ++    +  + ++LP +  +         
Sbjct: 5   TFFVALILITLRLAGMFIAAPGILPTGTPNILKAVLILILAYMVLPVINYS-GASALTEP 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                  + E   G   G +I ++ +  +  GS+I   +G ++ T    + +   T L  
Sbjct: 64  TKLIIQCLNEFSTGLAVGFIINLFFIAARIAGSIIDMQVGFSMVTLFDPTANSTATYLER 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +I ++  ++ID HH V  A + +Y  + IG            + +    + I ++++
Sbjct: 124 FFNLIAIMIFFIIDGHHYVIKAFIATYDKVSIGVFFLDQGTLQEILKLFGHFYAIGVKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   +V ++ +G+L++ +PQ+ I  +  P  + +G   L +S    V   ++SF  
Sbjct: 184 LPIILVILVADVLMGVLSRTMPQLNIMILGMPVKLLIGFGILAVSAPFFVRLITNSFQE 242


>gi|170757192|ref|YP_001782263.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum B1 str. Okra]
 gi|169122404|gb|ACA46240.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum B1
           str. Okra]
          Length = 609

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 106/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DINSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G ++ T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVINVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIVFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|148380604|ref|YP_001255145.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 3502]
 gi|153931538|ref|YP_001384891.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937825|ref|YP_001388360.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A str. Hall]
 gi|148290088|emb|CAL84207.1| flagellar biosynthetic protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152927582|gb|ABS33082.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. ATCC 19397]
 gi|152933739|gb|ABS39238.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A
           str. Hall]
          Length = 609

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 106/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DIRSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G ++ T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIVFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|322806976|emb|CBZ04546.1| flagellar biosynthesis protein FlhB [Clostridium botulinum H04402
           065]
          Length = 609

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 105/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DISSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G  + T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGAFFINQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIVFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|153939695|ref|YP_001391947.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum F str. Langeland]
 gi|152935591|gb|ABS41089.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. Langeland]
 gi|295319965|gb|ADG00343.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum F
           str. 230613]
          Length = 609

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 105/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DIRSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G  + T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGAFFLNQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIVFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFIFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|168180929|ref|ZP_02615593.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
 gi|182668325|gb|EDT80304.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum
           NCTC 2916]
          Length = 609

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 106/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DIRSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G ++ T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGTFFINQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + S
Sbjct: 180 IKIAVPIIFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSS 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|237796086|ref|YP_002863638.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
 gi|229263066|gb|ACQ54099.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum Ba4
           str. 657]
          Length = 609

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 105/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DIRSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G  + T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGTFFINQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIIFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|170761528|ref|YP_001787967.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408517|gb|ACA56928.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A3
           str. Loch Maree]
          Length = 609

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 105/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++  A+  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DIRSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G  + T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGTFFINQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIIFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|226950059|ref|YP_002805150.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
 gi|226843732|gb|ACO86398.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum A2
           str. Kyoto]
          Length = 609

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 104/241 (43%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +       ++ LI  R+     ++P       P+  ++   +  + +L+  + D   +  
Sbjct: 1   MISAAYATAIILISFRLFIFFSMVPIFFPKGTPVIGKVSLVLIIAYMLVGSI-DIRSINT 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             N       ++ E+  G + G +     +  ++ G+++   +G  + T    S +   T
Sbjct: 60  INNSTALIFNIVNEILAGAILGYITNAAFVCARYAGNMMDLQVGFAMMTMFDPSTNSNVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            L  ++     +  ++ID HH +  ALV+S+  I +G            +N+    F I 
Sbjct: 120 FLERILYWFSTIVFFLIDGHHMLIRALVESFNVIKLGAFFINQEGIKHVLNVFIQYFYIS 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +F  ++ ++++GL+ + VPQ+ I  +  P  I +G      ++ + +   + +
Sbjct: 180 IKIAVPIIFIILITDLTLGLVARTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSA 239

Query: 243 F 243
           F
Sbjct: 240 F 240


>gi|187778764|ref|ZP_02995237.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
 gi|187772389|gb|EDU36191.1| hypothetical protein CLOSPO_02359 [Clostridium sporogenes ATCC
           15579]
          Length = 587

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 99/219 (45%), Gaps = 1/219 (0%)

Query: 25  LLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHG 84
           ++P       P+  ++  A+  + +L+  + D   +    N       ++ E+  G + G
Sbjct: 1   MVPIFFPKGTPVIGKVSLALIIAYMLVGSI-DISSINTINNSTALIFNIVNEILAGAILG 59

Query: 85  LLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQ 144
            +     +  ++ G+++   +G ++ T    S +   T L  ++     +  ++ID HH 
Sbjct: 60  YITNAAFVCARYAGNMMDLQVGFSMMTMFDPSTNSNVTFLERILYWFSTIVFFLIDGHHM 119

Query: 145 VFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLN 204
           +  ALV+S+  I +G            +N+    F I ++++ P +F  ++ ++++GL+ 
Sbjct: 120 LIRALVESFNVIKLGAFFLNQEGIKHVINVFIQYFYISIKIAVPIVFIILITDLTLGLVA 179

Query: 205 KLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           + VPQ+ I  +  P  I +G      ++ + +   + +F
Sbjct: 180 RTVPQLNIMILGLPIKILVGLTAFVFALPLFLKVLNSAF 218


>gi|255305289|ref|ZP_05349461.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile ATCC 43255]
          Length = 604

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 102/233 (43%), Gaps = 2/233 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
             +  R+ +    L  L  +  P   +  FA+  SI++   +       N  N   ++  
Sbjct: 2   IFVFIRIVAFFGTLRILFSAGTPALFKSLFAIIISILISSTMQIEY-ATNIDNIVLFTLY 60

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + E   G + G +  +    ++  GS++   +GL++      +     T +N+L+    
Sbjct: 61  GINETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSMINMFDPNSMTQTTLINNLMNWTA 120

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L+  + +D HH +   +  S+  IPIG+     NI    +N+    F+   +++ P +  
Sbjct: 121 LMIFFSMDGHHVLIRGIRYSFELIPIGKSFVDNNI-DYIINIFVQCFLTGFKIAIPIVLC 179

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            ++ +  +GL+++ VPQ+ +  I  P  I +G     +SI +IV Q SH    
Sbjct: 180 LLMADFILGLISRSVPQLNVMIIGMPLKILVGIALFIISIPLIVNQISHLLSQ 232


>gi|126697834|ref|YP_001086731.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile 630]
 gi|115249271|emb|CAJ67084.1| Bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile]
          Length = 604

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 102/233 (43%), Gaps = 2/233 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
             +  R+ +    L  L  +  P   +  FA+  SI++   +       N  N   ++  
Sbjct: 2   IFVFIRIVAFFGTLRILFPAGTPALFKSLFAIIISILISSTMQIEY-ATNIDNIVLFTLY 60

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + E   G + G +  +    ++  GS++   +GL++      +     T +++L+    
Sbjct: 61  GVNETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSMINMFDPNSMTQTTLIDNLMNWTA 120

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
           L+  + +D HH +   +  S+  IPIG+     NI    +N+    F+   +++ P +  
Sbjct: 121 LMIFFSMDGHHVLIRGIRYSFELIPIGKPFVDNNI-DYIINIFVQCFLTGFKIAIPIVLC 179

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            ++ +  +GL+++ VPQ+ +  +  P  I +G     +SI +IV Q SH    
Sbjct: 180 LLMADFILGLISRSVPQLNVMIVGMPLKILVGIALFIISIPLIVNQISHLLSQ 232


>gi|254973928|ref|ZP_05270400.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-66c26]
 gi|255091314|ref|ZP_05320792.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile CIP 107932]
 gi|255312972|ref|ZP_05354555.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-76w55]
 gi|255515731|ref|ZP_05383407.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-97b34]
 gi|255648825|ref|ZP_05395727.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-37x79]
 gi|260682043|ref|YP_003213328.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile CD196]
 gi|260685641|ref|YP_003216774.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile R20291]
 gi|306518939|ref|ZP_07405286.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-32g58]
 gi|260208206|emb|CBA60557.1| flagellar export protein [Clostridium difficile CD196]
 gi|260211657|emb|CBE01921.1| flagellar export protein [Clostridium difficile R20291]
          Length = 604

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 101/233 (43%), Gaps = 2/233 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
             +  R+ +    L  L  +  P   +  FA+  SI++   +       N  N   ++  
Sbjct: 2   IFVFIRIVAFFGTLRILFPAGTPALFKSLFAIIISILISSTMQIEY-ATNIDNIVLFTLY 60

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
            + E   G + G +  +    ++  GS++   +GL++      +     T +++L+    
Sbjct: 61  GINETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSMINMFDPNSMTQTTLIDNLMNWTA 120

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
            +  + +D HH +   +  S+  IPIG+     NI    +N+    F+   +++ P +  
Sbjct: 121 RMIFFSMDGHHVLIRGIRYSFELIPIGKSFVDNNI-DYIINIFVQCFLTGFKIAIPIVLC 179

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            ++ +  +GL+++ VPQ+ +  I  P  I +G     +SI +IV Q SH    
Sbjct: 180 LLMADFILGLISRSVPQLNVMIIGMPLKILVGIALFIISIPLIVNQISHLLSQ 232


>gi|219854407|ref|YP_002471529.1| hypothetical protein CKR_1064 [Clostridium kluyveri NBRC 12016]
 gi|219568131|dbj|BAH06115.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 609

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 100/237 (42%), Gaps = 1/237 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
              +L L+  R+     ++P    +  P  V++   +  + +LLP + D   +    +  
Sbjct: 9   YFTALILVTLRIFCFFTMIPIFFPNGTPNIVKVGLTLVIAYILLPGI-DYSTVNTISSTI 67

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +    + E   G   G L+ +     +  GS +   +G ++ +    + S   T L  L
Sbjct: 68  PFVYNCINEAAAGLTLGFLVSLCFTAFRIAGSYMDLQVGFSMMSMFDPNSSSNTTLLERL 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +    ++    +D HH +  +L+ S+ TI +G         +  +      F I L+++ 
Sbjct: 128 MYWFCMVVFLAVDGHHMLIRSLIDSFATIKLGSFFLAQGSINIIIKAFIMYFSIALKIAI 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           P L   ++ ++++ L+ + VPQ+ I  +  P  I +G    C ++ I +    +SF 
Sbjct: 188 PILLIILIADLTMSLIARTVPQLNIMILGLPIKILIGLGSFCFALPIFLKIMGNSFQ 244


>gi|33601553|ref|NP_889113.1| flagellar biosynthetic protein [Bordetella bronchiseptica RB50]
 gi|33575989|emb|CAE33069.1| flagellar biosynthetic protein [Bordetella bronchiseptica RB50]
          Length = 262

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 101/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        R+ + +   P  S S IP +V++  A   +I + P +     +      
Sbjct: 11  GWLAQFLWPFVRILALVGAAPLFSESTIPTRVKIGLAFMLTIAVAPAIGPMPAVPPSSYA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   GL +RV    +Q  G  +   +GL+  +    +       L+ 
Sbjct: 71  GLF--LLGQQVLIGIALGLSMRVVFAAVQTAGEFVGLQMGLSFASFFDPATGANTAVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  I+ +L    +D H  V  ALV+S+ T+P+   +   N +        T F+  L L+
Sbjct: 129 LFNIVAMLVFLALDGHLLVLGALVRSFDTLPVAVGVLDRNGWGILAEWGTTIFVSGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ+ ++ I  P  + +G + L + +          F  G
Sbjct: 189 LPLICALLTINLAMGILNRAAPQLSVFAIGFPVSLIVGLVLLAIVLPHSGPFLERLFEQG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|251779901|ref|ZP_04822821.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243084216|gb|EES50106.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 613

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/236 (19%), Positives = 110/236 (46%), Gaps = 1/236 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              ++LF I  R+ S  +++     +  P  ++   ++  SI ++  + D   +    N 
Sbjct: 5   AYFLALFFIFLRLTSYFVIVNAFFQTGTPHILKGVLSLIISIAVIAGV-DYSTVNEINNV 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            Y     + E+  G V G +  +    ++F GS +    G ++ + +  +     T + +
Sbjct: 64  YYLIIYGLNEVMTGLVLGFITNMIFEVVKFAGSWMDIHAGFSMVSVLDPTSHTQSTLIGN 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +I  +  +++D HH V   L++S+  +PIG+ L +     + ++ +   F++ ++++
Sbjct: 124 FAYMIATVIFFIVDGHHIVIKLLIESFRIVPIGETLVYQETMMAVISTITDYFVLGVKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P +   ++ ++ +GL+++ VP IPI     P    LG +   + + +I    S++
Sbjct: 184 IPIVLIIVITDLCLGLISRTVPTIPIMIFGLPIKNLLGLITFVILLPLIFKIVSNA 239


>gi|188588311|ref|YP_001920219.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum E3 str. Alaska E43]
 gi|188498592|gb|ACD51728.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum E3
           str. Alaska E43]
          Length = 610

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/236 (19%), Positives = 110/236 (46%), Gaps = 1/236 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              ++LF I  R+ S  +++     +  P  ++   ++  SI ++  + D   +    N 
Sbjct: 5   AYFLALFFIFLRLTSYFVIVNAFFQTGTPHILKGALSLIISIAVIAGV-DYSTVNEINNV 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            Y     + E+  G V G +  +    ++F GS +    G ++ + +  +     T + +
Sbjct: 64  YYLIIYGLNEVMTGLVLGFITNMIFEVVKFAGSWMDIHAGFSMVSVLDPTSHTQSTLIGN 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +I  +  +++D HH V   L++S+  +PIG+ L +     + ++ +   F++ ++++
Sbjct: 124 FAYMIATVIFFIVDGHHIVIKLLIESFRIVPIGETLVYQETMMAVISTITEYFVLGVKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P +   ++ ++ +GL+++ VP IPI     P    LG +   + + +I    S++
Sbjct: 184 IPIVLIIVITDLCLGLISRTVPTIPIMIFGLPIKNLLGLITFVILLPLIFKIVSNA 239


>gi|153953791|ref|YP_001394556.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           kluyveri DSM 555]
 gi|146346672|gb|EDK33208.1| Fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium kluyveri DSM 555]
          Length = 606

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 100/237 (42%), Gaps = 1/237 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
              +L L+  R+     ++P    +  P  V++   +  + +LLP + D   +    +  
Sbjct: 6   YFTALILVTLRIFCFFTMIPIFFPNGTPNIVKVGLTLVIAYILLPGI-DYSTVNTISSTI 64

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +    + E   G   G L+ +     +  GS +   +G ++ +    + S   T L  L
Sbjct: 65  PFVYNCINEAAAGLTLGFLVSLCFTAFRIAGSYMDLQVGFSMMSMFDPNSSSNTTLLERL 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +    ++    +D HH +  +L+ S+ TI +G         +  +      F I L+++ 
Sbjct: 125 MYWFCMVVFLAVDGHHMLIRSLIDSFATIKLGSFFLAQGSINIIIKAFIMYFSIALKIAI 184

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           P L   ++ ++++ L+ + VPQ+ I  +  P  I +G    C ++ I +    +SF 
Sbjct: 185 PILLIILIADLTMSLIARTVPQLNIMILGLPIKILIGLGSFCFALPIFLKIMGNSFQ 241


>gi|187933790|ref|YP_001885058.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum B str. Eklund 17B]
 gi|187721943|gb|ACD23164.1| flagellar biosynthetic protein FliR/FlhB [Clostridium botulinum B
           str. Eklund 17B]
          Length = 613

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 109/237 (45%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              ++LF I  R+ S  +++     +  P  ++   ++  SI +L  + D   +    N 
Sbjct: 5   AYFLALFFIFLRLTSYFVIVNAFFQTGTPHILKGTLSLIISIAVLAGV-DYSTVNEINNV 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            Y     + E+  G V G +  +    ++F GS +    G ++ + +  +     T + +
Sbjct: 64  YYLIIYGLNEVMTGLVLGFITNMIFEVVKFAGSWMDIHAGFSMVSVLDPTSHSQTTLIGN 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +I  +  +++D HH V   L++S+  +PIGQ L +     + ++ +   F++ ++++
Sbjct: 124 FSYMIATVIFFIVDGHHIVIKLLIESFRIVPIGQTLVYQETMMAVISTITEYFVLGVKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            P +   ++ ++ +GL+++ VP IPI     P    LG +   + + +I    S + 
Sbjct: 184 VPIVLIIVITDLCLGLISRTVPTIPIMIFGLPIKNLLGLITFVILLPLIFKIVSSAI 240


>gi|33592490|ref|NP_880134.1| flagellar biosynthetic protein FliR [Bordetella pertussis Tohama I]
 gi|33572136|emb|CAE41679.1| flagellar biosynthetic protein FliR [Bordetella pertussis Tohama I]
 gi|332381908|gb|AEE66755.1| flagellar biosynthetic protein FliR [Bordetella pertussis CS]
          Length = 262

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 101/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        R+ + +   P  S S IP +V++  A   +I + P +     +      
Sbjct: 11  GWLAQFLWPFVRILALVGAAPLFSESTIPTRVKIGLAFMLTIAVAPAIGPMPAVPPSSYA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   GL +RV    +Q  G  +   +GL+  +    +       L+ 
Sbjct: 71  GLF--LLSQQVLIGIALGLSMRVVFAAVQTAGEFVGLQMGLSFASFFDPATGANTAVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  I+ +L    +D H  V  ALV+S+ T+P+   +   N +        T F+  L L+
Sbjct: 129 LFNIVAMLVFLALDGHLLVLGALVRSFDTLPVAVGVLDRNGWGILAEWGTTIFVSGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ+ ++ I  P  + +G + L + +          F  G
Sbjct: 189 LPLICALLTINLAMGILNRAAPQLSVFAIGFPVSLIVGLVLLAIVLPHSGPFLERLFEQG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|254519406|ref|ZP_05131462.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
 gi|226913155|gb|EEH98356.1| flagellar biosynthetic protein FlhB [Clostridium sp. 7_2_43FAA]
          Length = 614

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 54/233 (23%), Positives = 120/233 (51%), Gaps = 1/233 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              ++LF I  RV +   +      +  P  ++  F++ FS  LL  + D  ++ +  + 
Sbjct: 5   AYFLALFFIFLRVTAFFAITNIFFPNGTPKTLKAMFSLIFSFALLGGI-DYSNINSITSN 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            Y    ++ E+  G V GL+  +    +   GS+I   IGL++  ++  +   + T   +
Sbjct: 64  YYLIIYMISEVTTGLVLGLISNIAFEVVLMAGSLIDVHIGLSMVNTIDPNSKTSTTISGN 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+  + L+  +V+D HH +  +L++S+  +P+G+ L + +     + ++   F+I L+++
Sbjct: 124 LLHYVALMIFFVVDGHHMLIKSLIESFIILPMGKSLMYTDTMMVLIEVIAKYFVIGLKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            P +   I+ ++ +GL+++ VPQI +  +  P  + +G L + +S+ II+  F
Sbjct: 184 IPIVLIIILTDLCMGLISRAVPQINVMILGMPVKMLVGILAISVSLPIIIKLF 236


>gi|255523689|ref|ZP_05390655.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
 gi|296186693|ref|ZP_06855095.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
 gi|255512558|gb|EET88832.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
 gi|296048730|gb|EFG88162.1| flagellar biosynthetic protein FliR [Clostridium carboxidivorans
           P7]
          Length = 320

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 110/236 (46%), Gaps = 1/236 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
              +L LI  R+    +++P    S  P  V++   +  + +L+P +  T  + N  N  
Sbjct: 6   YFTALILISIRMFCFFVVVPIFFPSGTPATVKVGITLIMAYILIPGVDYT-GINNINNNL 64

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +    M E   G   G +  +    ++F GS++   +G ++ T    + S   T +  +
Sbjct: 65  PFIINCMNEAVAGFTLGFITNLCFNSVRFAGSIMDMQVGFSMMTMFDPTSSSNTTLIEHI 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +    ++  +++D HH +  AL++S+  I +G      N  +  + +    F I ++++ 
Sbjct: 125 LYWFSMVVFFIVDGHHMLIKALIESFKVIKLGNFFLNQNSINLIIRVFIEYFEIAVKIAI 184

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   ++ +I++GL+++ VPQ+ +  +  P  I +G    C ++ I +    +SF
Sbjct: 185 PIVLIILITDITMGLVSRTVPQLNVMILGMPVKILVGLGAFCFALPIFLKMIENSF 240


>gi|317406212|gb|EFV86460.1| flagellar biosynthetic protein FliR [Achromobacter xylosoxidans
           C54]
          Length = 262

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 103/241 (42%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        R+ + +   P  S S +P++V++  A   ++ + P L     +      
Sbjct: 11  GWIGQFLWPFVRILALVGTAPLFSESTVPVKVKIGLAFVLAVAVSPALDPAPPIAPGSFA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +VM ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+ 
Sbjct: 71  GLW--MVMQQVLIGIAMGFTMRLVFAAVQTAGEFVGLQMGLSFASFFDPSTGANTAVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  I+ +L    +D H  V  ALV+S+ T+P+       N +   V   +T F+  L L+
Sbjct: 129 LFNIVAMLTFLALDGHLLVLAALVRSFDTLPVAAIQLHQNGWGVVVEWGKTVFVSGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ+ ++ +  P  + +G + L + +          F  G
Sbjct: 189 LPLICALLTINLAMGILNRAAPQLSVFSVGFPVSLIVGVVLLTVVLPNSGPFLESLFESG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|163856446|ref|YP_001630744.1| flagellar biosynthesis protein FliR [Bordetella petrii DSM 12804]
 gi|163260174|emb|CAP42476.1| flagellar biosynthesis protein FliR [Bordetella petrii]
          Length = 262

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 102/242 (42%), Gaps = 2/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  ++       R+ + +   P  S S IP+++++  A   ++ + P L     +     
Sbjct: 10  DAWLLQFLWPFVRMLALVGSAPLFSESTIPIRIKVALAFMLTVAVAPGLEPPPAIPPGSY 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              +  L+  ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+
Sbjct: 70  AGLW--LLGQQVLIGIAMGFTMRIVFAAVQTAGEFVGLQMGLSFASFFDPSTGANTAVLS 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ I+ +L    +D H  V  ALV+S+  +P+ Q     N +   V   QT F+  L L
Sbjct: 128 RLLNIVAMLVFLALDGHLLVLAALVRSFDVLPLTQLTLDPNGWGILVQWGQTIFVSGLLL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN+  PQ+ ++ +  P  +  G L L   +             
Sbjct: 188 ALPLICALLTINLAMGILNRAAPQLSVFAVGFPVSLITGLLLLAAVLPHAAPFLEGLMRD 247

Query: 246 GF 247
           G 
Sbjct: 248 GL 249


>gi|150019066|ref|YP_001311320.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           beijerinckii NCIMB 8052]
 gi|149905531|gb|ABR36364.1| flagellar biosynthetic protein FlhB [Clostridium beijerinckii NCIMB
           8052]
          Length = 613

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 102/232 (43%), Gaps = 1/232 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
             ++LFLI  R+ S  M +     +  P  ++  F++  S  ++  + D   +    +  
Sbjct: 6   YFLALFLIFLRITSYFMAVQIFFPTGTPQIMQGVFSLILSFGIVAGI-DHSTVSAVNSSY 64

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
                 + E+  G + G +  +    ++  G  +    G ++ + +  +     T L +L
Sbjct: 65  MLVFYAISEIMSGLILGYITNLIFQVVKLAGEWMDIHAGFSMVSVLDPTTQTTSTLLGNL 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              I L   +++D HH V   LV+S   IPIG+ + +       +  +   F + ++++ 
Sbjct: 125 SYFISLAFFFIVDGHHVVINMLVESTKIIPIGKTIVYQETLMEVMKTIFDYFTLGVKIAI 184

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           P +   ++ ++ +GL+++ VP IPI  +  P    LG +   + + +++   
Sbjct: 185 PIVLIIVITDVCLGLISRTVPTIPIMILGMPIKNLLGLITYIILLPLMLKLI 236


>gi|293605016|ref|ZP_06687411.1| flagellar biosynthetic protein FliR [Achromobacter piechaudii ATCC
           43553]
 gi|292816585|gb|EFF75671.1| flagellar biosynthetic protein FliR [Achromobacter piechaudii ATCC
           43553]
          Length = 262

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 101/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        R+ + +   P  S S IP++V++  +   ++ + P L     +      
Sbjct: 11  GWIGQFLWPFVRILALVGTAPLFSESAIPVKVKVGLSFVLAVAVSPALDPMPPIAPGSYA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +VM ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+ 
Sbjct: 71  GLW--MVMQQVLIGIAMGFTMRIVFAAVQTAGEFVGLQMGLSFASFFDPSSGANTAVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  ++ +L    +D H  V  ALV+S+ T+P+       N +   V   +T F+  L L+
Sbjct: 129 LFNMVAMLTFLALDGHLLVLAALVRSFDTLPVAAIQLHQNGWGVVVEWGKTVFVSGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+   Q+ ++ +  P  + +G   L + +          F  G
Sbjct: 189 LPLICALLTINLAMGILNRAAQQLSVFSVGFPVTLIIGVTVLTVVLPHAGPFLETLFESG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|253681513|ref|ZP_04862310.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
 gi|253561225|gb|EES90677.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           botulinum D str. 1873]
          Length = 610

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 107/237 (45%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              + +FLI  R+ S + ++P       P  V++ F +  S +++P + D  ++ N    
Sbjct: 5   GYFLGIFLISLRMFSFVEVVPIFFPKGTPNVVKIMFTVILSFMIIPGI-DYSNISNINGN 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                  ++E+  G   G +  +    +++ G+ +   +G  + T    + +   T +  
Sbjct: 64  LQLIMYCLIEITTGLTFGFITNICFSCIRYAGAFMDLQVGFAMITMFDPNSNSNVTLIER 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+    L+   ++D    +    ++S+  I IG+ +   N     +N+    F + +R++
Sbjct: 124 LLYWFSLIVFIIVDGPRMIIKIFIESFNVIHIGKFILNQNSAMHVINVFVKYFQLGIRIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            P +   I+ ++++GL+ K VPQ+ I  +  P  I LG   + LS+ +I      SF
Sbjct: 184 IPIVLIIILTDLTMGLVAKTVPQLNIMILGMPVKIILGLSVIALSLPVIFNIIISSF 240


>gi|182418459|ref|ZP_02949753.1| fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium butyricum 5521]
 gi|237666957|ref|ZP_04526942.1| flagellar biosynthetic protein FliR/FlhB [Clostridium butyricum E4
           str. BoNT E BL5262]
 gi|182377841|gb|EDT75385.1| fusion of flagellar biosynthesis proteins FliR and FlhB
           [Clostridium butyricum 5521]
 gi|237658156|gb|EEP55711.1| flagellar biosynthetic protein FliR/FlhB [Clostridium butyricum E4
           str. BoNT E BL5262]
          Length = 612

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 99/239 (41%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              + +FLI  R+ S  +       S  P+  +  F++  +  ++  + D   +    + 
Sbjct: 5   AYFLGIFLIFLRISSYFVATNIFFPSGTPIMFKTGFSIIIAYGIILGV-DHSTILAIDSN 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
              +  ++ E+  G + G +  +     +  GS I    G ++ T +  +   + T + +
Sbjct: 64  YMIAFYIISEVLTGLILGYITNLVFQAAKLAGSWIDIHAGFSMVTVLDPATQTSTTLMGN 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L   + L+  ++I+    +  ++ +S   +P+G  + +          +   F++ ++++
Sbjct: 124 LFYFVSLVFFFMINGQELIVKSIYESISIVPLGHTIVYQETVMGAAETIVDFFVLGVKIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   ++ +I +GL+ + VP IPI     P    LG +   + +  ++     +   
Sbjct: 184 LPIVLIIVMTDICLGLITRTVPTIPIMIFGMPIKNILGFITFLIIMPTMLKIIGTAIYE 242


>gi|73539699|ref|YP_300066.1| flagellar biosynthesis protein FliR [Ralstonia eutropha JMP134]
 gi|72123036|gb|AAZ65222.1| Flagellar biosynthesis protein FliR [Ralstonia eutropha JMP134]
          Length = 261

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 100/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + I   P    S IP +V++  A   ++V+ P L +   +  +  +
Sbjct: 11  GWIATFLWPFFRLLALIGTAPLFGESTIPGRVKVGLAALTAMVVSPTLGNLPVVPVYSWQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ E+ +G   G  +R+    +Q  G +I   +GL   +    +       L  
Sbjct: 71  G--LIIILNEVGIGLATGFTMRLVFAIVQQAGEIIGMQMGLGFASFFDRAAGGQTMVLAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + II +L    +D H  +  ALV S+  +PIG     G  + +        F   L L+
Sbjct: 129 FLNIIAVLLFLAMDGHLLMLGALVDSFQGLPIGATPVSGEGWHAVARAGGMVFSSGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ+ I+ +  P  +  G L L L +  +     H    G
Sbjct: 189 LPMIAALLTLNLAMGILNRASPQLSIFAVGFPVTLSGGLLVLALVMPQMGSYMQHMIEAG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|82702486|ref|YP_412052.1| flagellar biosynthetic protein FliR [Nitrosospira multiformis ATCC
           25196]
 gi|82410551|gb|ABB74660.1| flagellar biosynthetic protein FliR [Nitrosospira multiformis ATCC
           25196]
          Length = 260

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 99/246 (40%), Gaps = 2/246 (0%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           ++     ++S F    R+ + + + P L    +P++V++   +  ++V+ P L     ++
Sbjct: 6   SVDLNAWLISFFWPAARILALLSVAPVLGNLAVPVRVKVGLGVLVALVVAPTLESVPKIE 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                         ++ +G   G  +R+    ++  G +    +GL   T        + 
Sbjct: 66  LASAPGLLVL--GQQIMIGLAMGFAMRIIFSAIELAGEIAGLQMGLGFATFFTPHSDGSS 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             L   +G++G LA    + H  +  AL+ S+   PI  E      +          F +
Sbjct: 124 LVLGRFLGLLGTLAFLSFNGHLLMLSALIDSFNAFPISTEPFSNMGWKRLAEWGSVIFSV 183

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L+L+ P +   ++ N+++G+L +  PQ+ I+ +  P  + +G   L LS+         
Sbjct: 184 GLQLALPVVAALLIVNLALGILTRASPQLNIFAVGFPITLMIGMSALMLSLPHFTPVLER 243

Query: 242 SFLYGF 247
               G 
Sbjct: 244 LITDGL 249


>gi|186477690|ref|YP_001859160.1| flagellar biosynthetic protein FliR [Burkholderia phymatum STM815]
 gi|184194149|gb|ACC72114.1| flagellar biosynthetic protein FliR [Burkholderia phymatum STM815]
          Length = 260

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 106/240 (44%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + +      R+ + +   P      +P +V++  A   ++++ P +        F  +
Sbjct: 11  VWLTAFLWPFVRILALMATAPAFGDKSLPNRVKIGLAGFVTLIVAPTIGALPSATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    +Q  G +I  ++GL   T      + +   ++ 
Sbjct: 71  GIWI--IVNQFLIGAALGFTMQIVFGAVQAAGDIIGMSMGLGFATFFDPHAAGSTDVMSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + +I +L    +D H QV  ALV+++  +P+   +   N +   V    T     L LS
Sbjct: 129 YVYMIAILTFLALDGHLQVLSALVQTFQALPVSANVLGANGWRVLVGWGSTVVSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQ+ ++ +  P  +  G L + L +  ++  F+  F  G
Sbjct: 189 LPIVTALLITNLALGILNRAAPQVGVFQVGLPVTVITGLLLIQLMLPNMMPFFARVFESG 248


>gi|288942623|ref|YP_003444863.1| flagellar biosynthetic protein FliR [Allochromatium vinosum DSM
           180]
 gi|288897995|gb|ADC63831.1| flagellar biosynthetic protein FliR [Allochromatium vinosum DSM
           180]
          Length = 260

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 101/240 (42%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
             +SL     R+ + ++++P      I  +VRL  A+  + ++ P L +   +       
Sbjct: 14  WTVSLVWPFVRISAMLLVMPVFGARQINARVRLGLALLLAWMIAPQLPEVPAIDPLSVGG 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               + + +  +G   G ++ +    +   G  I+ ++GL   +++     +    ++  
Sbjct: 74  --VVVAIEQALIGIAMGFVVTLVFSAINQAGEAIALSMGLGFASAVDPVGGVQVPMISQY 131

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + II  L    ++ H  +F  L++S+ T PIG +           N     F   + ++ 
Sbjct: 132 LSIIATLIFLAMNGHLVLFELLLRSFETFPIGLDGPDNEDLWYIANFGSQMFAGAVLIAL 191

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ N+++G++ +  PQ+ I+ I  P  I  G L + L++  +  +     L   
Sbjct: 192 PAVASLLLVNLAMGVVTRAAPQLNIFAIGFPITILAGFLIILLTLPSLTARIGDFLLTAL 251


>gi|146312187|ref|YP_001177261.1| flagellar biosynthesis protein FliR [Enterobacter sp. 638]
 gi|145319063|gb|ABP61210.1| flagellar biosynthetic protein FliR [Enterobacter sp. 638]
          Length = 264

 Score =  131 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 56/241 (23%), Positives = 105/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + IM  P LS   IP +V++   M  + V+ P L     +   +  
Sbjct: 11  EWLGLYFWPLLRVMALIMTAPILSEKSIPKRVKIGLGMLITFVIAPTLP---PVNVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L + ++ +G   G  +++    ++  G +I   +GL+  T       L    L  
Sbjct: 68  PQAIWLALQQVLIGVAIGFTMQLAFAAIRTAGELIGLQMGLSFATFFDPGSHLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +I ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+
Sbjct: 128 VIDMLAMLLFLTFNGHLWLISMLVDTFHTLPIGGNPVNSNAFLALTRAAGLIFINGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+S+GLLN++ PQ+ ++ I  P  + +G + + L + +I     H F   
Sbjct: 188 LPVITLLLTVNLSLGLLNRMAPQLSVFVIGFPITLTVGLILMGLLMPLIAPFCEHLFSEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|307318937|ref|ZP_07598368.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti AK83]
 gi|306895351|gb|EFN26106.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti AK83]
          Length = 250

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 148/243 (60%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G C+M++PG S + +PMQ+RL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGTVLALFAAFCRIGGCVMIMPGFSTARVPMQIRLFIAVALSMAILPIMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  LV  E  +G V GL+ R Y LGLQF G+ I+  +G     +  + +  A
Sbjct: 61  QVTGKGHDYLYLVATETAVGAVIGLVARYYVLGLQFAGTAITMLMGFGSPPAADVLEDTA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L S+IG  GL+ L+++DFHH +F A+ +SY  +PIG   +      +  N L  TFM
Sbjct: 121 ENQLTSMIGFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGTLITLTNSLGQTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SPF+ + ++FN++IG++NKL PQIP+YFIS PYLI  G   L L I  ++  F+
Sbjct: 181 IMLRLASPFVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLIMGGLFLLYLGIAAMLRLFA 240

Query: 241 HSF 243
             F
Sbjct: 241 DGF 243


>gi|187478198|ref|YP_786222.1| flagellar biosynthetic protein [Bordetella avium 197N]
 gi|115422784|emb|CAJ49312.1| flagellar biosynthetic protein [Bordetella avium 197N]
          Length = 264

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 98/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M        R+ + +   P  S S IP++V++  A   +  + P L     +      
Sbjct: 11  GWMGQFLWPFIRILALVGSAPLFSESTIPVKVKIGLAFMLAAAIAPGLPPMPSVSPSSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L+  ++ +G   G  +RV    +Q  G  I   +GL+  +            L+ 
Sbjct: 71  G--LLLLAQQVLIGVALGFTMRVVFSAVQTAGEYIGLQMGLSFASFFDPGTGANTAVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+ +L    +D H  +  ALV+S+  +P+   +   N     V    T F+  L L+
Sbjct: 129 FMNILAMLIFLALDGHLLMLAALVRSFDILPLTPAVLDRNGLGVLVQWGGTVFISGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ+ ++ +  P ++ +G L L + +          F  G
Sbjct: 189 LPLVCALLTINLAMGILNRAAPQLTVFAVGFPIMLTIGLLVLSVVLPHSGPFLEQLFERG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|222147597|ref|YP_002548554.1| flagellar biosynthesis protein FliR [Agrobacterium vitis S4]
 gi|221734585|gb|ACM35548.1| flagellar biosynthetic protein FLIR [Agrobacterium vitis S4]
          Length = 250

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 98/247 (39%), Positives = 157/247 (63%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+GSC M +PG + S IP Q+RL  A+A S+   P +WDT+  
Sbjct: 1   MITDPQGSVLALFLVFCRIGSCFMTMPGFASSRIPTQIRLLLAVAVSMACTPLVWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +     + +  L+  E  +G V GL+ R +TLGLQF G++++  IG N   +  + +  A
Sbjct: 61  KVSSGGSIFVALIFTETLIGAVFGLITRFFTLGLQFAGAILTMMIGFNSTATADVLEDGA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  + ++I   GL+ L+++DFHH VF AL+ SY  +P+G   +   +  +  +    T+M
Sbjct: 121 ENQMTNMISFCGLMMLFMMDFHHVVFRALIDSYTVMPMGGVPDTQKMLITLTDTASRTYM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +MLRLSSPF+ + ++FN+ +GL+NKL PQIP+Y+ISTPYLI  G L +  SI +++ QF+
Sbjct: 181 LMLRLSSPFIIYGLMFNLGVGLVNKLAPQIPVYYISTPYLITGGMLLVYWSIGVMMRQFA 240

Query: 241 HSFLYGF 247
            +F+  F
Sbjct: 241 DAFIPIF 247


>gi|253573536|ref|ZP_04850879.1| flagellar biosynthetic protein FliR [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251847064|gb|EES75069.1| flagellar biosynthetic protein FliR [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 262

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 108/243 (44%), Gaps = 7/243 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    LI CR+ +  ++ P  S   +P   ++ FA   ++V+L  +     +    N   
Sbjct: 8   ISIFMLIFCRMTAFFVVSPIFSSRSVPNTFKVGFAGIIAVVILLTIGPNQSIP---NDLG 64

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  +++ E+ +G + G +  +    +Q  GS I   IG  +   +      +   L +L 
Sbjct: 65  YILVIIREVLVGLLMGYVANLIFSVIQMAGSFIDIQIGFGIANVIDPMTGASAPVLGNLK 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIP----IGQELNFGNIFSSFVNMLQTTFMIMLR 184
            II  L    ++ HH +  A+++SY  +P    + Q++  GN+    V      FM+  +
Sbjct: 125 YIIATLVFLSMNGHHYLLDAVIRSYNWVPLSNQVFQQIYNGNLSEFLVQTFSQAFMLAFQ 184

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +S+P +    V ++++G L +  PQ  I+ I  P  I +G L L + +   +  F   F 
Sbjct: 185 MSAPLVVALFVTDVALGFLARTAPQFNIFVIGIPVKIIVGLLVLLVLVPGFIVAFQALFE 244

Query: 245 YGF 247
             F
Sbjct: 245 VLF 247


>gi|311105948|ref|YP_003978801.1| flagellar biosynthetic protein FliR [Achromobacter xylosoxidans A8]
 gi|310760637|gb|ADP16086.1| flagellar biosynthetic protein FliR [Achromobacter xylosoxidans A8]
          Length = 262

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 102/241 (42%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        R+ + +   P  S S IP++V++  +   ++ + P L     +      
Sbjct: 11  GWIGQFLWPFVRILALVGTAPLFSESLIPIKVKIGLSFVLAVAISPALDPVPPIAPGSFT 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +VM ++ +G   G  +R+    +Q  G  +   +GL+  +    S       L+ 
Sbjct: 71  GLW--MVMQQVLIGIALGFTMRLVFAAVQTAGEFVGLQMGLSFASFFDPSSGANTAVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  II +L    +D H  V  ALV+S+ T+P+       N F   V   +T F+  L L+
Sbjct: 129 LFNIIAMLTFLALDGHLLVLAALVRSFDTLPVAMIQLHQNGFGVVVEWGKTIFISGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+   Q+ ++ I  P  + +G   L + +          F  G
Sbjct: 189 LPLICALLTINLAMGILNRAAQQLSVFSIGFPVTLIIGVTILTVVLPHAGPFLESLFESG 248

Query: 247 F 247
           F
Sbjct: 249 F 249


>gi|254780511|ref|YP_003064924.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040188|gb|ACT56984.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 248

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 248/248 (100%), Positives = 248/248 (100%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL
Sbjct: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA
Sbjct: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM
Sbjct: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS
Sbjct: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240

Query: 241 HSFLYGFF 248
           HSFLYGFF
Sbjct: 241 HSFLYGFF 248


>gi|150395511|ref|YP_001325978.1| flagellar biosynthesis protein FliR [Sinorhizobium medicae WSM419]
 gi|150027026|gb|ABR59143.1| flagellar biosynthetic protein FliR [Sinorhizobium medicae WSM419]
          Length = 250

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 101/243 (41%), Positives = 149/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G CIM++PG S + +PMQ+RL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQIRLFVAVAISMAILPVMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  LV  E  +G V GL+ R Y LGLQF G+ ++  +G +   +  + +  A
Sbjct: 61  QVTGKGHDYLYLVATETAVGAVIGLVARYYVLGLQFAGTAMTMMMGFSPPPTADVLEDTA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L SLI   GL+ L+++DFHH +F A+ +SY  +PIG   +   +  +  N L+ TFM
Sbjct: 121 ENQLTSLISFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGMLITLTNSLEQTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SP + + ++FN++IG++NKL PQIP+YFIS PYLI  G   L L I  ++  F+
Sbjct: 181 IMLRLASPLVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLIMGGLFLLYLGIAAMLRLFA 240

Query: 241 HSF 243
             F
Sbjct: 241 DGF 243


>gi|15964440|ref|NP_384793.1| flagellar biosynthesis protein FliR [Sinorhizobium meliloti 1021]
 gi|307311582|ref|ZP_07591223.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti BL225C]
 gi|15073617|emb|CAC45259.1| Probable flagellar biosynthetic transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306899599|gb|EFN30228.1| flagellar biosynthetic protein FliR [Sinorhizobium meliloti BL225C]
          Length = 250

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 149/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE ++++LF   CR+G C+M++PG S + +PMQ+RL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGMVLALFAAFCRIGGCVMIMPGFSTARVPMQIRLFIAVALSMAILPIMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  LV  E  +G V GL+ R Y LGLQF G+ I+  +G     +  + +  A
Sbjct: 61  QVTGKGHDYLYLVATETAIGAVIGLVARYYVLGLQFAGTAITMLMGFGSPPAADVLEDTA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L S+IG  GL+ L+++DFHH +F A+ +SY  +PIG   +      +  N L  TFM
Sbjct: 121 ENQLTSMIGFAGLMILFMLDFHHVIFEAIAQSYRVMPIGAGFDPQGTLITLTNSLGQTFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SPF+ + ++FN++IG++NKL PQIP+YFIS PYLI  G   L L I  ++  F+
Sbjct: 181 IMLRLASPFVIYGLLFNVAIGMVNKLAPQIPVYFISQPYLIMGGLFLLYLGIAAMLRLFA 240

Query: 241 HSF 243
             F
Sbjct: 241 DGF 243


>gi|291613056|ref|YP_003523213.1| flagellar biosynthetic protein FliR [Sideroxydans lithotrophicus
           ES-1]
 gi|291583168|gb|ADE10826.1| flagellar biosynthetic protein FliR [Sideroxydans lithotrophicus
           ES-1]
          Length = 262

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 105/241 (43%), Gaps = 2/241 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + +    + R+ + I   P   +  +P ++++ FA+A +I++ P L    +L     
Sbjct: 10  SAWLAAFIFPLARILALIASSPLYGIKEVPARIKVGFAIAITIIIAPTLDIPANLDPASA 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           +  +  +   ++  G + G  IR+  + ++  G +    +GL   +     ++     + 
Sbjct: 70  QGLFVLV--QQIVAGVIIGFSIRLIFVAVEMAGDLTGMQMGLGFASFYDPVNATFTPIVA 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             +GI+  LA    + H  +  AL  S+   PIG  +   + F +      + F   L+ 
Sbjct: 128 QFLGILASLAFLAANGHLYLLVALADSFRDFPIGATVPSAHAFRTMAEWGGSLFSHALQF 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +   ++ NI++G+L +  PQ+ I+ +  P  I +G + L L++  +     +    
Sbjct: 188 SLPLIGALLITNIALGILARSAPQLNIFAVGFPITIAVGFVTLWLTLPYLAPVMDYFTHE 247

Query: 246 G 246
           G
Sbjct: 248 G 248


>gi|209547954|ref|YP_002279871.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533710|gb|ACI53645.1| type III secretion system inner membrane R protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 250

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 103/243 (42%), Positives = 153/243 (62%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A+A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIALALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L++ E  +G ++G+L R+YTLG+QF  ++I+T +G     S  I +   
Sbjct: 61  AVHTGSGTYIGLIVSESLIGVMYGMLARIYTLGMQFAATIIATMVGYTQPGSADIIEDTP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E+ L+  I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ T  
Sbjct: 121 ESSLSGFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFSDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G   +  SI  +V QF 
Sbjct: 181 IMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLVYFSIAALVSQFG 240

Query: 241 HSF 243
            SF
Sbjct: 241 QSF 243


>gi|332799193|ref|YP_004460692.1| flagellar biosynthetic protein FliR [Tepidanaerobacter sp. Re1]
 gi|332696928|gb|AEE91385.1| flagellar biosynthetic protein FliR [Tepidanaerobacter sp. Re1]
          Length = 258

 Score =  128 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/247 (17%), Positives = 109/247 (44%), Gaps = 3/247 (1%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M ++ E+ ++   LI+ R    + L P      IP Q+++  A   S ++ P +    +L
Sbjct: 1   MNVNYEVALIKYLLILFRCLGFLTLTPVFGRREIPFQIKIGLAALLSFIVYPIIP---EL 57

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +   N    S  V+ EL  G   G    +    L   G +I   +G  +   +    +  
Sbjct: 58  ELNNNLWIVSASVLRELMAGITMGYATFLLFSSLYLAGGIIDLEMGFGMVNVLDPQSNAQ 117

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              + +   I+ +L    ++ HH +  A++KSY  +P+G+ +    + +  +   +  F+
Sbjct: 118 VPLMGNYYYILTILLFLTVNGHHMLISAIIKSYDLLPLGKPVYQEGLLNVIIVSFKDMFI 177

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + ++++ P      + + ++G++ + VPQ+ ++ +  P  I +G + + +   + +    
Sbjct: 178 LGVQIALPVTAIIFLTDFALGIIARTVPQMNVFIVGLPLKIAIGMIGMIIVFPMYLVILD 237

Query: 241 HSFLYGF 247
           + +   +
Sbjct: 238 YIYNGTY 244


>gi|261340415|ref|ZP_05968273.1| flagellar biosynthetic protein FliR [Enterobacter cancerogenus ATCC
           35316]
 gi|288317507|gb|EFC56445.1| flagellar biosynthetic protein FliR [Enterobacter cancerogenus ATCC
           35316]
          Length = 261

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 55/241 (22%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   IP +V++   +  +I++ P L     +   +  
Sbjct: 11  QWLGLYFWPMLRVLALISTAPILSERTIPKRVKVGLGIIITIIIAPSLP---PVDIPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    + + ++ +G   G  +++    ++  G +I   +GL+  T +     L    L  
Sbjct: 68  AKAVWVALQQIMIGVAVGFTMQLAFAAVRTAGELIGLQMGLSFATFIDPGSHLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +I ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+
Sbjct: 128 IIDMLAMLLFLTFNGHLWLISMLVDTFHTLPIGDNPVNSNAFLALTRAAGLIFLNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+S+GLLN++ PQ+ ++ I  P  + +G L + L + +I     H F   
Sbjct: 188 LPIITLLLTVNLSLGLLNRMAPQLSVFVIGFPVTLTVGILLMSLLMPLIAPFCEHLFSEL 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|325981179|ref|YP_004293581.1| flagellar biosynthetic protein FliR [Nitrosomonas sp. AL212]
 gi|325530698|gb|ADZ25419.1| flagellar biosynthetic protein FliR [Nitrosomonas sp. AL212]
          Length = 265

 Score =  128 bits (322), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 110/241 (45%), Gaps = 1/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ +    + R+ + I   P L     P++V+L  A+  +I++LP +  ++   +  + 
Sbjct: 11  TLLAAFIWPLSRILALIASAPILGNPSTPVRVKLGLAIMITILILPLVEKSLPQIDPASG 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L + ++ +G   G ++RV  + ++  G +I   +GL         +S     +  
Sbjct: 71  IGLVIL-LQQILIGAAIGFVMRVVFVAVEMAGELIGLQMGLGFAIFFDPQNSGQIDIIGR 129

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +G+I  LA   +D H  +   + +S+ T+PIG        F++  N     F   L+LS
Sbjct: 130 FLGVIASLAFLAMDGHLLMIALISQSFSTLPIGSAALTDVTFTTLANWGGEIFKSGLQLS 189

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P L   ++ NI++G+L ++ PQ+ I+ +  P  + +G L L LS+        +    G
Sbjct: 190 LPVLTALLITNIALGILTRVAPQLNIFAVGFPLTLAIGFLVLGLSMPFYTPILEYLVHDG 249

Query: 247 F 247
            
Sbjct: 250 L 250


>gi|218463239|ref|ZP_03503330.1| flagellar biosynthesis protein FliR [Rhizobium etli Kim 5]
          Length = 250

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 101/247 (40%), Positives = 152/247 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI +LP LWDT+  
Sbjct: 1   MISDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIAVLPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  +++   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVTEDSP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L++ I   G++ L+++DFHH VF AL+ SY T+P G          SF + L+ T  
Sbjct: 121 ETSLSAFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G     +S+  +V QF 
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLFYVSVAALVSQFG 240

Query: 241 HSFLYGF 247
            +F   +
Sbjct: 241 QAFSSIY 247


>gi|297617156|ref|YP_003702315.1| flagellar biosynthetic protein FliR [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144993|gb|ADI01750.1| flagellar biosynthetic protein FliR [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 254

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 51/236 (21%), Positives = 100/236 (42%), Gaps = 1/236 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             L+  RV    +  P  S   IP+Q+++   +  + ++  ++          N   +  
Sbjct: 8   FLLVFARVSGLFLSAPVYSSRQIPVQIKVFLGLLLAAIIT-YVRPISTRVELDNTGIFLV 66

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            + VE+F G   GL   V    +Q  G ++   +G  +   M     +    + S   ++
Sbjct: 67  ALAVEVFTGYALGLAGYVLFAAVQLAGQLVDMQMGFGIVNVMDPQSGMQVPLVGSFYYLL 126

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L    ID HHQ+  A+  SY  IPI          +  V +    F++ +++++P + 
Sbjct: 127 AILVFLGIDGHHQLLSAVYHSYDVIPILGAKFQPGFTAFLVKLGGYMFVLGVKIAAPVVA 186

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +V + ++G + + VPQ+ I+ +  P  I  G + L L I + V+     F   F
Sbjct: 187 ALLVADTALGFMARTVPQMNIFLVGMPLKILGGIVMLLLVIPVYVWLLQVLFAQFF 242


>gi|222084893|ref|YP_002543422.1| flagellar byosinthesis transmembrane protein [Agrobacterium
           radiobacter K84]
 gi|221722341|gb|ACM25497.1| flagellar byosinthesis transmembrane protein [Agrobacterium
           radiobacter K84]
          Length = 250

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 117/247 (47%), Positives = 157/247 (63%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL  CR+G C+M+LPG S   +P Q+RL  A A S+ +LP LW+TI  
Sbjct: 1   MISDPQGTILALFLAFCRIGGCVMVLPGFSSGRVPPQIRLLLAAALSMAILPLLWNTIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +   + A Y  L+  E  +G ++G++ R+YTLGLQF G+VIS  IG N    M + +   
Sbjct: 61  EVSKSSATYISLIFTETVIGLMYGMMARLYTLGLQFAGTVISMLIGFNAPGGMDVIEDSN 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L SLI   GL+ L+V+DFHH V  ALV+SY  IP G  ++      S  + L TT  
Sbjct: 121 ETSLTSLISFCGLMILFVLDFHHYVLQALVESYSVIPFGGHVDVRASLISVTDTLATTTF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SPFL + ++F ISIG +NKL PQIPIYFISTPYL+  G   L LSI  ++ QFS
Sbjct: 181 IMLRLASPFLLYGLMFQISIGFINKLAPQIPIYFISTPYLLMGGLFMLYLSIAAMISQFS 240

Query: 241 HSFLYGF 247
            +FL  F
Sbjct: 241 GAFLTVF 247


>gi|296103570|ref|YP_003613716.1| flagellar biosynthesis protein FliR [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058029|gb|ADF62767.1| flagellar biosynthesis protein FliR [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 261

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 108/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ + I   P LS   IP +V++   +  +I++ P L     +   +  
Sbjct: 11  QWLGVYFWPMLRILALITTAPILSEKAIPKRVKVGLGIIITIIVAPSLPA---VNIPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    + + ++ +G   G  +++    ++  G +I   +GL+  T +     L    L  
Sbjct: 68  ANAVWVALQQILIGVAVGFTMQLAFAAVRTAGELIGLQMGLSFATFVDPGSHLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +I ++ +L     + H  +   LV ++ T+PIG+     N F +        F+  L L+
Sbjct: 128 IIDMLAMLLFLSFNGHLWLISMLVDTFHTLPIGENPVNSNAFLALTRAAGLVFLNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G L + L + +I     H F   
Sbjct: 188 LPIITLLLTVNLALGLLNRMAPQLSVFVIGFPLTLTVGILLMSLLMPLIAPFCEHLFGEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|162139705|ref|YP_877991.2| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           novyi NT]
          Length = 610

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 105/239 (43%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
              + +FL+  R+ S I +   L     P  V++ F +    +++  +  +  + +  + 
Sbjct: 5   TYFLGVFLVSLRILSFIEVAQILFPKGTPKVVKVMFGVILGFMIITGIDYSY-VNDINSN 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                  ++E+  G + G +  +    +++ G+ +   +G  + +    + +   T +  
Sbjct: 64  LMIIMYAIIEISTGVILGFITNICFSCIRYAGAFMDLQVGFAMMSMFDPNANSNTTLIER 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++    L+   ++D  + +   LV+S+  + IGQ +         +N+    F + +R++
Sbjct: 124 MLYWFSLIVFIIVDGPNMLIKILVESFKVVHIGQFILNQQSAMHVINVFIKYFQLGIRIA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   I+ ++++GL+ K VPQ+ +  +  P  I LG   L L + +I      +F  
Sbjct: 184 IPIVLIIILTDLTMGLVAKSVPQLNVMILGMPVKIVLGLGVLSLCLPVIFNIIGSAFDN 242


>gi|28211317|ref|NP_782261.1| flagellar biosynthetic protein fliR/B [Clostridium tetani E88]
 gi|28203757|gb|AAO36198.1| flagellar biosynthetic protein fliR/B [Clostridium tetani E88]
          Length = 539

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 108/239 (45%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
               ++ ++  R+     + P       P  +++ F +  S +L+P + D   + N  N 
Sbjct: 8   AFFTAVIMVFLRLIGFFTVTPVFFPKGTPAILKVAFTLILSYMLVPGI-DYSQISNINNT 66

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +      E+  G   G + ++  + ++  G+ +   +G ++ + +  + S   T +  
Sbjct: 67  MVFITNCSSEIITGLALGFMTQLCFMAIRLGGNYMDIQVGFSMVSMLDPNTSSNSTLIER 126

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+   GL+  +++D HH +   L+ S+  + IG+ +      S  + +    F++ L+++
Sbjct: 127 LLYWTGLILFFMVDGHHMLITQLIDSFNAVTIGRFILNQETASIIIEVFIQFFIMGLKIA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   I+  +++GL+ + VPQ+ +  +  P  I +G   L L++ II    +  F  
Sbjct: 187 IPIVLIIIIAELTLGLVGRAVPQLNVMILGLPLKIIVGLATLILAMPIIFKLIATGFSN 245


>gi|311279108|ref|YP_003941339.1| flagellar biosynthetic protein FliR [Enterobacter cloacae SCF1]
 gi|308748303|gb|ADO48055.1| flagellar biosynthetic protein FliR [Enterobacter cloacae SCF1]
          Length = 264

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 108/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + +   P LS   +P +V+L      + ++ P L  T      +  
Sbjct: 11  HWLSLYFWPLLRVLALVSTAPILSEKTVPKRVKLGLGFIITAIVAPTLPPT---DVTLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L + ++ +G   G  +++    ++  G +I   +GL+  T +  S +L+   L  
Sbjct: 68  PNALWLAIQQILIGIALGFTMQLAFAAIRTAGEIIGLQMGLSFATFVDPSSNLSMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ ++ +L   V + H  +   LV ++ T+PIG     GN F +        F+  L L+
Sbjct: 128 IMDMLAMLLFLVFNGHLWLISLLVDTFHTLPIGGLPLNGNAFLALSRAGGLIFLNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + +   + +I     H F   
Sbjct: 188 LPVITLLLTINLALGMLNRMAPQLSVFVIGFPITLTVGLILMSALMPLIAPFCEHLFSEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|91776318|ref|YP_546074.1| flagellar biosynthetic protein FliR [Methylobacillus flagellatus
           KT]
 gi|91710305|gb|ABE50233.1| flagellar biosynthetic protein FliR [Methylobacillus flagellatus
           KT]
          Length = 266

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           ++ + +L   + R+ + I + P  +   +P  V+L   +  ++ ++P + D   +  F  
Sbjct: 10  QVWVATLMWPLTRILAFIAVAPLFNHRALPNNVKLGLGLVLTVAVMPSIPDIPPVSVFSM 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                     ++ +G   G  +R+    ++  G      +GL              T + 
Sbjct: 70  NGLLIL--CQQVIIGAAMGFSLRIIFSAVELAGHTAGMTMGLGFAMFYDPQTQGQSTSIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++ +L    ID H  V   L +S+ + P+  E NFG             F   L +
Sbjct: 128 QFLVVLSMLLFLSIDGHLVVISTLAESFSSFPVTAEPNFGLDPYKIALWGGKIFSAGLLM 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +   ++ N+++G+L +  PQ+ ++ I  P  I LG L L L++  ++         
Sbjct: 188 SLPIIAALLLANLALGVLTRAAPQLNLFGIGFPITISLGFLLLMLALPYMMQPVQRLMHE 247

Query: 246 G 246
            
Sbjct: 248 S 248


>gi|218662875|ref|ZP_03518805.1| flagellar biosynthesis protein FliR [Rhizobium etli IE4771]
          Length = 250

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 100/247 (40%), Positives = 151/247 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MISDPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  + +   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVIEDSP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L++ I   G++ L+++DFHH VF AL+ SY T+P G          SF + L+ T  
Sbjct: 121 ETSLSAFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G     +S+  +V QF 
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLFYVSVAALVSQFG 240

Query: 241 HSFLYGF 247
            +F   +
Sbjct: 241 QAFSSIY 247


>gi|320085401|emb|CBY95182.1| Flagellar biosynthetic protein fliR [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 290

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 38  WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 94

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 95  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 154

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 155 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 214

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 215 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 274


>gi|86356338|ref|YP_468230.1| flagellar biosynthesis protein FliR [Rhizobium etli CFN 42]
 gi|86280440|gb|ABC89503.1| flagellar byosinthesis transmembrane protein [Rhizobium etli CFN
           42]
          Length = 250

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 101/247 (40%), Positives = 153/247 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C+++LPG S + +P Q+R+  A+A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLVLPGFSSARVPEQLRVFIALALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                 A Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  + +   
Sbjct: 61  AVHTGSATYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVIEDSP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L + I   G++ L+++DFHH VF AL+ SY T+P G          SF + L+ T  
Sbjct: 121 ETSLTAFITFAGIMILFIMDFHHIVFRALIDSYTTMPFGGLTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G     +S+  +V QF 
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLFYVSVAALVSQFG 240

Query: 241 HSFLYGF 247
            +F   +
Sbjct: 241 QAFSSIY 247


>gi|218681681|ref|ZP_03529482.1| flagellar biosynthesis protein FliR [Rhizobium etli CIAT 894]
          Length = 250

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 103/243 (42%), Positives = 153/243 (62%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C+++LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLVLPGFSSARVPEQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++GLL R+YTLG+QF  ++++T +G     S  I +   
Sbjct: 61  AVHTGSPTYIGLIFSESLVGVMYGLLARIYTLGMQFAATILATMVGYTQPGSADIIEDTP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E+ L+  I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ T  
Sbjct: 121 ESSLSGFITFAGIMILFMMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G   +  SI  +V QFS
Sbjct: 181 IMLRLASPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLIYFSIAAMVSQFS 240

Query: 241 HSF 243
            SF
Sbjct: 241 QSF 243


>gi|241203132|ref|YP_002974228.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857022|gb|ACS54689.1| type III secretion system inner membrane R protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 250

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 103/243 (42%), Positives = 150/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPDQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  I +   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADILEDTP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L+  I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ T  
Sbjct: 121 ETSLSGFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G   +  SI  +V QF 
Sbjct: 181 IMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLIYFSIAAMVSQFG 240

Query: 241 HSF 243
            SF
Sbjct: 241 QSF 243


>gi|125973004|ref|YP_001036914.1| flagellar biosynthesis protein FliR [Clostridium thermocellum ATCC
           27405]
 gi|256004801|ref|ZP_05429776.1| flagellar biosynthetic protein FliR [Clostridium thermocellum DSM
           2360]
 gi|281417215|ref|ZP_06248235.1| flagellar biosynthetic protein FliR [Clostridium thermocellum JW20]
 gi|125713229|gb|ABN51721.1| type III secretion system inner membrane R protein [Clostridium
           thermocellum ATCC 27405]
 gi|255991251|gb|EEU01358.1| flagellar biosynthetic protein FliR [Clostridium thermocellum DSM
           2360]
 gi|281408617|gb|EFB38875.1| flagellar biosynthetic protein FliR [Clostridium thermocellum JW20]
 gi|316940760|gb|ADU74794.1| flagellar biosynthetic protein FliR [Clostridium thermocellum DSM
           1313]
          Length = 261

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 102/232 (43%), Gaps = 2/232 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI  R+    ++ P      IP   ++ F+   +++L+  +   +    F N   Y  
Sbjct: 15  FMLIFVRMTGLFVIAPIFGSRNIPTYCKIGFSFMTALILVNTI--KVQELYFSNIYEYFI 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E  +G   G +  +    +   G  I   IG  +   +   +S   +  ++   ++
Sbjct: 73  LVLKEFLVGITLGYVAYMIFTAIYVAGQFIDMQIGFGVVNVIDPLNSTQVSITSNFYFLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L   +   H+ +  AL  SY  IP+G  +   ++ +  V +    F+I  ++S+P   
Sbjct: 133 CMLVFLICRGHYILIRALFASYNYIPVGTGVFGEDMVNDIVRVFGNIFLIAFKISAPITI 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             ++  +++G+++K VPQ+ ++ +  P  I LG   + ++I + +    +  
Sbjct: 193 SIMISEVALGIVSKTVPQLNVFMVGMPLKIILGLAVMVITIPMFLNLVENLI 244


>gi|254433171|ref|ZP_05046679.1| flagellar biosynthetic protein FliR [Nitrosococcus oceani AFC27]
 gi|207089504|gb|EDZ66775.1| flagellar biosynthetic protein FliR [Nitrosococcus oceani AFC27]
          Length = 262

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ +     CR+G+ +M +P      +P+++RL  A+A ++V+ P +  T      V  
Sbjct: 10  QLISAYLWPFCRIGALLMAMPLFGSKVVPVRIRLVLALALTVVIAPVIPATSVAALSVEG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                LVM +  +G    L++++        G +++T +GL   + M   + +A + ++ 
Sbjct: 70  G---LLVMQQFLIGFAMALVLQMVFQAFAIGGQIVATQMGLGFASLMDPQNGVAVSMVSQ 126

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  ++  L    ++ H  V   L +S+  +P+G E      F              + ++
Sbjct: 127 LYTVLITLVFLGLNGHLVVIQVLAESFYVLPLGVERASLGGFWQLAGAGSWMLAGSVLIA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +    + N++ G++++  PQ+  + I  P  + LG   L  ++        +     
Sbjct: 187 LPAIGALSLVNLTFGVMSRAAPQLNPFSIGFPLTLILGFWVLLFTLPNAPSHLVNLTDTA 246

Query: 247 F 247
            
Sbjct: 247 L 247


>gi|332284030|ref|YP_004415941.1| flagellar biosynthetic protein FliR [Pusillimonas sp. T7-7]
 gi|330427983|gb|AEC19317.1| flagellar biosynthetic protein FliR [Pusillimonas sp. T7-7]
          Length = 262

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 99/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M +      R+ + I   P L  S IP++ ++ FA   ++ + P L    D+      
Sbjct: 11  GWMNAFLWPFFRILALIGAAPLLGESSIPIRAKVGFAALVTVAIAPALDPMPDIPTASFA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L   ++ +G   GL++R+    +Q  G  I   +GL+  +    +       L  
Sbjct: 71  GLWIGL--QQVLIGMALGLVMRIVFAAVQTAGEFIGLQMGLSFASFFDPATGANTAVLAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ ++  L    ++ H  +   +++S+  +P+       N +           +  + L+
Sbjct: 129 IMNVVATLLFLALNGHLMMLAGIMRSFDVLPVRVGGLDPNGWGVLFEWSSEVMVSGMMLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+   Q+ ++ +  P  +  G + L + +       S+ F  G
Sbjct: 189 LPLIIVLLTINLALGILNRTAQQLSVFAVGFPISLMTGLVLLAVVLPQTGPFLSNLFQEG 248

Query: 247 F 247
           +
Sbjct: 249 Y 249


>gi|190890390|ref|YP_001976932.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
 gi|190695669|gb|ACE89754.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
           652]
          Length = 250

 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 149/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI L+P LWDT+  
Sbjct: 1   MIADPQGTVLALFLVFCRIGGCVLALPGFSSARVPEQLRVFIAGALSIALMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  ++I+  +G     S  + +   
Sbjct: 61  AVHTGAGTYIGLIFSESLVGLMYGMLARIYTLGMQFAATIIAMMVGYTQPGSADVIEDAP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L+  I   G++ L+++DFHH VF ALV SY T+P G          SF + L+ T  
Sbjct: 121 ETSLSGFITFAGIMILFIMDFHHIVFRALVDSYTTMPFGGVTQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G     +S+  +V QF 
Sbjct: 181 IMLRLSSPFLIYGMIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLFYVSVAALVSQFG 240

Query: 241 HSF 243
            +F
Sbjct: 241 QAF 243


>gi|227820883|ref|YP_002824853.1| flagellar biosynthesis protein FliR [Sinorhizobium fredii NGR234]
 gi|227339882|gb|ACP24100.1| flagellar biosynthesis protein FliR [Sinorhizobium fredii NGR234]
          Length = 250

 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 101/243 (41%), Positives = 149/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G CIM++PG S + +PMQVRL  A+A S+ +LP +W  I  
Sbjct: 1   MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQVRLFIAVALSMAILPIMWTDIYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q       Y  L+  E  +G V GL+ R Y LGLQF G+ I+  IG N   +  + +  A
Sbjct: 61  QVAGKGHTYIYLIATESVIGAVIGLVARYYVLGLQFAGTAITMLIGFNPPPATDVLEETA 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  L S+I   GL+ L+++DFHH +F A+ +SY  +PIG   +   +  +  N L  TF+
Sbjct: 121 ENQLTSMISFAGLMLLFMLDFHHVIFEAIAQSYRVMPIGIGFDPQGMLITLTNSLGQTFL 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRL+SPF+ + ++FN++IG++N+L PQ+P+YFIS PYLI  G   L L I  ++  F+
Sbjct: 181 IMLRLASPFVIYGLLFNVAIGMVNRLAPQVPVYFISQPYLILGGLFLLYLGIAAMLRLFA 240

Query: 241 HSF 243
             F
Sbjct: 241 DGF 243


>gi|30248475|ref|NP_840545.1| hypothetical protein NE0459 [Nitrosomonas europaea ATCC 19718]
 gi|30138361|emb|CAD84370.1| Bacterial export protein, family 1 [Nitrosomonas europaea ATCC
           19718]
          Length = 265

 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 105/240 (43%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + +L   + R+ + +   P L  S IP Q +L  A+  +I++ P L     +       
Sbjct: 12  WLSTLIWPLARILALLASTPLLGSSSIPTQTKLGLAVLLAILIAPLLPPLPQIDP--GSG 69

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               ++M ++ +G   G  +R+    ++  G +    +GL   T      S     +   
Sbjct: 70  VGLIVLMQQIIIGLAMGFSMRIVFTAVEMAGEITGLQMGLGFATFFDPQQSGQVQLVGRF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
            G++  L    ID H QV   L  S+ T+PIG E      F++ VN     FM+ L LS 
Sbjct: 130 YGLLATLTFLAIDGHLQVIAILAHSFTTLPIGAEGMSTTSFTALVNWGIKIFMLGLHLSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P L   ++ N+++G+L +  PQ+ I+ +  P  +G+G L +  ++       +  F   F
Sbjct: 190 PVLTALLITNLALGILTRAAPQLNIFAVGFPLTLGIGLLVMSWALPYFTPLLNQLFQESF 249


>gi|90411035|ref|ZP_01219049.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
 gi|90328248|gb|EAS44559.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
          Length = 260

 Score =  125 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 100/240 (41%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M +      ++  ++RL   +  +  ++P L         ++  
Sbjct: 11  WLANYFWPFTRISSMMMTMTFFGARFVSPRIRLYLGLTVTFAVMPSLPAVPANIELLSLQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   ++ +G   GL+ +  T      G ++     L   + +  ++      L  L
Sbjct: 71  GF-LITAQQIVIGVSIGLVTQFVTQTFVLVGQILGMQSSLGFASMVDPANGQNTPVLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + ++     D H ++   +V S+ T+PIGQE+   + +          F   L ++ 
Sbjct: 130 YLFLAIMLFLATDGHLEMLNVIVLSFKTLPIGQEMFRPDDYYQLAGWFGHMFKGALNMAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +   +  N+S G++ +  PQ+ I+ +   + + LG L     +  ++ Q+ H++ +GF
Sbjct: 190 AGVIALLTVNLSFGVMTRAAPQLNIFALGFSFALLLGLLISWYLVMGMLPQYQHAWDFGF 249


>gi|149377873|ref|ZP_01895602.1| Flagellar biosynthesis pathway, component FliR [Marinobacter
           algicola DG893]
 gi|149357815|gb|EDM46308.1| Flagellar biosynthesis pathway, component FliR [Marinobacter
           algicola DG893]
          Length = 260

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 98/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + R+ S +M++P +    +P +VRL  A+  +I+++P +     +  F   
Sbjct: 12  QWVGQHLWPLFRLVSFMMVIPFIGTQLVPARVRLGLALIITILVVPMIPPVPQVDAFSAD 71

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + ++ +G   G  +          G +I+  +GL   + +  ++ ++   L  
Sbjct: 72  G--VVITLQQILIGVGMGFALTALFQLFVVAGQMIAMQMGLGFASMVDPANGVSVPVLAQ 129

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  I   L    ++ H   F   ++S+ T+PIG E           + +   F+  + L+
Sbjct: 130 IYTITITLLYLAMNGHLVAFEVFIESFRTMPIGLEGLGQAGVWQLAHRISWIFVSAVLLA 189

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +    + NIS G++ +  PQ+ I+ +  P  +  G   + +     +  F       
Sbjct: 190 LPAVTAVFIVNISFGVMTRAAPQMNIFALGFPIGLIFGLFAIWVLHANFLPHFEQYTRET 249

Query: 247 F 247
           F
Sbjct: 250 F 250


>gi|325291970|ref|YP_004277834.1| flagellar biosynthesis protein FliR [Agrobacterium sp. H13-3]
 gi|325059823|gb|ADY63514.1| flagellar biosynthesis protein FliR [Agrobacterium sp. H13-3]
          Length = 251

 Score =  124 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 99/248 (39%), Positives = 156/248 (62%), Gaps = 1/248 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-D 59
           M   P+  +++LFL +CR+G+C M +PG S S I  Q+R+   +A S+ LLP LWDTI  
Sbjct: 1   MITDPQGTIIALFLAICRIGACFMTMPGFSSSRISPQIRILLCVAVSMALLPVLWDTIYP 60

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
             +  ++     L+  E+ +G ++GL+ R YTLG QFTG++I  +IGL+        + +
Sbjct: 61  KVSGASQGAVVGLIFTEIVIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGADAVEDV 120

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
            E  +++ I   GL+ L+++DFHH V  ALV SY T P+G  ++   +  +  + L+ +F
Sbjct: 121 QENQISNFITFGGLMVLFILDFHHIVLRALVDSYATTPVGALISGQKMLITLTDTLRASF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            IMLRL+SPF+ + ++FN+++GL+NKL PQIP+YFISTP+++  G   L LSI  ++ QF
Sbjct: 181 SIMLRLASPFVIYGLMFNVAVGLINKLAPQIPVYFISTPFVLAGGIFMLYLSIAALIRQF 240

Query: 240 SHSFLYGF 247
              F   F
Sbjct: 241 VDGFGPVF 248


>gi|311695201|gb|ADP98074.1| flagellar biosynthesis protein FliR [marine bacterium HP15]
          Length = 261

 Score =  124 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + R+ S +M++P      +P ++RL  A+  +I++ P +     ++     
Sbjct: 13  QWVGQHLWPLFRLASFLMVIPIFGTQLVPARIRLGLALLMTILIAPMIPPVPQVEALSAD 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    + + ++ +G   G  +          G +I+  +GL   + +  ++ +    L+ 
Sbjct: 73  A--VVITLQQILIGVGMGFALTALWQLFVIAGQMIAMQMGLGFASMVDPANGVNVPVLSQ 130

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  I   L    ++ H   F   ++S+ T+PIG E           + +   F   + L+
Sbjct: 131 IYTITITLLFLAMNGHLVAFEVFIESFRTLPIGMEGLGQTGIWELAHRISWMFASAMLLA 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ NIS G++ +  PQ+ I+ +  P  +  G   + +     +  F       
Sbjct: 191 LPAVTAVLIVNISFGVMTRAAPQMNIFALGFPIGLIFGLFAIWVLHANFLPHFDQYARET 250

Query: 247 F 247
           F
Sbjct: 251 F 251


>gi|260886651|ref|ZP_05897914.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
 gi|330839518|ref|YP_004414098.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
 gi|260863794|gb|EEX78294.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
 gi|329747282|gb|AEC00639.1| flagellar biosynthetic protein FliR [Selenomonas sputigena ATCC
           35185]
          Length = 260

 Score =  124 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 108/242 (44%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +    +  L++ RV    ++ P      IP  +R+  A+AFS VL P +     +    N
Sbjct: 8   QGHAAAYLLVLTRVTGIFVIAPFFGSLNIPAHIRVGTAVAFSFVLFPIVDSYGPVSAPDN 67

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              Y+     ELF+G + G +  V    + F G V+   +G  +   M  +       + 
Sbjct: 68  VFLYAAAAAGELFVGWLIGFVAYVTFSAIHFAGKVMDMQVGFAMVNVMDPTSGQQIPLIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           S +  + ++   V++ HH +  AL +S+ ++P+       N+    VN++   F+  ++L
Sbjct: 128 SFLYNLAIIVFLVVNGHHMLIAALFESFQSVPMMGLSPSPNLAGFVVNLVNGVFVTGMKL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  ++ N+ +G+L + +PQ+ I+ +  P  I +G   L + +   V      F  
Sbjct: 188 AMPVTFSILLTNVGLGILARTMPQLNIFVVGLPLQIVIGMFVLSILMPFYVLFLDVLFNE 247

Query: 246 GF 247
            +
Sbjct: 248 TY 249


>gi|116250508|ref|YP_766346.1| flagellar biosynthesis protein FliR [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255156|emb|CAK06230.1| putative flagellar biosynthetic protein FliR [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 250

 Score =  124 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 103/243 (42%), Positives = 150/243 (61%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   P+  +++LFL+ CR+G C++ LPG S + +P Q+R+  A A SI ++P LWDT+  
Sbjct: 1   MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPQQLRVFIAGALSIAVMPLLWDTVYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  E  +G ++G+L R+YTLG+QF  S+ +  +G     S  I +   
Sbjct: 61  AVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAASITAMMVGYTQPGSADILEDTP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET L++ I   G++ L+++DFHH VF AL+ SY T+P G  +       SF + L+ T  
Sbjct: 121 ETSLSAFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQMRATLISFTDTLEQTTY 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFL + ++FN+SIG +NKL PQIP+YFISTPYL+  G   +  SI  +V QF 
Sbjct: 181 IMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLMGGLFLIYFSIAAMVSQFG 240

Query: 241 HSF 243
            SF
Sbjct: 241 QSF 243


>gi|94314222|ref|YP_587431.1| flagellar biosynthetic protein FliR [Cupriavidus metallidurans
           CH34]
 gi|93358074|gb|ABF12162.1| flagellar biosynthetic protein FliR [Cupriavidus metallidurans
           CH34]
          Length = 261

 Score =  124 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 102/241 (42%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + R+   I   P LS S IP ++++  A A SI++ P + +   +  +   
Sbjct: 11  GWIATFLWPMFRMLGLISSAPLLSESTIPRRLKILLAAALSIIISPTIGNIPTVPVYSLD 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ E+ +G   G  +R+    +Q  G VI   +GL+  +    +       L+ 
Sbjct: 71  G--LLIVLNEVGIGLSMGFAMRLVFAAVQMAGEVIGLQMGLSFASFYDRAAGGQTMVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L    +D H  +  AL+ S+  +PI      G+ +          F     LS
Sbjct: 129 FLNMVAMLLFLALDGHLMMLAALIDSFQGLPISGVPLSGHGWGVLARAGSMIFSAGTLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ+ I+ +  P  +  G L L L +  +     H    G
Sbjct: 189 LPMIAALLTMNLAMGILNRASPQLSIFAVGFPVTLLGGMLVLALVMPHMGAYVQHLIESG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|304311112|ref|YP_003810710.1| Flagellar biosynthesis protein FliR [gamma proteobacterium HdN1]
 gi|301796845|emb|CBL45057.1| Flagellar biosynthesis protein FliR [gamma proteobacterium HdN1]
          Length = 259

 Score =  124 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 109/240 (45%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F   CR+G+  + +P +    +P ++R+  A++ ++V+ P L     ++     
Sbjct: 10  TWIAEYFWPFCRIGALFLAIPLIGTRSVPQRIRIVLALSVTVVVAPLLGKMPAVELLSVD 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           ++    V+ +L +G + G ++++        G +++   GL   + +  ++ L+   ++ 
Sbjct: 70  SWLI--VIQQLLIGLLLGFVVQLLFQLFIVGGQMVAMQNGLGFSSLVDPTNGLSVAVISQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  +   L  + ++ H  +   +V S+  +P+       + +   +      F   + LS
Sbjct: 128 IYLMTVNLVFFTLNGHLALIRFIVDSFQYLPVSTSGIAPDGYYMVIMHAVWMFQNAVLLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N+S G+++++ PQ+ I  +  P  +  G + L +++  ++  +  +F   
Sbjct: 188 LPAVTALLVTNLSFGVMSRVAPQLNIMSVGFPMNMVAGVIVLWVTLPSLLPLYERTFDET 247


>gi|295678049|ref|YP_003606573.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1002]
 gi|295437892|gb|ADG17062.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1002]
          Length = 260

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 107/240 (44%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + +      R+ + I   P L  + +P +V++  A   +I++ P +     +  F   
Sbjct: 11  VWLTAFLWPFARIAALIATAPVLGNTSLPSRVKIGLAAFTTIIVAPTIGALPQVTVFSAD 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +      +  +G   G+ +++    +  TG  I   +GL   T      + +   ++ 
Sbjct: 71  GVWIL--ANQFLIGIALGVTMQIVFQAIDATGYFIGLGMGLGFATFFDQQATGSGVVISR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +LA   +D H Q+  ALV ++ ++P+   L   + + +  N   + F   L LS
Sbjct: 129 YMTTIAMLAFLAVDGHLQMIAALVTTFQSVPVSANLLAPHGWQTLANWGSSIFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L + L +  ++  F   F  G
Sbjct: 189 LPVVVALLIANLALGILNRAAPQIGVFQIGFPLTMLVGLLLVQLMLPNMIPFFVRLFDSG 248


>gi|152980679|ref|YP_001353119.1| FliR component of the flagellar biosynthesis pathway
           [Janthinobacterium sp. Marseille]
 gi|151280756|gb|ABR89166.1| FliR component of the flagellar biosynthesis pathway
           [Janthinobacterium sp. Marseille]
          Length = 263

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + R+   I + P      +P +V++   +  ++++ P +     L     +
Sbjct: 11  TWIAAFLWPLTRIIGMISVAPLFGNVSVPARVKIGLGILLAMIIAPTVPAMPALDPMSLQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                    +L +G   G  +R+   G++  G +I   +GL   +          + ++ 
Sbjct: 71  GLLIL--AQQLIIGLSIGFAMRITFAGVEMAGEIIGMTMGLGFASFFDPQTRARSSAISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ L+     + H  V   L +S+  +PI             V      F   ++LS
Sbjct: 129 FLALLTLMIYLATNLHLVVLSTLAQSFEMLPISSSFLSAGGMLEVVKWGGRIFSAGVQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ NI++G+L +  PQ+ I+ I  P  IG+G + + + +  ++    +    G
Sbjct: 189 LPIVAALLITNIALGILTRAAPQLNIFGIGFPITIGVGFIMIGIVLPYLMNPIINLMQEG 248


>gi|237653574|ref|YP_002889888.1| flagellar biosynthetic protein FliR [Thauera sp. MZ1T]
 gi|237624821|gb|ACR01511.1| flagellar biosynthetic protein FliR [Thauera sp. MZ1T]
          Length = 265

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/242 (17%), Positives = 95/242 (39%), Gaps = 2/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  + +L   + R+       P  S   + +++RL   +  ++ +LP L     +     
Sbjct: 10  DAWLAALMFPLGRLLGLFASAPVFSNRGVSVRIRLAIGLGVAMAVLPVLPPMPQVPP--G 67

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +   ++ +G   G ++R+    +   G++I   +GL+               L+
Sbjct: 68  GGLGLAIFAQQILIGIAIGFVMRIVFAAVDMAGALIGMQMGLSFAVFFDPDAGGQTAVLS 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    ID H  +   LV+S+  +P+  +      ++       T F   L L
Sbjct: 128 DFLNLLATLIFLAIDGHLLMIDLLVRSFEWLPVATDAVDAGGWAFLARSGITVFSAGLLL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +   +V NI++G+L +  PQ+ ++ +  P  +  G + + L +          F  
Sbjct: 188 SLPVIAVLLVANIALGVLTRAAPQLNLFAVGFPITLTAGFIGVLLIMSNFAPVLQSLFER 247

Query: 246 GF 247
            +
Sbjct: 248 SY 249


>gi|220929450|ref|YP_002506359.1| flagellar biosynthesis protein FliR [Clostridium cellulolyticum
           H10]
 gi|219999778|gb|ACL76379.1| flagellar biosynthetic protein FliR [Clostridium cellulolyticum
           H10]
          Length = 265

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 101/235 (42%), Gaps = 1/235 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI  R+    +  P      IP+  ++ FA   + +L   +     + N  N   ++ 
Sbjct: 15  FLLIFVRMTGLFVTAPIFGRRNIPVYYKVGFAF-ITAILASSVIRVDHIINTDNFLIFAL 73

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            ++ E  +G + G +       +   G +I   IG  +        ++      +L  I+
Sbjct: 74  YILKEFLVGIIIGFVAYAVFTCIYLAGQIIDMQIGFGMVNVFDPISNIQIPVTANLYFIL 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            ++   + + HH +  AL +S+  IP+G  +    +    + ++Q  F +  ++++P + 
Sbjct: 134 SMIIFLLTNGHHMLIRALYESFQIIPLGSAVIGPKLKDDVIGIMQGVFSMGFKIAAPIVA 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              + ++ +G+++K +PQ+ ++ +  P  I +G L + ++I   VY  +      
Sbjct: 194 AIFITDVVLGIISKTIPQMNVFILGMPLKIFVGILIILITIPAFVYIVTVITDDM 248


>gi|54308127|ref|YP_129147.1| flagellar biosynthesis protein FliR [Photobacterium profundum SS9]
 gi|46912553|emb|CAG19345.1| putative polar flagellar assembly protein FliR [Photobacterium
           profundum SS9]
          Length = 260

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 100/240 (41%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M +      ++  ++RL   +  +  ++P L         ++  
Sbjct: 11  WLANYFWPFTRISSMMMTMTFFGARFVSPKIRLYLGLTVTFAVMPALPAVPANIELLSLQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   ++ +G   GL+ +  T      G ++     L   + +  ++      L  L
Sbjct: 71  GF-LITAQQIVIGVSIGLVTQFVTQTFVLVGQILGMQSSLGFASMVDPANGQNTPVLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + ++     D H ++   +V S+ T+PIGQE+   + +          F   L ++ 
Sbjct: 130 YLFLAIMLFLATDGHLEMLNIIVLSFKTLPIGQEMFRPDDYYQLAGWFGHMFKGALNMAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +   +  N+S G++ +  PQ+ I+ +   + + LG L     +  ++ Q+ H++ +GF
Sbjct: 190 AGVIALLTVNLSFGVMTRAAPQLNIFALGFSFALLLGLLISWYLVMGMLPQYQHAWDFGF 249


>gi|330814978|ref|YP_004358683.1| Flagellar biosynthetic protein FliR [Burkholderia gladioli BSR3]
 gi|327367371|gb|AEA58727.1| Flagellar biosynthetic protein FliR [Burkholderia gladioli BSR3]
          Length = 259

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + +      R+ + +   P +  + +P +V++  +   SI + P L        F   
Sbjct: 11  VWLTAFLWPFVRILALVATAPLIGHASVPARVKIGVSALVSIAVAPALGPLPQATVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   +  +G   G  +++    ++  G  I   +GL   +            L  
Sbjct: 71  GIWILV--NQFLIGAALGFTMQIVFAVVEAAGDYIGLQMGLGFASFFDPHSG-NTPMLGR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++    +LA    D H Q+  ALV+S+  +PI   L     +          F + L L+
Sbjct: 128 VLNAFAMLAFIAFDGHLQLIAALVQSFDIVPISSNLLRAAGWRIVAGAGINVFSMGLLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P L+ +G L + L I  ++  FSH F  G
Sbjct: 188 LPVVAALLISNLALGILNRAAPQIGIFQVGFPVLMLVGLLLVQLMIPNLMPFFSHLFDDG 247

Query: 247 F 247
           +
Sbjct: 248 Y 248


>gi|300113615|ref|YP_003760190.1| flagellar biosynthetic protein FliR [Nitrosococcus watsonii C-113]
 gi|299539552|gb|ADJ27869.1| flagellar biosynthetic protein FliR [Nitrosococcus watsonii C-113]
          Length = 262

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ +     CR+G+ +M +P      +P+++RL  A+A ++V+ P +  T      V  
Sbjct: 10  QLISAYLWPFCRIGALLMAMPLFGSKVVPVRIRLMLALALTVVIAPVIPATSVAALSVEG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                LVM +  +G    L++++        G +++T +GL   + M   + +A + ++ 
Sbjct: 70  G---LLVMQQFLIGLAMTLVLQMVFQAFAIGGQIVATQMGLGFASLMDPQNGVAVSMISQ 126

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  I+  L    ++ H  V   L +S+  +P+G E      F              + ++
Sbjct: 127 LYTILITLVFLGLNGHLVVIQVLAESFYILPLGVEGASLGSFWQLAGGGSWMLAGSVLIA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +    + N++ G++++  PQ+  + I  P  + LG   L  ++        +     
Sbjct: 187 LPAIGALSLVNLTFGVMSRAAPQLNPFSIGFPLTLLLGFWVLLFTLPNAPSHLVNLTDTA 246

Query: 247 F 247
            
Sbjct: 247 L 247


>gi|170748649|ref|YP_001754909.1| flagellar biosynthetic protein FliR [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655171|gb|ACB24226.1| flagellar biosynthetic protein FliR [Methylobacterium radiotolerans
           JCM 2831]
          Length = 253

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 60/241 (24%), Positives = 121/241 (50%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M +    I  +  +   R+G+ IML+PG+    +  ++RL FA+  ++VL P +   +  
Sbjct: 1   MNLLLPGIASAYLITFARIGTLIMLMPGIGEQTVSPRLRLAFALLTALVLFPTVRPLLGG 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
              V       L+  E  +G V GL +R+    LQ  G +IS  +GL+   ++  S    
Sbjct: 61  TEGVAGPRLIGLLFGETIIGLVLGLTVRMILAALQTAGVIISAQVGLSYAMTVDPSQGGQ 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  + + + ++G+  ++  D HH     + +SY  +P     +F +        L   F 
Sbjct: 121 QVAIGNFLSLLGITLIFAADLHHLAIEGVARSYEVLPPDGVPSFSDALMLATKALARGFT 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + +++S PF+ F I+FN+ +G+L++L+PQ+ ++F++ P  + +G L L   + +++  F 
Sbjct: 181 LAVQISGPFIAFGILFNLGLGVLSRLMPQMQVFFLAVPASVLIGMLLLMGCLGVMMGVFL 240

Query: 241 H 241
            
Sbjct: 241 D 241


>gi|329901239|ref|ZP_08272764.1| Flagellar biosynthesis protein FliR [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549171|gb|EGF33763.1| Flagellar biosynthesis protein FliR [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 258

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++      + R+   I + P    + +P ++++   +  ++++ P +     L+    +
Sbjct: 11  ALITGFLWPLTRILGLIAVAPVFGNASVPRRIKVGLGILIAMIVAPLVQVPSGLEPMSMQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +    L +G   G  +R+    ++  G V S  +GL   T            ++ 
Sbjct: 71  GLLILVQQ--LLIGIAMGFSMRIIFSAVEMAGEVASMTMGLGFATFFDPQSRGRSNAVSQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + +I L+     + H  +   LV S+ T+PI      GNI    V      F   L+L+
Sbjct: 129 FLSLIVLMVYLAANVHLALLSTLVDSFTTMPITVGPLAGNIAEQVVRWASRLFSAGLQLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+L +  P + ++ I  P  + +G   L L +  +    +  F   
Sbjct: 189 LPIVAALLITNVALGILTRAAPSLNLFGIGFPITLTIGFAMLGLVLPYLATPMAKLFEET 248


>gi|94500292|ref|ZP_01306825.1| flagellar biosynthesis protein [Oceanobacter sp. RED65]
 gi|94427591|gb|EAT12568.1| flagellar biosynthesis protein [Oceanobacter sp. RED65]
          Length = 262

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 94/243 (38%), Gaps = 2/243 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              +        R     M+LP      +  +VRL  A   SI++ P L     +     
Sbjct: 17  SSWVSRYLWPFFRFAGFFMVLPLFGTRLVTARVRLFLAFFTSILVTPLLPPMPVIDAVSV 76

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           +      +  ++ +G   G ++ +        G +I+   GL +   +  ++ +    + 
Sbjct: 77  QTMVI--IAQQILIGIALGFVVEILMQIFILCGQLIAMQTGLGMAMMVDPTNGVNVAVVA 134

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               I   L    ++ H      L  S+ TIP+G+     N+  S V +    F   + L
Sbjct: 135 QWFLIFANLLFITLNGHLVAIEILADSFFTIPVGEGTISTNVMWSIVELAHWMFSAAIVL 194

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +V NI+ G++ +L PQ+ I+ +  P  + LG + L ++      +F      
Sbjct: 195 ALPAITSMLVVNIAFGVMARLAPQLNIFAVGFPVTMLLGLIVLWIAFSGFGAEFGRLLTE 254

Query: 246 GFF 248
            F+
Sbjct: 255 LFY 257


>gi|253688964|ref|YP_003018154.1| flagellar biosynthetic protein FliR [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755542|gb|ACT13618.1| flagellar biosynthetic protein FliR [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 261

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 100/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P  +   I  +V++   +  ++++ P+L         V   
Sbjct: 12  WVSQFFWPFVRILALISTAPVFNERAIGNRVKIGLGVLITLLVAPYLPLNTTPIFSVAG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   
Sbjct: 71  --IWLLIQQVLIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVIARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI       + F +        F+  L L+ 
Sbjct: 129 LNILAILLFLTFDGHLWMISLLADSFYTLPISTNPINSHAFLALARAGGLIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ I+ +  P  + +G + L L I +I     H F   F
Sbjct: 189 PIITLLLTINLALGMLNRVAPQLSIFVVGFPITLTVGIMTLGLLIPLIPPFAEHLFSEVF 248


>gi|325288791|ref|YP_004264972.1| flagellar biosynthetic protein FliR [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964192|gb|ADY54971.1| flagellar biosynthetic protein FliR [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 259

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 111/234 (47%), Gaps = 2/234 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    LI CR    +M+ P      +P  V+L  AMA S+VL P +     +Q  V+   
Sbjct: 11  LTLFLLIFCRWAGMVMIAPVFGARGVPNLVKLGLAMALSVVLYPTVLSMT-VQVPVDTLL 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L++ E+ +G V GL+I + T  +Q  G +I   IG  L  ++   + +      + +
Sbjct: 70  YIGLIIKEVTVGLVIGLVINLLTSVMQTAGELIDYQIGFTLGNTIDPINGMQSPMTGNFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  + L  I+ HH +  A+VKSY  IP+   +      + ++ ++     +  +++ P
Sbjct: 130 MVLTTMLLLAINAHHLIIAAMVKSYSYIPVNTGILPKG-MTFYIQIVGQVIALGAQIAMP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
                 + ++ +GLL+K VPQ+ I+ +  P  I  G   L LSI  +    S+ 
Sbjct: 189 IFGALFLADVGVGLLSKTVPQLNIFSVIFPVKIIFGLTLLFLSIPYLGSTVSNL 242


>gi|74317630|ref|YP_315370.1| flagellar biosynthesis protein FliR [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057125|gb|AAZ97565.1| flagellar biosynthesis protein FliR [Thiobacillus denitrificans
           ATCC 25259]
          Length = 262

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 106/241 (43%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + ++S    + R+   +M+ P      +P +V++   +  +++  P L     +   +  
Sbjct: 11  VWLISFIWPLTRILGLVMVAPVFGHRAVPGRVKIGLGIFIALIAAPTLPPMPAV--GLGS 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +   +++ +  +G   G ++R+    ++  G +I   +GL   +      +     L  
Sbjct: 69  WHGLFILVQQFLIGVAIGFIMRIVFAAVEAAGEIIGLQMGLGFASFFDPQSAGQTLVLAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++ +L +  ++ H  +   LV+S+  +PI  E      F +      T F + L+L+
Sbjct: 129 FFNMLAVLLMLAVNAHLLLLGVLVESFQILPISHEPLAAAGFRNVAAFGTTIFSLGLQLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+L +  PQ+ I+ I  P  +G+G + L +++     QF      G
Sbjct: 189 LPLIAILLMTNLTLGILTRSAPQLNIFAIGFPITLGVGLIMLDVTLPYFAPQFEQLIASG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|90021815|ref|YP_527642.1| flagellar biosynthetic protein FliR [Saccharophagus degradans 2-40]
 gi|89951415|gb|ABD81430.1| flagellar biosynthetic protein FliR [Saccharophagus degradans 2-40]
          Length = 261

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 100/240 (41%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++   FL  CR+G+  + +P L    +  +VRL  A   +++++P L     +     + 
Sbjct: 14  LLQQYFLPFCRIGAMFLAMPILGSQLVSPRVRLGLAFIVTLMVVPMLGSIPKVSGLSVQT 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
                +  E+ LG   G   +V        G +I+  +GL   +     + +  T ++  
Sbjct: 74  --FIYISQEILLGLAAGYCFQVAFQVFVLAGQLIAMKMGLGFASMNDPVNGVQTTAISQF 131

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L    ++ H  +   LV+S+ T P G  +   N      N+    F   L ++ 
Sbjct: 132 YLMLVTLMFVSVNGHLVMINMLVESFVTFPPGGFIFSTNTMWKIANVGTWLFAAGLLMAL 191

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P L   +  NI+ G++++  PQ+ I+ I  P+ +  G L + L +      F      GF
Sbjct: 192 PVLTALLFINIAFGIMSRAAPQLNIFAIGFPFTLLCGLLMIWLGLVTFDSNFESVMDDGF 251


>gi|121533744|ref|ZP_01665571.1| flagellar biosynthetic protein FliR [Thermosinus carboxydivorans
           Nor1]
 gi|121307735|gb|EAX48650.1| flagellar biosynthetic protein FliR [Thermosinus carboxydivorans
           Nor1]
          Length = 260

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 104/246 (42%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
               +  +    LI  RV   +   P L    IP+  +  FA+  S +L P +     + 
Sbjct: 4   ITIMQSQLGFFLLIFTRVTGILTTAPILGSRNIPVYTKAGFALILSYILTPIVVQRSHII 63

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                  Y  LV+ EL +G + G +  +    +Q  G ++   IG  +   +        
Sbjct: 64  VPDQFGAYVFLVIGELLIGLILGYISSMIFYAVQMAGQLLDMQIGFGIVNIIDPQSGQQL 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             + +   I  LL  +  + HH +  AL  S+ T+P+G  +    +    +++  +  +I
Sbjct: 124 PLIGNFKYIFSLLVFFATNGHHILLSALFTSFKTVPVGAAVFRPQLADLVIDITFSVLII 183

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L++S P L    + +I++G+L +++PQ+ I+ +  P  I +G   L L++   +     
Sbjct: 184 ALKISLPILVAIFLTDIAMGILARIMPQMNIFIVGIPGKIIVGIFMLALTLPFYITLLEV 243

Query: 242 SFLYGF 247
            F   +
Sbjct: 244 GFSAMY 249


>gi|116694512|ref|YP_728723.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
 gi|113529011|emb|CAJ95358.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
          Length = 261

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 97/240 (40%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + +      R+ + I   P    S IP + ++  +   ++V+ P +     +  +    
Sbjct: 12  WLAAFLWPFFRILALIGTAPLFGESTIPRRAKIALSAMVAVVVSPTIAQLPVVPVYSFGG 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +++ E+ +G   G  +R+    +Q  G +I   +GL+  +    +       L+  
Sbjct: 72  --LMIILNEVGIGLATGFAMRLVFATVQQAGEIIGLQMGLSFASFFDRAAGGQTMVLSRF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +I +L    +D H  +  ALV S+  +PIG          +        F   L L+ 
Sbjct: 130 LNLIAMLLFLALDGHLLMLGALVDSFSGLPIGGTPLSAGGAMAVARAGGMVFSSGLLLAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN+  PQ+ I+ +  P  +  G L L L +  +     H    G 
Sbjct: 190 PMIAALLTLNLAMGILNRASPQLSIFAVGFPVTLSGGLLVLMLVMPQMGTYMQHMIGAGL 249


>gi|313896132|ref|ZP_07829686.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320529416|ref|ZP_08030504.1| flagellar biosynthetic protein FliR [Selenomonas artemidis F0399]
 gi|312975557|gb|EFR41018.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320138382|gb|EFW30276.1| flagellar biosynthetic protein FliR [Selenomonas artemidis F0399]
          Length = 260

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/247 (19%), Positives = 109/247 (44%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    +  + +  L++ R+    ++ P      IPM  R+  A+A S+VL P +      
Sbjct: 3   LYELLQGHIAAFLLMLTRISGIFLISPFFGSMNIPMFFRVGIALAMSVVLFPVVDGLGTP 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +   +   +   V+ ELF+G + G +  +    +   G V+   +G  +   +  +    
Sbjct: 63  ETPPSIIMFGAAVLGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAVVNVVDPTSGQQ 122

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              + S +  + ++ L V + HH +  ALV+S+  +P+       ++     N   T F+
Sbjct: 123 IPLIGSFLYNLAVIILLVTNGHHMLIAALVESFRAVPLAGLEANISLALIIANFTGTIFL 182

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             ++++ P  F  ++ N+ +G+L++ +PQ+ I+ +  P  + +G   L + +   V    
Sbjct: 183 TGMKIAMPITFAILLTNVGLGILSRTMPQMNIFVVGIPMQLMIGLFVLSMIMPFYVLFLD 242

Query: 241 HSFLYGF 247
             F   +
Sbjct: 243 VLFNEMY 249


>gi|89075525|ref|ZP_01161936.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|89048797|gb|EAR54368.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
          Length = 260

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 96/240 (40%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M +      ++  ++RL  A+A +  +LP L         ++ A
Sbjct: 11  WIANYFWPFTRISSMVMAMTFFGARFVSPKIRLYLALAITFAVLPVLPKVPQDIELLSLA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   +L +G   GL+ +  T      G ++     L   + +  ++      L   
Sbjct: 71  GFI-VTTQQLIIGVAMGLVTQFITQIFVLLGQILGMQSSLGFASMVDPANGQNTPVLGQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + +L     D H ++  A+V S+ T+PIG+ +     +          F   + ++ 
Sbjct: 130 YMFLAILLFLATDGHLEMLNAVVVSFKTLPIGEAMLQPKDYYQLAGWFGHMFKAGVNMAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +   +  N+S G++ +  PQ+ I+ +   + + LG       +  I+ Q+   +  G 
Sbjct: 190 AGVIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLLGLAISWFIVLGILPQYEAIWQVGL 249


>gi|254785482|ref|YP_003072911.1| flagellar biosynthetic protein FliR [Teredinibacter turnerae T7901]
 gi|237685643|gb|ACR12907.1| flagellar biosynthetic protein FliR [Teredinibacter turnerae T7901]
          Length = 257

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 102/240 (42%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   FL   R+G   +++P      +  +VRL  A   +++++P L     +     +A
Sbjct: 11  FIQQYFLPFVRIGVMFLVMPVFGSRIVSPRVRLVLAFLITVLVVPLLPALPSVPPLSWQA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   V  E+ LG   G   +V        G  ++  +GL   +    ++ +  T L+  
Sbjct: 71  LFF--VAQEVVLGAAVGFTFQVVFQMFVLGGQFMAMKMGLGFASMNDPTNGVQTTVLSQF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L    ++ H  +   +V S+ T+  G+ +   + F   V +    F   L ++ 
Sbjct: 129 FLMLVTLMFVAVEGHLVLISLIVDSFHTLQPGRFVFASSNFYEIVKLGSWMFAAALLMAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  NI+ G++++  PQ+ I+ +  P+ +  G L + L +      F  +  YGF
Sbjct: 189 PVITSLLFVNIAFGIMSRAAPQLNIFAVGFPFTLMCGLLLIWLGLTHFSEIFETAITYGF 248


>gi|86573910|gb|ABD08467.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           HaA2]
          Length = 283

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 70/234 (29%), Positives = 122/234 (52%), Gaps = 1/234 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  RVG+ +MLLP L  S IP +++L  A+  ++++LP   +   +    +    
Sbjct: 41  AAFMLVFARVGAMVMLLPTLGESNIPTRIKLSIALGLTLIILPLHRNAYQVD-MSSLTPL 99

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             L++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + + 
Sbjct: 100 LVLMIQEIIIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFLT 159

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           I+G+  L+  D HH V  AL  SY     G+ LN G++ +        +F I ++L++PF
Sbjct: 160 ILGVTMLFATDSHHLVIEALSDSYKIFAPGELLNSGDVAALATKAFAASFKIGMQLAAPF 219

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           L F +VFNI +G+L +L+PQ+ +YF+  P  I +G +     +  ++  F   F
Sbjct: 220 LVFGLVFNIGLGILARLMPQMQVYFVGVPLSIMIGFVIFAAVLTTMMGTFLAYF 273


>gi|120554899|ref|YP_959250.1| flagellar biosynthesis protein FliR [Marinobacter aquaeolei VT8]
 gi|120324748|gb|ABM19063.1| flagellar biosynthetic protein FliR [Marinobacter aquaeolei VT8]
          Length = 261

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 99/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + R+ S +M++P      +P +VRL  A+  +I++ P +     ++     
Sbjct: 13  QWVGQHIWPLFRLASFLMVIPIFGTQLVPARVRLGLALLMTILIAPMIPPVPQVEALSAD 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    + + ++ +G   G  +          G +I+  +GL   + +  ++ +    L  
Sbjct: 73  A--VVITLQQILIGIGLGFALTALWQLFVIAGQMIAMQMGLGFASMVDPANGVNVPVLAQ 130

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  I   L   V++ H   F   ++S+ T+PIG E    +   +  + +   F   + L+
Sbjct: 131 IYTITITLLFLVMNGHLVAFEVFIESFYTLPIGLEGLGQDGVWALAHRISWMFASAMLLA 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ NIS G++ +  PQ+ I+ +  P  +  G   + +     +  F       
Sbjct: 191 LPAVTAVLIVNISFGVMTRAAPQMNIFALGFPIGLIFGLFAIWVLHANFLPHFDQYTRET 250

Query: 247 F 247
           F
Sbjct: 251 F 251


>gi|303240270|ref|ZP_07326789.1| flagellar biosynthetic protein FliR [Acetivibrio cellulolyticus
           CD2]
 gi|302592180|gb|EFL61909.1| flagellar biosynthetic protein FliR [Acetivibrio cellulolyticus
           CD2]
          Length = 261

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 109/232 (46%), Gaps = 2/232 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI  R+    ++ P  S + IP  +++ F+   +++L+  + +   + N  N   ++ 
Sbjct: 15  FLLIFIRMAGLFVIAPIFSRANIPTYLKIGFSFMLALILVNTISNQNIVIN--NIYEFAA 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E  +G   G +       +   G +I   IG  +   +    ++  +  ++   I+
Sbjct: 73  LVIREFVVGITLGYVSYTIFNAIYIAGELIDMQIGFGVVNVIDPISNIQVSITSTFYFIL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L   + + HH +  AL  SY  +P+GQ +    + S  + +    F+I  ++++P L 
Sbjct: 133 CMLVFILCNGHHILIRALFSSYEYVPLGQAVFGSGLQSRILEIFGGIFLIAFKIAAPMLT 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             ++ ++++G+++K VPQ+ ++ +  P  I LG   + L++ + +       
Sbjct: 193 AILITDVALGVISKTVPQLNVFVVGMPLKIILGLAVMVLTMPLFISIVETLI 244


>gi|332524234|ref|ZP_08400460.1| flagellar biosynthetic protein FliR [Rubrivivax benzoatilyticus
           JA2]
 gi|332107569|gb|EGJ08793.1| flagellar biosynthetic protein FliR [Rubrivivax benzoatilyticus
           JA2]
          Length = 253

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 95/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L     R  +    +P L    +P +VR+  A   +    P L     +     +
Sbjct: 11  GWITPLIWPFLRALALFTAMPVLGTRSVPTRVRIGLAGLIAFAAQPSLPAVEPVPLDSPQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    LV+ ++ +G   G  +R+    ++F G ++   +GLN             T  + 
Sbjct: 71  A--FVLVVQQVVIGLSLGFAVRIVFAAVEFAGEIVGLQMGLNFAAFFDPIRGGTATATSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G        VI+ H  V  ALV+S+   P+G E       +         F   + ++
Sbjct: 129 FYGTTIAWLFIVINGHLLVIAALVQSFTAFPVGPEPFGFLKEARPHLWAAEIFSTGVWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P L   +  NI +G ++++ PQ+ ++ +  P  +G+G + + L++  +   F+ +    
Sbjct: 189 LPLLAMLLFVNIVLGAVSRVAPQMNVFSVGFPITLGVGLVGILLTLPAMQGPFTVALERL 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|209522298|ref|ZP_03270925.1| flagellar biosynthetic protein FliR [Burkholderia sp. H160]
 gi|209497274|gb|EDZ97502.1| flagellar biosynthetic protein FliR [Burkholderia sp. H160]
          Length = 260

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 104/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + +      R+ + I   P      +P +V++  A   +I++ P +     +  F   
Sbjct: 11  VWLTAFLWPFARIAALIATAPIFGNMSLPSRVKIGLAAFATIIVAPTIGALPQVTVFSAA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   +  +G   G+ +++    +  TG  I   +GL   T      + +   ++ 
Sbjct: 71  GVWILV--NQFLIGIALGVTMQIVFQAIDATGYFIGLGMGLGFATFFDQQATGSGVVISR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I  L    +D H Q+  ALV ++ ++P+   L   + + +  N   + F   L L+
Sbjct: 129 YMTTIATLVFLAVDGHLQMIAALVTTFQSVPVSANLLAPHGWQTLANWGGSIFSAGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L + L +  ++  F   F  G
Sbjct: 189 LPVVVALLIANLALGILNRAAPQIGVFQIGFPLTMLVGLLLVQLMLPNMIPFFVRLFDSG 248


>gi|193222345|emb|CAL62040.2| Flagellar biosynthetic protein FliR [Herminiimonas arsenicoxydans]
          Length = 263

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S    + R+   I + P      +P +V++   +  ++++ P +     +      
Sbjct: 11  TWIASFLWPLTRILGLISVAPLFGNVSVPARVKISLGIMLALIIAPTVPALPAMDPMSPA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +    L +G   G  +R+   G++  G +    +GL   +          + ++ 
Sbjct: 71  GLLILVQQ--LLIGLTMGFAMRIVFAGVEMAGEITGMTMGLGFASFFDPQTRARSSAISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ L+     + H  V   L +S+  +PI         F   V      F   ++LS
Sbjct: 129 FLALLILMIYLSTNLHLVVLSTLAQSFELLPISSNFVSTEGFFQVVKWGGRIFSAGVQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ NI++G+L +  PQ+ I+ I  P  IG+G + + + +  ++  F +    G
Sbjct: 189 LPMVAALLMTNIALGILTRAAPQLNIFGIGFPITIGVGFIMIAIVLPYLMNPFINLMQEG 248


>gi|167617385|ref|ZP_02386016.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           Bt4]
          Length = 260

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 104/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + L P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVALAPVTGHRATPVRVKIGLAGFMALVVAPTLPPMPAATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAVEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +PI  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPISADLLRAAGWQTLVAFGSAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|90579939|ref|ZP_01235747.1| flagellar biosynthesis protein [Vibrio angustum S14]
 gi|90438824|gb|EAS64007.1| flagellar biosynthesis protein [Vibrio angustum S14]
          Length = 260

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 96/240 (40%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M +      ++  ++RL  A+A +  +LP L         ++ A
Sbjct: 11  WIANYFWPFTRISSMMMAMTFFGARFVSPKIRLYLALAITFAVLPVLPKVPQDIELLSLA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   +L +G   GL+ +  T      G ++     L   + +  ++      L   
Sbjct: 71  GFI-VTTQQLIIGVAMGLVTQFITQIFVLLGQILGMQSSLGFASMVDPANGQNTPVLGQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + +L     D H ++  A+V S+ T+PIG+ +     +          F   + ++ 
Sbjct: 130 YMFLAILLFLATDGHLEMLNAVVLSFKTLPIGEAMLQPKDYYQLAGWFGHMFKAGVNMAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +   +  N+S G++ +  PQ+ I+ +   + + LG       +  IV Q+   +  G 
Sbjct: 190 AGVIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLLGLAISWFIVLGIVPQYEAIWQVGL 249


>gi|147678409|ref|YP_001212624.1| flagellar biosynthesis protein FliR [Pelotomaculum
           thermopropionicum SI]
 gi|146274506|dbj|BAF60255.1| flagellar biosynthesis pathway, component FliR [Pelotomaculum
           thermopropionicum SI]
          Length = 254

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 102/236 (43%), Gaps = 2/236 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + FL+  R  + +   P  ++  +P  ++  F +A + V+ P L   ++    ++  
Sbjct: 6   YLAAFFLVFLRTAAFMTAGPLYALRGVPPLLKAAFCLALAAVIFPVL--DLNEPLPLDAW 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y      E  LG + G  + +     +  G +I   IG ++            T L+  
Sbjct: 64  GYGLAAARETGLGLLLGTAVTMILNSFRMAGQIIDFQIGYSMAALADPQYGTQNTLLSQY 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ L+   V+D H+ +   LV+SY  +P+   +  G   S  + M   +F I L++S+
Sbjct: 124 LYLLALVFFLVVDGHYSLIAGLVESYRLVPLNAAVFNGAAASVLLRMFSGSFAIALQVSA 183

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P L   ++ ++++G L +  PQ+ ++    P  I  G L L   I ++        
Sbjct: 184 PVLAVLVICDLTLGFLARTAPQLNVFLTGFPVKIAAGLLTLSFLIPLLGTVLRSLL 239


>gi|167579279|ref|ZP_02372153.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           TXDOH]
          Length = 260

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 104/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + L P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVALAPVTGHRATPVRVKIGLAGFMALVVAPTLPPMPAATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +PI  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPISADLLRAAGWQTLVAFGSAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|71277858|ref|YP_268256.1| flagellar biosynthesis protein FliR [Colwellia psychrerythraea 34H]
 gi|71143598|gb|AAZ24071.1| flagellar biosynthetic protein FliR [Colwellia psychrerythraea 34H]
          Length = 260

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 94/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M    L   R+ + IM + G S   IP +V++   ++ +I ++P +         +  
Sbjct: 10  QYMADFVLPFSRISALIMTMIGFSSKTIPGRVKVFLCISITIAVMPAIPP--ASVTNLMS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
              + L+  ++ +G + G +  +        G +I+   GL   + +  +  +    +  
Sbjct: 68  LNTAILLGQQMIIGVMLGFVTIMVVNTFTLAGQIIAMQSGLGFASLVDPASGMNVPAIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  WV+D H      +V S+ T+PI  E      +   V      F   L L+
Sbjct: 128 FFLILSSLLFWVMDGHLAYLQFIVASFDTLPIPTEHLSSIKYREVVEWGGWMFATALSLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N S G++ +  PQ+ I+ I  P  +  G L + L+       F   +   
Sbjct: 188 LAPITAMLLINFSFGIMTRAAPQLNIFAIGFPITMMAGLLIMWLTFGNFFTHFELQWQRA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|167900655|ref|ZP_02487860.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei NCTC
           13177]
          Length = 260

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 104/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +P+  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFKLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|107021597|ref|YP_619924.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia AU
           1054]
 gi|116688059|ref|YP_833682.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           HI2424]
 gi|170731409|ref|YP_001763356.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           MC0-3]
 gi|254246636|ref|ZP_04939957.1| Flagellar biosynthesis protein FliR [Burkholderia cenocepacia
           PC184]
 gi|105891786|gb|ABF74951.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia AU
           1054]
 gi|116646148|gb|ABK06789.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           HI2424]
 gi|124871412|gb|EAY63128.1| Flagellar biosynthesis protein FliR [Burkholderia cenocepacia
           PC184]
 gi|169814651|gb|ACA89234.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           MC0-3]
          Length = 260

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 56/241 (23%), Positives = 110/241 (45%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPMVGHAAVPVRVKIGVAAFMALVVAPTLGAMPDVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   +  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWILV--NQFLIGVAMGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPAMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QVF AL  S+ ++P+  +L     + +      T F + L LS
Sbjct: 129 FLNAVAMLAFLAVDGHLQVFAALAASFQSLPVSADLLHAPGWRTLAAFGATVFEMGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI +Y I  P  + +G L + L I  +V   SH F  G
Sbjct: 189 LPVVVALLIANLALGILNRAAPQIGMYQIGFPVTLIVGLLLVQLMIPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|120613019|ref|YP_972697.1| flagellar biosynthetic protein FliR [Acidovorax citrulli AAC00-1]
 gi|120591483|gb|ABM34923.1| flagellar biosynthetic protein FliR [Acidovorax citrulli AAC00-1]
          Length = 247

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 99/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +  M+ P  SM  IP++ ++  A   ++     L D   +      
Sbjct: 2   AWLSPVLWPFLRVLAVFMVAPVFSMRSIPVRAKVGLAFLVAVCAQAVLPDQPVVSVNGRE 61

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     V  ++ +G   G  +R+    ++  G V+   +GLN  +    S S   + +  
Sbjct: 62  A--LGAVAQQVAVGMSVGFAVRLVFTAVELAGEVVGLQMGLNFASFFDPSTSGQVSAVGR 119

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G + +L   VI+ H  V  A+VKS+ + P+               +  + F   L ++
Sbjct: 120 FFGHMAMLLFVVINGHLMVLMAVVKSFDSFPVDGNFLQSIGQMRLHELGASLFSSALWIA 179

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 180 LPMIALLMFVNLALGVISRVAPQMNIYAVGFPVTLTVGLLGIAATLPMLEQPVLTLMQQS 239


>gi|126442304|ref|YP_001057089.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 668]
 gi|126455304|ref|YP_001064319.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106a]
 gi|134281514|ref|ZP_01768222.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 305]
 gi|167717399|ref|ZP_02400635.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           DM98]
 gi|167813517|ref|ZP_02445197.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 91]
 gi|167843672|ref|ZP_02469180.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           B7210]
 gi|167892143|ref|ZP_02479545.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           7894]
 gi|167916914|ref|ZP_02504005.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           BCC215]
 gi|237814427|ref|YP_002898878.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           MSHR346]
 gi|242317745|ref|ZP_04816761.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106b]
 gi|254194718|ref|ZP_04901149.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei S13]
 gi|254298635|ref|ZP_04966086.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           406e]
 gi|126221797|gb|ABN85303.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 668]
 gi|126228946|gb|ABN92486.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106a]
 gi|134247181|gb|EBA47267.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 305]
 gi|157808738|gb|EDO85908.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           406e]
 gi|169651468|gb|EDS84161.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei S13]
 gi|237506029|gb|ACQ98347.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           MSHR346]
 gi|242140984|gb|EES27386.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1106b]
          Length = 260

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 104/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +P+  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|94968668|ref|YP_590716.1| flagellar biosynthetic protein FliR [Candidatus Koribacter
           versatilis Ellin345]
 gi|94550718|gb|ABF40642.1| flagellar biosynthetic protein FliR [Candidatus Koribacter
           versatilis Ellin345]
          Length = 253

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 103/242 (42%), Gaps = 4/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E+ + S+ L+  R+ + ++  P  S + IP +V+    +  +I+L P +         ++
Sbjct: 5   EVWVQSIVLVGTRIAALVLFAPFFSHAAIPPRVKGGLVVLLTILLYPSVIS----ATVLS 60

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    +V+ E F+G + GL   +    +QF G  +   +GL+L + +          L+
Sbjct: 61  ASEVVGVVLHETFIGMLIGLSSVLVFEAVQFAGQCLGIEVGLSLVSVLDPQTQADSPVLS 120

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+  I LL    ++ HH +  AL  SY  IP G     G +           F + +++
Sbjct: 121 VLLQTILLLLFLDLNVHHWLLRALADSYRLIPPGAGRLTGVVVQDLFQQAGMIFALGVQI 180

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           ++P L   ++ +I    L K  PQ+P+  +  P    LG   L   +      F  +F  
Sbjct: 181 AAPVLAATLLADIVFAFLAKASPQMPVLLLGMPVKFVLGLTTLWAGLRFWPVIFDRNFAL 240

Query: 246 GF 247
             
Sbjct: 241 AL 242


>gi|53717671|ref|YP_106657.1| flagellar biosynthetic protein [Burkholderia pseudomallei K96243]
 gi|76810974|ref|YP_331662.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710b]
 gi|167908875|ref|ZP_02495966.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 112]
 gi|254258615|ref|ZP_04949669.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710a]
 gi|52208085|emb|CAH34015.1| flagellar biosynthetic protein [Burkholderia pseudomallei K96243]
 gi|76580427|gb|ABA49902.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710b]
 gi|254217304|gb|EET06688.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1710a]
          Length = 260

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 103/240 (42%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPIPVATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +P+   L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPVSANLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|88800469|ref|ZP_01116033.1| flagellar biosynthesis protein [Reinekea sp. MED297]
 gi|88776799|gb|EAR08010.1| flagellar biosynthesis protein [Reinekea sp. MED297]
          Length = 263

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 97/236 (41%), Gaps = 2/236 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +        R+G+  +++P L    IP++VRL  A   +  + P L D   ++    + 
Sbjct: 17  WVSHFMWPFFRLGAFFVIVPVLGARLIPVRVRLGLAFVITYTIYPLLPDMPIIEAVDVQT 76

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +    ++ ++ +G   G L+ V        G  IS  +GL   + +  ++ ++   L+  
Sbjct: 77  FMI--ILEQILIGTTLGFLVFVILQIFILAGQTISMQMGLGFASMVDPANGVSVAVLSQW 134

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L    I+ H      +V S+ T+P+GQ L     +          F   L L+ 
Sbjct: 135 YQVLVTLVYLAINGHLLTLEVVVDSFYTLPVGQGLFTVESWRLLSEFGAWLFRASLMLAL 194

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   ++ N++ G++ +  PQ+ ++ +  P  +  G + + +S            
Sbjct: 195 PAVTALLLVNLTFGVMTRAAPQLNVFALGFPITMLGGLVIVWVSYAAAAPLVRQYL 250


>gi|53724241|ref|YP_104208.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           23344]
 gi|67641566|ref|ZP_00440342.1| flagellar biosynthetic protein FliR [Burkholderia mallei GB8 horse
           4]
 gi|121598912|ref|YP_994548.1| flagellar biosynthetic protein FliR [Burkholderia mallei SAVP1]
 gi|124384712|ref|YP_001027836.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10229]
 gi|126448436|ref|YP_001082216.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10247]
 gi|167001621|ref|ZP_02267415.1| flagellar biosynthetic protein FliR [Burkholderia mallei PRL-20]
 gi|254175309|ref|ZP_04881970.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           10399]
 gi|254206623|ref|ZP_04912974.1| flagellar biosynthetic protein FliR [Burkholderia mallei JHU]
 gi|254357356|ref|ZP_04973630.1| flagellar biosynthetic protein FliR [Burkholderia mallei
           2002721280]
 gi|52427664|gb|AAU48257.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           23344]
 gi|121227722|gb|ABM50240.1| flagellar biosynthetic protein FliR [Burkholderia mallei SAVP1]
 gi|124292732|gb|ABN02001.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10229]
 gi|126241306|gb|ABO04399.1| flagellar biosynthetic protein FliR [Burkholderia mallei NCTC
           10247]
 gi|147752165|gb|EDK59231.1| flagellar biosynthetic protein FliR [Burkholderia mallei JHU]
 gi|148026420|gb|EDK84505.1| flagellar biosynthetic protein FliR [Burkholderia mallei
           2002721280]
 gi|160696354|gb|EDP86324.1| flagellar biosynthetic protein FliR [Burkholderia mallei ATCC
           10399]
 gi|238522519|gb|EEP85963.1| flagellar biosynthetic protein FliR [Burkholderia mallei GB8 horse
           4]
 gi|243062631|gb|EES44817.1| flagellar biosynthetic protein FliR [Burkholderia mallei PRL-20]
          Length = 260

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 103/240 (42%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +P+   L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPVSANLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|269103166|ref|ZP_06155863.1| flagellar biosynthesis protein FliR [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163064|gb|EEZ41560.1| flagellar biosynthesis protein FliR [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 260

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 99/240 (41%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + +      R+ S +M +      ++  ++RL  A+  +  ++P L         ++  
Sbjct: 11  WLANYMWAFIRISSMMMTMTFFGARFVSAKIRLYLALTITFAVVPVLPQVPQDIALLSLH 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   ++ +G   GL+ +  T      G +++    L   + +  ++      L  L
Sbjct: 71  GFI-ITTQQIVIGAAIGLVTQFITQSFVLLGQILAMQSSLGFASMVDPANGQNTPVLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + ++   + D H ++   +VKS+ T+PIG+ +  G  +          F + L ++ 
Sbjct: 130 YLFLAIILFLMTDGHLEMLELIVKSFTTLPIGKAMFNGQDYYQLALWFGHMFKMALSMAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +   +  N+S G++ +  PQ+ I+ +   + + +G +     +  ++  +   + +G 
Sbjct: 190 AGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLIGFVISWFVVRGLLPHYEQYWQFGL 249


>gi|83721282|ref|YP_440592.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           E264]
 gi|83655107|gb|ABC39170.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           E264]
          Length = 260

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 103/240 (42%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + L P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVALAPVTGHRATPVRVKIGLAGFMALVVAPTLPPMPAATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAVEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF  LV S+  +PI  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAVLVDSFRLVPISADLLRAAGWQTLVAFGSAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|217424090|ref|ZP_03455590.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 576]
 gi|254184097|ref|ZP_04890688.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1655]
 gi|184214629|gb|EDU11672.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           1655]
 gi|217393153|gb|EEC33175.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 576]
          Length = 260

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 105/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P  S    P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTSHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +P+  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPVSADLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|167822059|ref|ZP_02453530.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 9]
 gi|226193326|ref|ZP_03788936.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           Pakistan 9]
 gi|225934926|gb|EEH30903.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei
           Pakistan 9]
          Length = 260

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 103/240 (42%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P       P++V++  A   ++V+ P L        F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPVATVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +P+   L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHVQVFAALVDSFRLVPVSANLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDTG 248


>gi|77463636|ref|YP_353140.1| flagellar protein FliR [Rhodobacter sphaeroides 2.4.1]
 gi|126462468|ref|YP_001043582.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17029]
 gi|332558492|ref|ZP_08412814.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides WS8N]
 gi|3435111|gb|AAC32324.1| flagellar protein FliR [Rhodobacter sphaeroides]
 gi|77388054|gb|ABA79239.1| Flagellar protein FliR [Rhodobacter sphaeroides 2.4.1]
 gi|126104132|gb|ABN76810.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17029]
 gi|332276204|gb|EGJ21519.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides WS8N]
          Length = 269

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 95/235 (40%), Gaps = 2/235 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F+   R+G+ ++  P     ++P+ VR+   +  ++ +L  +   +     +       L
Sbjct: 23  FVASLRIGAFLIASPAFGGRFVPLPVRIVATVILTLPVLGRV--ELPPPEELASLAAIPL 80

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +M E+ +G   GL++ +        G  I++  GL     +  S       +  + G+  
Sbjct: 81  MMQEIAVGLSAGLVLTILFSAAALAGDRIASTAGLGFAAQIDPSAGGQTPVVAQIFGLAL 140

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
                 +D H      L++SY ++P G     G    + +      F++ L++  P +  
Sbjct: 141 TTVFLALDGHLTALDILLRSYESLPPGAPFAPGRFLEAGIGAGGRMFLLGLQIMMPVVAA 200

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            I+ N++IG++ +  PQ+ ++    P  +    + L L+    +  FS       
Sbjct: 201 LILINVTIGIVTRSAPQLNVFSFGFPVTMSATLILLFLTAPGTMGAFSGLVEESL 255


>gi|302389678|ref|YP_003825499.1| flagellar biosynthetic protein FliR [Thermosediminibacter oceani
           DSM 16646]
 gi|302200306|gb|ADL07876.1| flagellar biosynthetic protein FliR [Thermosediminibacter oceani
           DSM 16646]
          Length = 254

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 102/242 (42%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E I+++  L+  R+    +L P       P+Q RL  +   +++L P +     +    N
Sbjct: 2   EFIIVNFLLVFFRILGFFILTPVFGRREFPVQGRLGVSALIAVILYPVVN---KIPLPDN 58

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L + E  +G   G +  V    +   G +I   +G  +   +    +     + 
Sbjct: 59  LWDTVILFIRETAVGLSIGFITFVVFSAVYICGEIIDLQMGFGIVNVIDPQTNAQIPVMG 118

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +   I+ +L    I+ HH +  AL+KSY  +P+G      +     +      F   +++
Sbjct: 119 NFFYILTILIFLSINGHHVLLNALMKSYDILPLGGAGLHDSFLEGMLKSFFEMFAAGVKM 178

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +    + + ++G++ + VPQ+ ++ +  P+ I +G + L +++ + V      F  
Sbjct: 179 SIPVVAATFLADFALGVIARTVPQMNVFIVGLPFKIIIGFIALIIALPMYVLALDVLFSG 238

Query: 246 GF 247
            +
Sbjct: 239 SY 240


>gi|253996311|ref|YP_003048375.1| flagellar biosynthetic protein FliR [Methylotenera mobilis JLW8]
 gi|253982990|gb|ACT47848.1| flagellar biosynthetic protein FliR [Methylotenera mobilis JLW8]
          Length = 263

 Score =  121 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 109/241 (45%), Gaps = 3/241 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  ++SL   + R+ + I ++P LS + IP +V+L  ++  +I+++P +      + F  
Sbjct: 10  QTWVISLLWPLTRILAVIAIVPILSHATIPRRVKLGLSVLLTIIIVPTIPPLPQFEAFSL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +   ++ +G   G  +R+    +   G +I   +GL          +   T LN
Sbjct: 70  EGLLILV--QQVIIGFAIGFSMRLVFAAVDLAGQLIGLTMGLGFAQFFDPQTNGQSTALN 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L    +D H  +  A+ +S+ T+PIG      +          T F   L L
Sbjct: 128 QLLVLLAMLIFLSLDGHLIIVSAMARSFITMPIGLGGAGIDAMQ-IALWGNTIFSAGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   ++ N+++G+L +  PQ+ ++ I  P  + +G + + LS+  ++         
Sbjct: 187 ALPAVCALLITNMALGILTRTAPQLNLFGIGFPITLSMGFVVVALSLSSMLQPIIKFIEQ 246

Query: 246 G 246
           G
Sbjct: 247 G 247


>gi|145598594|ref|YP_001162670.1| flagellar biosynthesis protein FliR [Yersinia pestis Pestoides F]
 gi|108779103|gb|ABG13161.1| flagellar biosynthetic protein FliR [Yersinia pestis Antiqua]
 gi|145210290|gb|ABP39697.1| flagellar biosynthetic protein FliR [Yersinia pestis Pestoides F]
          Length = 284

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + RV + I   P LS   I  +V++   +  + ++ P L     +   + 
Sbjct: 34  SVWVSQYFWPLVRVLALIGTAPLLSEKQINKKVKIGLGVLITFLIAPSLP---PVNIPLF 90

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    + + ++ +G   G+ ++     ++ +G VI   +GL+  T    S       L+
Sbjct: 91  SSAALWVAIQQILIGVALGVTMQFAFAAVRLSGEVIGLQMGLSFATFFDPSGGPNMPVLS 150

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ I+  L     D H  +   L  S+ T+PI      GN F +        FM  L L
Sbjct: 151 RLLNILVTLLFLSFDGHLWLISLLADSFHTLPIQFAPLNGNGFLTLAQSGSMIFMNGLML 210

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 211 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLFSE 270

Query: 246 GF 247
            F
Sbjct: 271 FF 272


>gi|330961235|gb|EGH61495.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 258

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 114/242 (47%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + +  L + R+ S +M +P +  + +P +VRL  A+A ++V+ P L +   +Q    
Sbjct: 10  STWVAAFMLPLFRIISLLMTMPIIGTTLVPRRVRLYLAVAITVVVAPALPNMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLSMNGHLVVLEILVESFTTMPVGSGLLVNNFWE-LANGLGWVLSSGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + +G + L L+I  I+ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVMGMVILWLTIGDILNQYQPIASQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|220932507|ref|YP_002509415.1| flagellar biosynthetic protein FliR [Halothermothrix orenii H 168]
 gi|219993817|gb|ACL70420.1| flagellar biosynthetic protein FliR [Halothermothrix orenii H 168]
          Length = 259

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 96/237 (40%), Gaps = 1/237 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
              LI+ R     ++ P       P++V++  A+  + + LP +     ++         
Sbjct: 13  QFLLIMFRYLGLFLIAPVFGSRVYPVRVKVSLALMLTFITLPLIGGQT-VELPQQTVGIL 71

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             V+ E  +G + G +  +    +Q  G  I   +G  +   M     +    +     I
Sbjct: 72  LDVIRESLIGFIIGYIFYLVFASIQLAGQFIDVRMGFAIANVMDPISGVTAPVVGQFKNI 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + +L    I+ HH +   L +S+  IP+        +F+         F+I  +++ P +
Sbjct: 132 MAILVFLAINGHHLLLEGLYRSFQIIPLRGLTLGSEVFNLLFRTTGNMFIIAFKIALPVM 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
               + ++  G L + VPQ+ I+ I  P  I +G + L LS+ + VY F   F   +
Sbjct: 192 GTLFIADVVFGFLARTVPQMNIFIIGLPMKILIGFIMLILSLGVAVYFFQDLFSEFY 248


>gi|319764503|ref|YP_004128440.1| flagellar biosynthetic protein flir [Alicycliphilus denitrificans
           BC]
 gi|317119064|gb|ADV01553.1| flagellar biosynthetic protein FliR [Alicycliphilus denitrificans
           BC]
          Length = 254

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 100/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +     P  SM  IP++VR+  A   ++     L     +      
Sbjct: 11  AWLSPVLWPFLRVLALFTSAPVFSMRAIPVRVRIGLAFLVALCAQAALPGQPVIDLNGRE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A  +  V+ ++ +G   G  +R+  + ++  G VI   +GLN  +    + +   + +  
Sbjct: 71  A--AGAVLQQVGVGLAIGFAVRLVFVAVELAGEVIGLQMGLNFASFFDPASNAQVSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G I +L   V++ H  V  A+VKS+ + P+               +  + F   L ++
Sbjct: 129 FFGNIAMLLFVVVNGHLMVLMAVVKSFESFPVDGHFLQAVAQMRLHELGASVFASGLWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 189 LPMIALLLFVNLTLGVISRVAPQMNIYAVGFPVTLTVGMLGITATLPMLEQPMLTLLQQA 248


>gi|118581842|ref|YP_903092.1| flagellar biosynthetic protein FliR [Pelobacter propionicus DSM
           2379]
 gi|118504552|gb|ABL01035.1| flagellar biosynthetic protein FliR [Pelobacter propionicus DSM
           2379]
          Length = 264

 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 109/243 (44%), Gaps = 1/243 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    +  ++   L++ R+      LP      +P+Q+R+   MA S++  P L      
Sbjct: 5   LPFPSQREIILFALVLGRMAGMFSALPVFGGKRLPLQIRVVAVMAMSLICFPLLNVNAP- 63

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               +    + L + E+ +G     + ++    ++F+G +I   +G  +   M  +    
Sbjct: 64  NIPDDTISLALLALREVMIGITLSFVTQIIFSAVEFSGQIIGMQMGFTMAAIMDPTHGTQ 123

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              ++ +  ++  L    +  HH    A+V S+  IP+G     G I +         F+
Sbjct: 124 SQVMSVMQSLLATLMFLCMSIHHLFIRAIVDSFHIIPLGVWHLNGEIITFLTRATADVFV 183

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + +RL++P +   ++ ++++G++ +  PQ+ ++ IS P  IG+G + L  ++ +  +   
Sbjct: 184 LGVRLAAPVMVALLLTSVTLGIMARSFPQMNVFMISFPLNIGIGFIILGATLPMFFHVLE 243

Query: 241 HSF 243
            SF
Sbjct: 244 VSF 246


>gi|330876031|gb|EGH10180.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964681|gb|EGH64941.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 258

 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 111/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SG--LLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLSMNGHLVVLEILVESFTTMPVGGGLLVNNFWE-LANGLGWALSSGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+      
Sbjct: 187 VLPAVTALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQPIATQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|326319059|ref|YP_004236731.1| flagellar biosynthetic protein FliR [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375895|gb|ADX48164.1| flagellar biosynthetic protein FliR [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 256

 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 99/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +  M+ P  SM  IP++ ++  A   ++     L D   +      
Sbjct: 11  AWLSPVLWPFLRVLAVFMVAPVFSMRSIPVRAKIGLAFLVAVCAQAVLPDQPVISVNGRG 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     V  ++ +G   G  +R+    ++  G V+   +GLN  +    S S   + +  
Sbjct: 71  A--LGAVAQQVAVGMSVGFAVRLVFSAVELAGEVVGLQMGLNFASFFDPSTSGQVSAVGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G + +L   VI+ H  V  A+VKS+ + P+              ++  + F   L ++
Sbjct: 129 FFGHMAMLLFVVINGHLMVLMAVVKSFDSFPVDGNFLQSIGQMRLHDLGASLFSSALWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +      N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 189 LPMIALLTFVNLALGVISRVAPQMNIYAVGFPVTLTVGLLGIAATLPMLEQPVLTLMQQS 248


>gi|197120183|ref|YP_002140610.1| flagellar biogenesis protein FliR [Geobacter bemidjiensis Bem]
 gi|197089543|gb|ACH40814.1| flagellar biogenesis protein FliR [Geobacter bemidjiensis Bem]
          Length = 261

 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 107/243 (44%), Gaps = 1/243 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           + ++    ++ L L++ RV      +P      +P +V++    A ++++ P +   + +
Sbjct: 5   LPLTSLADLIPLALVLARVAGLFSAIPMFGARLVPARVKMGLIFAMTLLIFPVIKPHV-V 63

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
            N  +      LV+ E  +G   G + +     ++F G ++ T +G+++      +    
Sbjct: 64  PNVSDSLGLMLLVLQETLIGLTLGAVSQFIFAAVEFCGQLVGTQMGISMAAQFDPATQNN 123

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              +    G +  L     + H      +V SY  +P+G     G +    V      F+
Sbjct: 124 VPTMAIFQGALATLLFLAFNVHEYFIRGIVDSYRVVPLGAWHVSGGLLKFLVETSTGIFI 183

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I ++L++P     +  ++++G++ +  P + ++ +S P  IG+G + L +S+ + V    
Sbjct: 184 IAIKLAAPVSVALLATSVALGIVARSFPAMNVFMVSMPLNIGIGFVILGISLPVFVRVLQ 243

Query: 241 HSF 243
            SF
Sbjct: 244 GSF 246


>gi|326204608|ref|ZP_08194464.1| flagellar biosynthetic protein FliR [Clostridium papyrosolvens DSM
           2782]
 gi|325985175|gb|EGD46015.1| flagellar biosynthetic protein FliR [Clostridium papyrosolvens DSM
           2782]
          Length = 265

 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 99/235 (42%), Gaps = 1/235 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI  R+    +  P      IP+  ++ FA   + +L   +     + N  N   ++ 
Sbjct: 15  FLLIFVRMTGLFVTAPIFGRRNIPVYFKVGFAF-ITAILASSVIKVDHIINTDNFLIFAL 73

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            ++ E  +G + G +       +   G +I   IG  +        ++      +L  I+
Sbjct: 74  YILKEFLVGIIIGFVAYAVFTCIYLAGQIIDMQIGFGMVNVFDPMSNIQIPVTANLYFIL 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            ++   V + HH +  AL +S+  +P+G  +         + ++   F +  ++++P + 
Sbjct: 134 AMIIFLVTNGHHMLIKALFESFQLVPLGSGVIGPKFTDDVIGLISGVFSMGFKIAAPVVA 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              + ++ +G+++K +PQ+ ++ +  P  I LG L + ++I   VY  +      
Sbjct: 194 AIFITDVVLGIISKTIPQMNVFILGMPLKIFLGILIVMITIPAFVYIVTVITDDM 248


>gi|167560943|ref|ZP_02353859.1| flagellar biosynthetic protein FliR [Burkholderia oklahomensis
           EO147]
 gi|167568202|ref|ZP_02361076.1| flagellar biosynthetic protein FliR [Burkholderia oklahomensis
           C6786]
          Length = 260

 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 103/240 (42%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P       P++V++  A   ++V+ P L     +  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVTGHRATPVRVKIGLAGFMALVVAPTLGPMPVVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHASGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +LA    D H QVF ALV S+  +PI   L     + + V      F + L L+
Sbjct: 129 FLNAIAILAFLAFDGHLQVFAALVDSFRLVPISAGLLRAPGWQTIVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    +V      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLVPFVGRLFDTG 248


>gi|189426337|ref|YP_001953514.1| flagellar biosynthetic protein FliR [Geobacter lovleyi SZ]
 gi|189422596|gb|ACD96994.1| flagellar biosynthetic protein FliR [Geobacter lovleyi SZ]
          Length = 265

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 114/241 (47%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +  +  +    LI+CR+G     LP      +P ++++   +A ++V LP L  T     
Sbjct: 8   LPSQSDVFLFALILCRIGGLFAALPVFGGKRLPTRIKIAAVLAITLVCLPVLKITPP-PL 66

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
             +      LVM E+ +G     + ++    ++F+G +I   +G ++ + +  S      
Sbjct: 67  PGDAFTLGLLVMREMLIGLTLAFITQIIFAAVEFSGQIIGLQMGFSISSVLDPSMGTQTQ 126

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            ++ +  ++  L    ++ HH    A+V S+  IP+G       +    VN     F++ 
Sbjct: 127 IMSVVQSLLATLFFLSLNIHHVFISAIVDSFTVIPLGGWKMSEALIHFLVNATSEVFILG 186

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +RL++P +   ++ ++ +G++ +  PQ+ ++ +S P  IGLG + L +++ +  +    S
Sbjct: 187 IRLAAPVMVALLLTSVVLGIMARAFPQMNVFMVSFPLNIGLGFMVLGMTLLLFFHVLELS 246

Query: 243 F 243
           F
Sbjct: 247 F 247


>gi|289629018|ref|ZP_06461972.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298487819|ref|ZP_07005859.1| Flagellar biosynthesis protein fliR [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157544|gb|EFH98624.1| Flagellar biosynthesis protein fliR [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330880587|gb|EGH14736.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 258

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 111/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SG--LLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLSMNGHLVVLEVLVESFTTMPVGGGLLVNNFWE-LANGLGWALSSGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +S+  I+ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMSMGDILNQYQPIASQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|257484901|ref|ZP_05638942.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289651608|ref|ZP_06482951.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|320325129|gb|EFW81198.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329388|gb|EFW85381.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330866460|gb|EGH01169.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330889045|gb|EGH21706.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986504|gb|EGH84607.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011079|gb|EGH91135.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 261

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 111/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q    
Sbjct: 13  STWVASFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQALDL 72

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 73  SG--LLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 131 QFFTMLVTLLFLSMNGHLVVLEVLVESFTTMPVGGGLLVNNFWE-LANGLGWALSSGLRL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +S+  I+ Q+      
Sbjct: 190 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMSMGDILNQYQPIASQ 249

Query: 246 GF 247
             
Sbjct: 250 AL 251


>gi|157145256|ref|YP_001452575.1| flagellar biosynthesis protein FliR [Citrobacter koseri ATCC
           BAA-895]
 gi|157082461|gb|ABV12139.1| hypothetical protein CKO_00993 [Citrobacter koseri ATCC BAA-895]
          Length = 264

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L      ++++ P L         V   
Sbjct: 12  WLNLYFWPLLRVLALISTAPILSERTVPKRVKLGLGFMITLIIAPSLPAN---NVPVFST 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  EALWLAMQQIMIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSRLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG +    N F +        F+  L L+ 
Sbjct: 129 LDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGGDPVNSNAFLALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+S+GLLN++ PQ+ ++ I  P  + +G L +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLSLGLLNRMAPQLSVFVIGFPLTLSVGILLITALMPLIAPFCEHLFGEIF 248


>gi|258514017|ref|YP_003190239.1| flagellar biosynthesis protein FliR [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777722|gb|ACV61616.1| flagellar biosynthetic protein FliR [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 255

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 106/239 (44%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +++  FL+  R+ + +M  P      IP  +++ F++  + ++ P +  T          
Sbjct: 6   LLVVFFLVFIRITAFMMTAPFFEYRNIPNLLKIGFSLLLAGIVFPVIK-TSGFSVPGGVL 64

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y   VM E  +G + GL+      G++  G +I   IG  +         +  T +   
Sbjct: 65  GYILAVMAEAGVGLMLGLIASFIFHGIRMAGQLIDLQIGFAMAMVFDPLSEMQTTIIARF 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ L+    ++ H+ +  +LVKSY  +P+        +  + V      F +  ++S+
Sbjct: 125 LNLLALIFFLNVNGHYYLIESLVKSYDLVPLTAMAIKSGVVLTVVKFFSGMFALAFQISA 184

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +   ++ ++S+G +++ VPQ+ ++ +  P  I +G L L + + ++       F   
Sbjct: 185 PIIAVLVIIDLSLGFVSRTVPQLNVFMLGFPVKIVVGILTLSVVVPVLGTLLQDVFKTM 243


>gi|28869178|ref|NP_791797.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967545|ref|ZP_03395693.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato T1]
 gi|301382882|ref|ZP_07231300.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061092|ref|ZP_07252633.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tomato K40]
 gi|302131292|ref|ZP_07257282.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28852418|gb|AAO55492.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927846|gb|EEB61393.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           tomato T1]
          Length = 258

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 110/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SG--LLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H      LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLSMNGHLVALEILVESFTTMPVGGGLLVNNFWE-LANGLGWALSAGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+      
Sbjct: 187 VLPAVTALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQPIATQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|167834872|ref|ZP_02461755.1| flagellar biosynthetic protein FliR [Burkholderia thailandensis
           MSMB43]
          Length = 260

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 105/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P       P++V++  A   ++V+ P L     +  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRATPVRVKIGLAGFMALVVTPTLPPMPVVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G  +++    ++  G +I  ++GL   T      S A   +  
Sbjct: 71  GVWI--IVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHASGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QVF ALV S+  +PI  +L     + + V      F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVFAALVDSFRLVPISADLLRAAGWQTLVAFGAAIFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ +  P  + +G L + L    +V      F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMAPNLVPFVGRLFDTG 248


>gi|70729045|ref|YP_258779.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens Pf-5]
 gi|68343344|gb|AAY90950.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens Pf-5]
          Length = 255

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 109/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + RV S +M++P    + +P +VRL FA+A ++V+ P L    ++     
Sbjct: 7   STWVASFMLPLFRVTSLLMVMPVFGTTLVPRRVRLYFALAITVVIAPGLPPMPEVHALDL 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV  ++ +G V G  ++++       G +++  +G+   + +  ++ ++   + 
Sbjct: 67  SG--LLLVAEQILIGAVLGFSLQLFFQAFVVAGQIVAIQMGMGFASMVDPTNGVSVAVIG 124

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  VF  L +S+ T+P+G  L   N +      L       L L
Sbjct: 125 QFFTMLVTLLFLAMNGHLVVFEVLTESFTTLPVGGGLMV-NHYWELAGKLGWVLGAALLL 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG   + +S+  I+ Q+      
Sbjct: 184 VLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIVWISLADILNQYQPLASE 243

Query: 246 GF 247
             
Sbjct: 244 AL 245


>gi|308068670|ref|YP_003870275.1| flagellar biosynthetic protein fliR [Paenibacillus polymyxa E681]
 gi|305857949|gb|ADM69737.1| Flagellar biosynthetic protein fliR [Paenibacillus polymyxa E681]
          Length = 261

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 97/243 (39%), Gaps = 7/243 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
                LI CR+ S  ++ P  S   +P   ++  +   ++V+         +   V    
Sbjct: 8   FPVFLLIFCRITSFFVVAPIFSTRGVPNIFKVGISGFLALVVYLTYGTHQQVPTDVA--- 64

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LV  E+ +G + G    ++   +Q  GS I   +G  + +        +     +  
Sbjct: 65  YVLLVGREVLIGLLLGFTAYLFMTAIQTAGSFIDLQVGFGMASVFDPMTGASTPLTGNFK 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN----FGNIFSSFVNMLQTTFMIMLR 184
             I +L    I+ HH +  A++ SY  +P+  +       G++    V     +FM+  +
Sbjct: 125 FAIAVLFFLSINGHHHLLNAILYSYDWVPLTNDFFVKLYGGSVTEFLVRSFAESFMLAFQ 184

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +++P +    + ++ +G L K  PQ  I+ I  P  I +G   L L +    + F   F 
Sbjct: 185 IAAPIVVATFLTDVGLGFLAKTAPQFNIFVIGVPLKIIVGLFMLLLLMPSFAFIFERLFS 244

Query: 245 YGF 247
             F
Sbjct: 245 VMF 247


>gi|254436544|ref|ZP_05050038.1| flagellar biosynthetic protein FliR [Octadecabacter antarcticus
           307]
 gi|198251990|gb|EDY76304.1| flagellar biosynthetic protein FliR [Octadecabacter antarcticus
           307]
          Length = 275

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 99/240 (41%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            M+  FL + R+ +  M  P    + IP+Q R+  ++  +  L   +   +   N +   
Sbjct: 25  FMLIFFLHILRLSAFFMAAPFFGAAAIPVQARIIISVLIAFSLYGLI--EVPDPNQLPFL 82

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
              ++V++E+ +G   GL   +    +   G  I+ + GL     +  +       ++  
Sbjct: 83  ALIEVVLIEIAIGVSLGLTFTILFASVAMAGEQIAISAGLGFAAQVDPNSGGQTPVVSQF 142

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +  + A   ++ H  V   +  S+  +P+G+  NF  + S  +      F+I  RL+ 
Sbjct: 143 LNLFAIAAFLSLNGHLHVIGVIRMSFEILPLGEPFNFSGLISGGLTAGGHMFVIASRLAL 202

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ NI++G++ +  PQ+ ++    P  I    + L  S        +    +  
Sbjct: 203 PIVSILLLANITVGVVTRSAPQLNLFSFGFPLTILTCFVALYFSTTPFAAGIADMIEFML 262


>gi|187925752|ref|YP_001897394.1| flagellar biosynthetic protein FliR [Burkholderia phytofirmans
           PsJN]
 gi|187716946|gb|ACD18170.1| flagellar biosynthetic protein FliR [Burkholderia phytofirmans
           PsJN]
          Length = 260

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 109/240 (45%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P L    +P++V++  A   +I++ P L     +  F   
Sbjct: 11  AWLTAFLWPFVRILALVATAPVLGNRSLPIRVKIGLAAFVTIIVAPTLGALPQVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G+ +++    +  TG  +   +GL   T      + +   L+S
Sbjct: 71  GVWI--IVNQFLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDAQAASSSQVLSS 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +L   VID H Q+  AL+ ++ ++P+   +     + +  N   T F   L LS
Sbjct: 129 YMNTIAMLVFLVIDGHLQMISALLATFQSVPVSANILGAPGWRTLANFGSTVFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+S+G+LN+  PQI ++ I  P  + +G L L L +  ++  F+  F  G
Sbjct: 189 LPVVAALLITNLSLGILNRAAPQIGVFQIGFPLTMLIGMLLLQLMVPNMIPFFTRLFEVG 248


>gi|161523218|ref|YP_001578230.1| flagellar biosynthetic protein FliR [Burkholderia multivorans ATCC
           17616]
 gi|189348925|ref|YP_001944553.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
 gi|221214542|ref|ZP_03587512.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD1]
 gi|160340647|gb|ABX13733.1| flagellar biosynthetic protein FliR [Burkholderia multivorans ATCC
           17616]
 gi|189332947|dbj|BAG42017.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
           17616]
 gi|221165432|gb|EED97908.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD1]
          Length = 260

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 106/241 (43%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P +V++  A   ++++ P L     +  F   
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHASVPARVKIGVAAFMALIVAPTLGPMPAVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWI--VVTQFLIGTAMGFTMQIVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QV  AL  S+ ++P+  +L     + +      T F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQVLAALTASFQSLPVSADLLHAPGWRTLATFGATVFGMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ +  P  + +G L + L +  +V   S  F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMVPNLVPFVSRLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|71735042|ref|YP_275526.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555595|gb|AAZ34806.1| flagellar biosynthetic protein FliR [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 258

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 111/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VRL  A A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPMFRIVALLMTMPVIGTTLVPRRVRLYLAFAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SG--LLLIGEQIIIGAGMGLSLQMFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSAVIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLFMNGHLVVLEVLVESFTTMPVGGGLLVNNFWE-LANGLGWALSSGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +S+  I+ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMSMGDILNQYQPIASQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|302185377|ref|ZP_07262050.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae 642]
          Length = 258

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 114/242 (47%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVVAGQIISTQMGMGFASMVDPTNGVSSATIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLAMNGHLVVLEILVESFTTMPVGSGLLVNNFWE-LANGLGWVLSSGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQPIATQ 246

Query: 246 GF 247
           G 
Sbjct: 247 GL 248


>gi|261407966|ref|YP_003244207.1| flagellar biosynthetic protein FliR [Paenibacillus sp. Y412MC10]
 gi|261284429|gb|ACX66400.1| flagellar biosynthetic protein FliR [Paenibacillus sp. Y412MC10]
          Length = 262

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/246 (19%), Positives = 110/246 (44%), Gaps = 7/246 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  +    LI CR+ S  ++ P  +   IP   ++  +   ++++         +   ++
Sbjct: 5   QQSLPVFMLIFCRITSFFVISPVFASRGIPSSYKIALSAIIALIVYLSFGLGEVVPQDLS 64

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              Y+ L++ E+ +G + G    +    +Q  G++I   IG ++   +      +   + 
Sbjct: 65  ---YAILIVQEVLVGLLLGFTAYLIMAVVQTAGALIDIQIGFSMANVIDPFTGTSTPLIG 121

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF----GNIFSSFVNMLQTTFMI 181
           +    + LL    ++ HH +F A++ SY  IPI  ++      GN+    V     +F++
Sbjct: 122 NFKYYLALLVFLSMNGHHYLFDAIMYSYDWIPITGDVFGKIHEGNVTDFLVRTFSHSFVL 181

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            +++++P +    + ++ +G L +  PQ  ++ I     I +G + L L + ++V  F H
Sbjct: 182 AIQMAAPLVAALFLTDVGLGFLARTAPQFNVFVIGIIIKIIVGLVLLMLLMPMLVSLFDH 241

Query: 242 SFLYGF 247
            F   F
Sbjct: 242 LFAKMF 247


>gi|83647844|ref|YP_436279.1| flagellar biosynthesis protein FliR [Hahella chejuensis KCTC 2396]
 gi|83635887|gb|ABC31854.1| Flagellar biosynthesis pathway, component FliR [Hahella chejuensis
           KCTC 2396]
          Length = 261

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 107/241 (44%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + R+ S +M  P L    +P +VRL  ++  +I+++P L    ++      
Sbjct: 11  AWVGMHLWPLFRISSFMMTTPILGTQIVPARVRLALSLLMTILIVPSLPPVPEVDPLSVN 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    +++ ++ +G   G  + +       TG +++  +GL   + +  ++ +  T L+ 
Sbjct: 71  S--VAIIIQQVLIGLAMGFAVLLLFQLFVVTGQIVAMNMGLGFASMVDPTNGITVTALSQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +  H  +F A+V+S+  +PI  +      +    + +   F   L ++
Sbjct: 129 FYLMLVTLLFLSMGGHLVMFEAVVESFRFLPISAQEVDVWSWWYLASRISWMFASALMIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ NIS G++ +  PQ+ I+ I  P  +  G +   +SI  I+ QF+      
Sbjct: 189 LPAVTALLIVNISFGVMTRAAPQMNIFSIGFPMTVLFGLVVFWISIGGILPQFTVLSENT 248

Query: 247 F 247
           F
Sbjct: 249 F 249


>gi|220934506|ref|YP_002513405.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995816|gb|ACL72418.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. HL-EbGR7]
          Length = 257

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 108/241 (44%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + SL     R+ + ++  P      + ++VRL  A   ++V+ P +     ++     
Sbjct: 10  AWIGSLLWPFLRISAMLLAAPLYGAGTVTVRVRLAIAFILALVVAPLIPLPPAVEPLSLA 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + ++ +G   G ++++    L   G  I+ ++GL   + +     +    ++S
Sbjct: 70  G--LVVSVQQILIGLTIGFVLQMVFAALTQAGEAIALSMGLGFASMVDPQSGVQVPVVSS 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L    ++ H  +    + S+  +P+G E        + V+   T F+  L ++
Sbjct: 128 YFVIMSTLLFLALNGHVALIELTLLSFQALPVGVEGVTREGLWALVSWGSTMFLYALLVA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+S+G++ +  PQ+ I+ +  P +I LG + L L+  +++ +F+     G
Sbjct: 188 LPAVASMLLVNLSMGVITRAAPQLNIFAVGFPMMIMLGFILLLLTTPVLLPKFTELLASG 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|121608109|ref|YP_995916.1| flagellar biosynthetic protein FliR [Verminephrobacter eiseniae
           EF01-2]
 gi|121552749|gb|ABM56898.1| flagellar biosynthetic protein FliR [Verminephrobacter eiseniae
           EF01-2]
          Length = 256

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 90/240 (37%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +   + P  S   +P++ ++  A   ++     L D   +      
Sbjct: 10  AWLSPVLWPFLRVLALFSVAPVFSARQLPLRAKIGLAFLVALCAQGVLTDQPVISVNGRE 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     V  ++ +G   G  +R+    ++  G +I   +GLN  +          + +  
Sbjct: 70  A--LGAVAQQVAVGLAIGFALRLVFTAVELAGEIIGLQMGLNFASFFDPVAHAQISAVTR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
               + LL   V + H  V  A+V S+   P+               +    F   L ++
Sbjct: 128 FFDNLVLLLFIVGNGHLLVLMAVVDSFDRFPVDGNFLQALGQMRLHTLGSAIFSSALWIA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 188 LPMIALLLFVNLTLGIISRVAPQMNIYAVGFPVTLTVGLLGITATLPMLESPVLALMQQA 247


>gi|188592194|ref|YP_001796792.1| flir: flagellar biosynthesis inner membrane protein. flir/mope/spar
           family. [Cupriavidus taiwanensis LMG 19424]
 gi|170938568|emb|CAP63555.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Cupriavidus taiwanensis LMG 19424]
          Length = 265

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/245 (18%), Positives = 99/245 (40%), Gaps = 6/245 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + I   P    S IP + ++  +   ++V+ P +     +  +   
Sbjct: 11  GWLAAFLWPFFRILALIGTAPLFGESTIPRRAKIALSALIAMVVSPTIAQVPVVPVYSFG 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ E+ +G   G ++R+    +Q  G +I   +GL+  +    +       L+ 
Sbjct: 71  G--LMIILNEVGIGLATGFVMRLVFATVQQAGEIIGLQMGLSFASFFDRAAGGQTMVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIP----IGQELNFGNIFSSFVNMLQTTFMIM 182
            + +I +L    +D H  +  ALV S+ ++P     G          +        F   
Sbjct: 129 FLNLIAVLLFLALDGHLLMLGALVDSFNSLPIGGNPGGTPLSAGGAMAVARAGGMVFASG 188

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           L L+ P +   ++ N+++G+LN+  PQ+ I+ +  P  +  G L L L +  +     H 
Sbjct: 189 LLLALPMIAALLILNLAMGILNRASPQLSIFAVGFPVTLSGGLLVLMLVMPQMGSYMQHM 248

Query: 243 FLYGF 247
              G 
Sbjct: 249 IEAGL 253


>gi|315648121|ref|ZP_07901222.1| flagellar biosynthetic protein FliR [Paenibacillus vortex V453]
 gi|315276767|gb|EFU40110.1| flagellar biosynthetic protein FliR [Paenibacillus vortex V453]
          Length = 262

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 108/246 (43%), Gaps = 7/246 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  +    LI CR+ S  ++ P  +   +P   ++  +   ++++         +   ++
Sbjct: 5   QQSLPVFMLIFCRITSFFVISPVFTSRSVPTSYKIALSAIIALIVYFSFGLGEVVPQDLS 64

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              Y  L++ E+ +G + G    +    +Q  G++I   IG ++   +      +   + 
Sbjct: 65  ---YVILIVQEVLVGLLLGFTAYLIMAVVQTAGALIDIQIGFSMANVIDPFTGASTPLIG 121

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF----GNIFSSFVNMLQTTFMI 181
           +    + LL    ++ HH +  A++ SY  IPI  ++      GN+    V     +F++
Sbjct: 122 NFKYYLALLVFLSMNGHHYLLDAIMYSYDWIPITGDVFGKIHDGNVTDFLVRTFSHSFVL 181

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L++++P +    + ++ +G L +  PQ  ++ I     I +G + L L + ++V  F H
Sbjct: 182 ALQMAAPLVAALFLTDVGLGFLARTAPQFNVFVIGIIIKIIVGLVLLMLLMPMLVSLFDH 241

Query: 242 SFLYGF 247
            F   F
Sbjct: 242 LFAKMF 247


>gi|302878287|ref|YP_003846851.1| flagellar biosynthetic protein FliR [Gallionella capsiferriformans
           ES-2]
 gi|302581076|gb|ADL55087.1| flagellar biosynthetic protein FliR [Gallionella capsiferriformans
           ES-2]
          Length = 260

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 107/242 (44%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +I + +L   + R+ + I   P L    +P +V++  ++  +IV+ P L    D+   + 
Sbjct: 10  DIWLSTLLYPMVRLLAMISSAPILGNKQVPARVKIGLSVLMAIVIAPTLAPMPDIP--LG 67

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +++ ++ +G   G  +R+    ++  G      +GL   +      + + T   
Sbjct: 68  SPQSLLIMVQQIIIGVSMGFTMRIVFTAVEMAGEFSGLQMGLGFASFYNPQSASSSTVTA 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             +GII  LA   ++ H  +   + +S+ T+P+GQ +   + +++      T F   L+L
Sbjct: 128 QFMGIIATLAFLSMNGHLMLLALVTESFHTLPVGQMMATKSFYTA-AQWGATIFAYGLQL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P L   ++ N+++G++ +   Q+  + I  P  + +G   L LS+  +          
Sbjct: 187 SMPLLAALLITNLALGIMTRAAQQLNPFAIGFPITLTVGFFVLSLSLPYLAPMLDRMTTE 246

Query: 246 GF 247
           G 
Sbjct: 247 GL 248


>gi|330899443|gb|EGH30862.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 258

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 113/242 (46%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNNFWE-LANGLGWALASGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  ++ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDMLNQYQPIATQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|66046671|ref|YP_236512.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257378|gb|AAY38474.1| Flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           syringae B728a]
          Length = 261

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 113/242 (46%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q    
Sbjct: 13  STWVASFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDL 72

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 73  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 131 QFFTMLVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNNFWE-LANGLGWVLASGLRL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  ++ Q+      
Sbjct: 190 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDMLNQYQPIATQ 249

Query: 246 GF 247
             
Sbjct: 250 AL 251


>gi|330953764|gb|EGH54024.1| flagellar biosynthesis protein FliR [Pseudomonas syringae Cit 7]
 gi|330972451|gb|EGH72517.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 258

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 113/242 (46%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVVAGQIISTQMGMGFASMVDPTNGVSSATIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLAMNGHLVVLEILVESFTTMPVGSGLLVNNFWE-LANGLGWVLASGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG + L +++  I+ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDILNQYQPIATQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|221639479|ref|YP_002525741.1| Flagellar biosynthetic protein FliR [Rhodobacter sphaeroides KD131]
 gi|221160260|gb|ACM01240.1| Flagellar biosynthetic protein FliR [Rhodobacter sphaeroides KD131]
          Length = 269

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 95/235 (40%), Gaps = 2/235 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
           F+   R+G+ ++  P     ++P+ VR+   +  ++ +L  +   +     +       L
Sbjct: 23  FVASLRIGAFLIASPAFGGRFVPLPVRIVATVILTLPVLGRV--ELPPPEALASLAAIPL 80

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           +M E+ +G   GL++ +        G  I++  GL     +  S       +  + G+  
Sbjct: 81  MMQEIAVGLSAGLVLTILFSAAALAGDRIASTAGLGFAAQIDPSAGGQTPVVAQIFGLAL 140

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
                 +D H      L++SY ++P G     G    + +      F++ L++  P +  
Sbjct: 141 TTVFLALDGHLTALDILLRSYESLPPGAPFAPGRFLEAGIGAGGRMFLLGLQIMMPVVAA 200

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            I+ N++IG++ +  PQ+ ++    P  +    + L L+    +  FS       
Sbjct: 201 LILINVTIGIVTRSAPQLNVFSFGFPVTMSATLILLFLTAPGTMGAFSGLVEESL 255


>gi|227328346|ref|ZP_03832370.1| flagellar biosynthesis protein FliR [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 261

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 99/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P  +   I  +V++      ++++ P+L         V   
Sbjct: 12  WVSQFFWPFVRILALISTAPVFNERAIGNRVKIGLGALITLLVAPYLPLNTTPIFSVAG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   
Sbjct: 71  --VWLLIQQILIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVVARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI       + F +        F+  L L+ 
Sbjct: 129 LNILAILLFLTFDGHLWMISLLADSFYTLPISTNPINSHAFLALARAGGLIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ ++ +  P  + +G + L L + ++     H F   F
Sbjct: 189 PIITLLLTINLALGMLNRVAPQLSVFVVGFPITLTVGIMTLGLLLPLVPPFAEHLFSEVF 248


>gi|172059102|ref|YP_001806754.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MC40-6]
 gi|171991619|gb|ACB62538.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MC40-6]
          Length = 260

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 110/241 (45%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F   
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAP 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++    ++  G  I  ++GL   T      + A   +  
Sbjct: 71  GIWI--VVTQFLIGVALGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +LA   +D H QVF AL  S+ T+P+  +L     + +      T F + L L+
Sbjct: 129 FLNAIAMLAFLAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|87119471|ref|ZP_01075368.1| flagellar biosynthesis protein [Marinomonas sp. MED121]
 gi|86164947|gb|EAQ66215.1| flagellar biosynthesis protein [Marinomonas sp. MED121]
          Length = 260

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 100/239 (41%), Gaps = 4/239 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            + +S  L   R+G+ ++ LP      +  ++R+ FA   +I++ P +            
Sbjct: 11  GLTVSFLLPFFRIGAFLLALPLFGTQLVSTRIRIAFAFVIAIIVTPSVPVPSYDPV---S 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            Y+  L+  ++ +G V G ++ V        G + +   GL    S   ++ ++   L  
Sbjct: 68  PYFVLLIAEQIIIGIVLGFVVSVLFQVFSLAGQLAAMKAGLGFAMSNDPANGISVATLGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
               +  LA  + D HH +F  LV+S+   PIG+  N    +   V +    F   L + 
Sbjct: 128 YYLTMVGLAFLLTDGHHVMFEYLVESFDYWPIGEGFNS-EYYYDIVLLGGWMFEKALLMV 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P     +V N+S G++ K  PQ+ I+ +  P ++     F  + +E  +  +   F  
Sbjct: 187 LPLAIAVLVMNLSFGVVAKASPQLNIFALGFPVIMLFSLFFFWIMLEDFLDIYRLFFTE 245


>gi|330826719|ref|YP_004390022.1| flagellar biosynthetic protein FliR [Alicycliphilus denitrificans
           K601]
 gi|329312091|gb|AEB86506.1| flagellar biosynthetic protein FliR [Alicycliphilus denitrificans
           K601]
          Length = 254

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 99/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +     P  SM  IP++VR+  A   ++     L     +      
Sbjct: 11  AWLSPVLWPFLRVLALFTSAPVFSMRAIPVRVRIGLAFLVALCAQAALPGQPVIDLGGRE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A  +  V+ ++ +G   G  +R+  + ++  G VI   +GLN  +    + +   + +  
Sbjct: 71  A--AGAVLQQVGVGLAIGFAVRLVFVAVELAGEVIGLQMGLNFASFFDPASNAQVSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G I +L   V++ H  V  A+VKS+ + P+               +    F   L ++
Sbjct: 129 FFGNIAMLLFVVVNGHLMVLMAVVKSFESFPVDGHFLQAVAQMRLHELGAAVFASGLWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 189 LPMIALLLFVNLTLGVISRVAPQMNIYAVGFPVTLTVGMLGITATLPMLEQPMLTLLQQA 248


>gi|261821161|ref|YP_003259267.1| flagellar biosynthesis protein FliR [Pectobacterium wasabiae
           WPP163]
 gi|261605174|gb|ACX87660.1| flagellar biosynthetic protein FliR [Pectobacterium wasabiae
           WPP163]
          Length = 261

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 100/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P  +   I  +V++   +  ++++ P+L         V   
Sbjct: 12  WVSQFFWPFVRILALISTAPVFNERAIGNRVKIGLGVLITLLVAPYLPLNTTPIFSVAG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   
Sbjct: 71  --VWLLIQQILIGITLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMPVIARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI       + F +        F+  L L+ 
Sbjct: 129 LNILAILLFLTFDGHLWLISLLADSFHTLPISTSPINSHAFLALARAGGLIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ I+ +  P  + +G + L L + +I     H F   F
Sbjct: 189 PIITLLLTINLALGMLNRMAPQLSIFVVGFPITLTVGIMTLGLLLPLIPPFAEHLFSEVF 248


>gi|330502778|ref|YP_004379647.1| flagellar biosynthesis protein FliR [Pseudomonas mendocina NK-01]
 gi|328917064|gb|AEB57895.1| flagellar biosynthesis protein FliR [Pseudomonas mendocina NK-01]
          Length = 258

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 109/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              +    L + R+ + +M++P +    +P +VRL  A+A S+VL+P L     +     
Sbjct: 10  SGWVGQFLLPLFRIAAMLMVMPIIGTQLVPTRVRLYLALAISVVLVPTLPPMPQVDALSL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           R+    +++ ++ +G + G +++++       G +I+  +GL   + +  ++ ++   L 
Sbjct: 70  RS--LLMILEQVLIGAMFGFILQLFFHLFAVAGQIIAMQMGLGFASMVDPTNGVSVPVLG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    I+ H  V   L +S+ ++P GQ +   N + +    L       L L
Sbjct: 128 QFMLMLVTLLFLAINGHLVVLEILAESFISLPPGQGMMV-NHYWTLAGKLSWVIGAGLLL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +V N++ G++ +  PQ+ I+ I  P  + +G +   + +      F      
Sbjct: 187 TLPMVTALLVINLAFGVMTRAAPQLNIFSIGFPLTLAMGLVIFWVGLSDFGSLFQALASE 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|258404719|ref|YP_003197461.1| flagellar biosynthetic protein FliR [Desulfohalobium retbaense DSM
           5692]
 gi|257796946|gb|ACV67883.1| flagellar biosynthetic protein FliR [Desulfohalobium retbaense DSM
           5692]
          Length = 260

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/233 (24%), Positives = 105/233 (45%), Gaps = 1/233 (0%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           S  L   RV + I  +P LS    P ++R   A+  ++++ P +  TI   NF       
Sbjct: 13  SFLLCFIRVAAIIGSMPVLSGGQTPARLRAGLALVLAVIIFPAVDGTIPDINF-APLRLF 71

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L   E+ LG + G + R+  L  QF G+++   +G      +          ++    +
Sbjct: 72  VLGSQEVLLGLMLGFIGRLLFLAAQFGGTILGFQMGFAAANILDPQSQQQIQLMSQFQNV 131

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +  L    +D HH    +L +S+  +P G  L+  +   S V M    F++ L+L++P  
Sbjct: 132 LASLVFLAVDGHHVFLRSLARSFEVVPPGGGLHLQDAVPSMVAMTGEMFVLGLQLTAPIY 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              I+ +  +G+++++ PQ+  + +  P  IG+   FL LS E IV      F
Sbjct: 192 VILILSDFILGIMSRIFPQLNAFMLKFPINIGVAFFFLGLSAEFIVSILISEF 244


>gi|237799250|ref|ZP_04587711.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022105|gb|EGI02162.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 258

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/235 (21%), Positives = 112/235 (47%), Gaps = 3/235 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + +  L + R+ + +  +P +  + +P +VR+  A A ++V+ P L D   +Q    
Sbjct: 10  STWVAAFMLPLFRIIALLTTMPVIGTTLVPRRVRMYLAFAITVVVAPALPDMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ ++P+G  L   N +    N L       LRL
Sbjct: 128 QFFTLLVTLLFLSMNGHLVVLEILVESFTSMPVGSGLLVNNFWE-LANGLGWVLGSGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + +G + L +++  I+ Q+ 
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVMGMVILWMTMGDILNQYQ 241


>gi|330976010|gb|EGH76076.1| flagellar biosynthesis protein FliR [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 258

 Score =  119 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 114/242 (47%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P +  + +P +VR+  A+A ++V+ P L     +Q    
Sbjct: 10  STWVASFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPALPAMPPVQALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G   GL ++++       G +IST +G+   + +  ++ ++   + 
Sbjct: 70  SA--LLLIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDPTNGVSSATIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  V   LV+S+ T+P+G  L   N +    N L       LRL
Sbjct: 128 QFFTMLVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNNFWE-LANGLGWALASGLRL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   ++ NI+ G++ +  PQ+ I+ I  P  + LG++ L +++  ++ Q+      
Sbjct: 187 VLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGTVILWMTMGDMLNQYQPIATQ 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|329929261|ref|ZP_08283014.1| flagellar biosynthetic protein FliR [Paenibacillus sp. HGF5]
 gi|328936630|gb|EGG33073.1| flagellar biosynthetic protein FliR [Paenibacillus sp. HGF5]
          Length = 264

 Score =  119 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/246 (19%), Positives = 109/246 (44%), Gaps = 7/246 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  +    LI CR+ S  ++ P  +   IP   ++  +   ++++         +   ++
Sbjct: 7   QQSLPVFMLIFCRITSFFVISPVFASRGIPSSYKIALSAIIALIVYLSFGLGEVVPQDLS 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              Y  L++ E+ +G + G    +    +Q  G++I   IG ++   +      +   + 
Sbjct: 67  ---YVILIVQEVLVGLLLGFTAYLIMAVVQTAGALIDIQIGFSMANVIDPFTGTSTPLIG 123

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF----GNIFSSFVNMLQTTFMI 181
           +    + LL    ++ HH +F A++ SY  IPI  ++      GN+    V     +F++
Sbjct: 124 NFKYYLALLVFLSMNGHHYLFDAIMYSYDWIPITGDVFGKIHEGNVTDFLVRTFSHSFVL 183

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            +++++P +    + ++ +G L +  PQ  ++ I     I +G + L L + ++V  F H
Sbjct: 184 AIQMAAPLVAALFLTDVGLGFLARTAPQFNVFVIGIIIKIIVGLVLLMLLMPMLVSLFDH 243

Query: 242 SFLYGF 247
            F   F
Sbjct: 244 LFAKMF 249


>gi|119899018|ref|YP_934231.1| flagellar biosynthesis protein FliR [Azoarcus sp. BH72]
 gi|119671431|emb|CAL95344.1| flagellar biosynthesis protein FliR [Azoarcus sp. BH72]
          Length = 270

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 100/242 (41%), Gaps = 2/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  + +L   + R+       P  S   IP+++R    MA  I L          Q    
Sbjct: 10  DAWLAALMFPLARLLGLFATAPVFSNRAIPVRIR--LTMALGIALALLPALPAMPQTPPG 67

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +++ ++F+G   G +IR+    +   GS+I   +GL+               L+
Sbjct: 68  GGIGLLVMVQQMFIGIAIGFMIRIVFAAIDMAGSLIGMQMGLSFAVFFDPDAGGQTAVLS 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    I+ H  +  AL++S+  +PIG  +   + ++         F   L L
Sbjct: 128 DFLSLVATLLFLSINGHLMLVAALIRSFEWLPIGLNVVSASGWAYIARAGAAVFATGLLL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +   +V NI++G+L +  PQ+ ++ I  P  + +G + L L +          F +
Sbjct: 188 SLPIVAVLLVANIALGILTRAAPQLNLFAIGFPVTLAMGFMGLILIMTNFGPVVVSLFEH 247

Query: 246 GF 247
           GF
Sbjct: 248 GF 249


>gi|126665003|ref|ZP_01735986.1| flagellar biosynthesis protein R [Marinobacter sp. ELB17]
 gi|126630373|gb|EBA00988.1| flagellar biosynthesis protein R [Marinobacter sp. ELB17]
          Length = 259

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + R+ S +M++P      +P +VRL  A+  +I+++P +     +      
Sbjct: 13  QWVGQHLWPLFRIASFLMVIPVFGTQLVPARVRLGLALLMTIIVVPMIPPVPQIDALSAD 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    + + ++ +G   G  +          G +I+  +GL   + +  ++ +    L  
Sbjct: 73  A--VVITLQQILIGVGLGFALTALWQLFVIAGQMIAMQMGLGFASMVDPANGVNVAVLAQ 130

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  I   L    ++ H   F   ++S+ T+PIG E           + +   F+  + ++
Sbjct: 131 IYTITITLLFLAMNGHLVAFEVFIESFRTLPIGLEGLGQAGMWQLAHRISWMFVSAMLMA 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ +IS G++ +  PQ+ I+ +  P  +  G   + +     +  F       
Sbjct: 191 LPAVTAVLIVSISFGVMTRAAPQMNIFALGFPIGLIFGLFAIWVLHANFLPHFEVYARQT 250

Query: 247 F 247
           F
Sbjct: 251 F 251


>gi|221201781|ref|ZP_03574818.1| flagellar biosynthetic protein FliR [Burkholderia multivorans
           CGD2M]
 gi|221207714|ref|ZP_03580722.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD2]
 gi|221172560|gb|EEE04999.1| flagellar biosynthetic protein FliR [Burkholderia multivorans CGD2]
 gi|221178201|gb|EEE10611.1| flagellar biosynthetic protein FliR [Burkholderia multivorans
           CGD2M]
          Length = 260

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 107/241 (44%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P +V++  A   ++++ P L     +  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHASVPARVKIGVAAFMALIVAPTLGPMPAVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWI--VVTQFLIGTAMGFTMQIVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QV  AL  S+ ++P+  +L     + +      T F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQVVAALTASFQSLPVSADLLHAPGWRTLAAFGATVFGMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ +  P  + +G L + L +  +V   S  F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMVPNLVPFVSRLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|227112529|ref|ZP_03826185.1| flagellar biosynthesis protein FliR [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 261

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 99/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P  +   I  +V++      ++++ P+L         V   
Sbjct: 12  WVSQFFWPFVRILALISTAPVFNERAIGNRVKIGLGALITLLVAPYLPLNTTPIFSVAG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   
Sbjct: 71  --VWLLIQQILIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVVARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI       + F +        F+  L L+ 
Sbjct: 129 LNILAILLFLTFDGHLWMISLLADSFYTLPISANPINSHAFLALARAGGLIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ ++ +  P  + +G + L L + ++     H F   F
Sbjct: 189 PIITLLLTINLALGMLNRVAPQLSVFVVGFPITLTVGIMTLGLLLPLVPPFAEHLFSEVF 248


>gi|170694402|ref|ZP_02885556.1| flagellar biosynthetic protein FliR [Burkholderia graminis C4D1M]
 gi|170140825|gb|EDT08999.1| flagellar biosynthetic protein FliR [Burkholderia graminis C4D1M]
          Length = 260

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 108/240 (45%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P L    +P++V++  A   +I++ P L     +  F   
Sbjct: 11  AWLTAFLWPFVRILALVATAPVLGNRSLPLRVKIGLAAFVTIIVAPTLGALPQVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G+ +++    +  TG  +   +GL   T      S +   L++
Sbjct: 71  GVWI--IVNQFLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDAQASSSSQVLST 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +L   VID H Q+  AL+ ++ T+P+   +     + +  N   T F   L LS
Sbjct: 129 YMYTIAMLVFLVIDGHLQMISALLATFNTLPVSANILGSPGWRTLANFGSTIFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L L L    ++  F+  F  G
Sbjct: 189 LPVVAALLITNLALGILNRAAPQIGVFQIGFPLTMLIGMLLLQLMTPNMIPFFARLFTVG 248


>gi|188586037|ref|YP_001917582.1| flagellar biosynthetic protein FliR [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350724|gb|ACB84994.1| flagellar biosynthetic protein FliR [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 257

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/236 (22%), Positives = 107/236 (45%), Gaps = 2/236 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +   L++ R+   IM  P    +Y+P Q+++ F++  ++V LP L         +     
Sbjct: 12  VLFILLLTRISGMIMTAPIFGSNYMPNQIKIAFSLILTLVFLPVLSPEGLSDYHI--MNV 69

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
                +EL +G   G++  +    +Q  G +I   +G  +   M          +     
Sbjct: 70  ILFAFMELMVGIAIGMIANLVFSSIQIAGQLIDVQMGFAMARVMDPQYETQVPLIGQFKY 129

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           I+ ++   VI+ HH +  ++ +SY  +PIG   + G    +   +  T F++ +++S+P 
Sbjct: 130 ILAIMIFLVINGHHLLIRSVYESYQLLPIGNIFDLGAGGVALNELFSTVFVLAIQVSAPA 189

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           L    + NI++G+L + VPQ+ ++ I  P  I +G L L L +        + F +
Sbjct: 190 LGTLFLTNIALGVLARTVPQMNVFIIGFPVKIFVGFLSLVLLMPTYTLVLGNLFQH 245


>gi|104782806|ref|YP_609304.1| flagellar biosynthesis protein FliR [Pseudomonas entomophila L48]
 gi|95111793|emb|CAK16517.1| flagellar biosynthetic protein FliR [Pseudomonas entomophila L48]
          Length = 258

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 104/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P +VRL  A+A ++V++P L    ++     R
Sbjct: 11  TWVATFILPLFRVTALLMTMPIFGTKMLPARVRLYAAVAITVVIVPGLPPLPEIDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + G  +++        G +++  +G+   + +  ++ +    ++ 
Sbjct: 71  G--VLLCGEQIIVGALFGFSLQLLFQAFVVAGQIVAVQMGMAFASMVDPANGVNVAVVSQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   V++ H   F  L +S+ T+P+G  L   N F      L       L L 
Sbjct: 129 FMTMLVSVLFLVMNGHLVAFEILTESFTTLPVGNALVV-NHFWEMAGRLSWVLGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++ G++ +  PQ+ I+ I  P  + LG     + +  I+  +       
Sbjct: 188 LPAIAALLVVNVAFGVMTRAAPQLNIFSIGFPLTLVLGLGIFWVGLADILSHYQALASEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|221309515|ref|ZP_03591362.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313839|ref|ZP_03595644.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318762|ref|ZP_03600056.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323034|ref|ZP_03604328.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767371|ref|NP_389519.2| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321315404|ref|YP_004207691.1| flagellar biosynthesis protein FliR [Bacillus subtilis BSn5]
 gi|239938629|sp|P35537|FLIR_BACSU RecName: Full=Flagellar biosynthetic protein fliR
 gi|225184998|emb|CAB13510.2| component of the flagellar export machinery [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320021678|gb|ADV96664.1| flagellar biosynthesis protein FliR [Bacillus subtilis BSn5]
          Length = 259

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 95/239 (39%), Gaps = 6/239 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+ +  + +P      +P   R+ FA   +++    +     L+      
Sbjct: 7   LFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTIDKPPSLEI---DE 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +Y  L   E  +G   GL+  +    +Q  GS I   +G ++   +          +   
Sbjct: 64  HYMLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVIDPQTGAQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN---IFSSFVNMLQTTFMIMLR 184
           I  + LL +  ++ HH +   +  S+  I + Q                     F+I  +
Sbjct: 124 IYTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + +I     + F
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVRNVF 242


>gi|283785720|ref|YP_003365585.1| flagellar biosynthesis protein FliR [Citrobacter rodentium ICC168]
 gi|282949174|emb|CBG88782.1| flagellar biosynthesis protein FliR [Citrobacter rodentium ICC168]
          Length = 264

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/241 (23%), Positives = 104/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         V  
Sbjct: 11  QWLSLYFWPLLRVLALISTAPILSERVIPKRVKLGLGIIITVVIAPALPPH---NVPVFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L M ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  
Sbjct: 68  FNALWLAMQQILIGIALGFTMQFTFAAVRTAGEIIGLQMGLSFATFVDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +I ++ +L     + H  +   LV ++ T+PIG +    N F +  +     F+  L L+
Sbjct: 128 IIDMLAMLLFLTFNGHLWLISLLVYTFHTLPIGGDPVNSNAFLALASAGSLIFLNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   
Sbjct: 188 LPVITMLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGMTLIAALMPLIAPFCEHLFSEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|253702492|ref|YP_003023681.1| flagellar biosynthetic protein FliR [Geobacter sp. M21]
 gi|251777342|gb|ACT19923.1| flagellar biosynthetic protein FliR [Geobacter sp. M21]
          Length = 261

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/243 (18%), Positives = 107/243 (44%), Gaps = 1/243 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           + ++    ++ L L++ RV      +P      +P +V++    A ++++ P +     +
Sbjct: 5   LPLTSLADLIPLALVLARVAGLFSAIPMFGARLVPARVKMGLIFAMTLLIFPVIKPH-AV 63

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
            N  +      LV+ E  +G   G + +     ++F G ++ T +G+++      +    
Sbjct: 64  PNVSDSLGLMLLVLQEALVGLTLGAVSQFIFAAVEFCGQLVGTQMGISMAAQFDPATQNN 123

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              +    G +  L     + H      +V SY  IP+G     G +   F+      F+
Sbjct: 124 VPTMAIFQGALATLLFLAFNVHEHFIRGIVDSYRVIPLGAWHVSGGLMKFFIETSTGIFI 183

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I ++L++P     +  ++++G++ +  P + ++ +S P  IG+G + L +S+ + V    
Sbjct: 184 IGIKLAAPVSVALLATSVALGIVARSFPAMNVFMVSMPLSIGIGFVILGISLPVFVRVLQ 243

Query: 241 HSF 243
            SF
Sbjct: 244 GSF 246


>gi|78064696|ref|YP_367465.1| flagellar biosynthesis protein FliR [Burkholderia sp. 383]
 gi|77965441|gb|ABB06821.1| Flagellar biosynthesis protein FliR [Burkholderia sp. 383]
          Length = 260

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 110/241 (45%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHAAVPVRVKIGLAAFMALVVAPTLGAMPDVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   +  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWILV--TQFLIGAAMGFTMQIVFAAVEAAGDFIGLSMGLGFATFFDPHTSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QVF AL  S+ ++P+  +L     + +      T F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQVFAALTASFQSLPVSADLLHAPGWRTLAGFGTTVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L + L I  +V   +H F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGVFQIGFPVTMLVGLLLVQLMIPNLVPFVAHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|325525520|gb|EGD03319.1| flagellar biosynthetic protein FliR [Burkholderia sp. TJI49]
          Length = 260

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 106/241 (43%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +    +P++V++  A   ++++ P L     +  F   
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHPSVPVRVKIGVAAFMALIVAPTLGAMPPVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWI--VVTQFLIGAAMGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QVF AL  S+ ++P+   L     + +      T F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQVFAALAASFQSLPVSAALLHAPGWRTLAAFGATVFGMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L + L +  +V   S  F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGVFQIGFPVTMLVGLLLVQLMVPNLVPFVSRLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|170698075|ref|ZP_02889156.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria
           IOP40-10]
 gi|170137036|gb|EDT05283.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria
           IOP40-10]
          Length = 260

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 111/241 (46%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++    ++  G  I  ++GL   T      + A   +  
Sbjct: 71  GIWI--VVTQFLIGVALGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +LA   +D H QVF AL  S+ T+P+  +L     + +      T F + L L+
Sbjct: 129 FLNAIAMLAFLAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|308048764|ref|YP_003912330.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
 gi|307630954|gb|ADN75256.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
          Length = 261

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 97/239 (40%), Gaps = 3/239 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + S+   + R+ + IM++  +  S +P +VRL  ++  +  + P L     ++      
Sbjct: 11  WLRSVLWPLFRISAMIMVMVTIGGSSVPARVRLLLSVMITAAVAPILPAPPPVELLSAEG 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +       ++ +G   G +  +        G +I     L   + +  S+      +   
Sbjct: 71  FLIS--AQQVVIGIAIGFVSVLVLNTFVLAGQIIGMQTSLGFASMVDPSNGQQVPLVGQF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L  + +D H  +   LV S+ T+PIG+ L   +   + V      F   L LS 
Sbjct: 129 YLLLSTLLFFGVDGHLLMIRMLVASFETLPIGEGL-SPSGLDAIVKFGGLMFASALTLSL 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
                 ++ N S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F   +  G
Sbjct: 188 SAATALLLINFSFGVMTRAAPQLNIFAIGFPITMLSGLLILWLTLGGVLSHFYSVWDAG 246


>gi|50120647|ref|YP_049814.1| flagellar biosynthesis protein FliR [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611173|emb|CAG74619.1| flagellar biosynthetic protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 261

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 100/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P  +   I  ++++   +  ++++ P+L         V   
Sbjct: 12  WVSQFFWPFVRILALISTAPVFNERAIGNRIKIGLGVLITLLVAPYLPLNTTPIFSVAG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   
Sbjct: 71  --VWLLIQQILIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVIARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI       + F +        F+  L L+ 
Sbjct: 129 LNILAILLFLTFDGHLWLISLLADSFYTLPISTNPINSHAFLALARAGGLIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ I+ +  P  + +G + L L + +I     H F   F
Sbjct: 189 PIITLLLTINLALGMLNRMAPQLSIFVVGFPITLTVGIMTLGLLLPLIPPFAEHLFSEVF 248


>gi|289208349|ref|YP_003460415.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. K90mix]
 gi|288943980|gb|ADC71679.1| flagellar biosynthetic protein FliR [Thioalkalivibrio sp. K90mix]
          Length = 253

 Score =  119 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 106/241 (43%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + ++     R+G+ ++++P      +   VR+ FA+  +I +         +      
Sbjct: 6   VWVGAVMWPFARIGAMLLVMPVFGGDQLTATVRILFALVLAIFVAMQGPALPAVDPISIE 65

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + ++ +G V G ++++    L   G VI+ ++GL   + +  +  +    +++
Sbjct: 66  G--VVVTVHQILIGLVMGFILQMVFSALTQAGEVIALSMGLGFASIVDPAQGVQVPVVST 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  I+  L    ++ H      L+ S+ T+P+          +S +      F   + ++
Sbjct: 124 IFVIMATLIFLAMNGHLIALELLLTSFETLPVAPSGLDAEALASLIAFGSVMFQGAVLVA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+S+G++ +  PQ+ I+ +  P +I +G + L L++  +  +       G
Sbjct: 184 IPAVASLLLVNLSMGVITRASPQLNIFAVGFPMMILMGFILLMLTMPGLPERLGDLLFDG 243

Query: 247 F 247
           F
Sbjct: 244 F 244


>gi|171316885|ref|ZP_02906094.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MEX-5]
 gi|171097966|gb|EDT42784.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria MEX-5]
          Length = 260

 Score =  119 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 112/241 (46%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   GL +++    ++  G  I  ++GL   T      + A   +  
Sbjct: 71  GIWI--VVTQFLIGVALGLTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +LA   +D H QVF AL  S+ T+P+  +L     + +      T F + L L+
Sbjct: 129 FLNAIAMLAFLAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|239997096|ref|ZP_04717620.1| flagellar biosynthesis protein FliR [Alteromonas macleodii ATCC
           27126]
          Length = 259

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  + L   R+    + + GLS   IP QVR    +  +++++P +  +      +  
Sbjct: 10  QFLADMLLPFMRISGLFVAMIGLSAKSIPPQVRALLGIMLTLIIMPVVPPSP--IENLVD 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ +L +G   G +  +        G VI+   GL   + +   + +    +  
Sbjct: 68  VGTFLIVVQQLLIGIAIGFISMMVLNTFVLAGQVIAMQTGLGFASIVDPVNGINVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  W +D H  +   +V S+   PIG+    G  F    +     F+  + LS
Sbjct: 128 FYLILATLLFWTLDGHLSMIQMIVMSFEAFPIGEAWWTGEQFRDIAHWAGWMFISAVTLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N++ G++ K  PQ+ I+ I       +G L + ++++     F   +   
Sbjct: 188 LAPIVSLLIVNLAFGVMTKAAPQLNIFSIGFSIAQVMGLLIIWITLDNFTAHFETQWFRA 247


>gi|332140594|ref|YP_004426332.1| flagellar biosynthesis protein FliR [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550616|gb|AEA97334.1| flagellar biosynthesis protein FliR [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 259

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 95/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  + L   R+    + + GLS   IP QVR    +  ++V++P +  +         
Sbjct: 10  QFLADMLLPFMRISGLFVAMIGLSAKSIPPQVRALLGIMLTLVIMPVVPPSPIENLVSVG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +    V+ +L +G   G +  +        G +I+   GL   + +   + +    +  
Sbjct: 70  TFLI--VIQQLLIGIAIGFISMMVLNTFVLAGQIIAMQTGLGFASIVDPVNGINVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  W +D H  +   +V S+   PIG+    G  F    +     F+  + LS
Sbjct: 128 FYLILATLLFWTLDGHLSMIQMIVMSFEAFPIGEAWWTGEQFRDIAHWGGWMFVSAITLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N++ G++ K  PQ+ I+ I       +G L + ++++     F   +   
Sbjct: 188 LAPIVSLLIVNLAFGVMTKAAPQLNIFSIGFSIAQLMGLLIIWITLDNFTAHFETQWFRA 247


>gi|156933430|ref|YP_001437346.1| flagellar biosynthesis protein FliR [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531684|gb|ABU76510.1| hypothetical protein ESA_01248 [Cronobacter sakazakii ATCC BAA-894]
          Length = 262

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 103/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   I ++V++  A+  +I L P +  +      +  
Sbjct: 11  HWLTLYFWPLLRVLALISTAPILSERSISIRVKIGLALLITIALAPNIPGS---NVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L + ++ +G   G  ++     ++  G +I   +GL+  T       L    L  
Sbjct: 68  LEGLWLGLQQILIGVAIGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I ++ +L    ++ H  +   L  ++ T+PIG E    N F +        F+  + L+
Sbjct: 128 FIDMLAMLLFLTVNGHLWLISILADTFHTLPIGGEAINSNAFMALTRAGGLIFINGVMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G + L   + +I     H F   
Sbjct: 188 LPMITLLLSLNLALGLLNRMAPQLTVFAIGFPLTLSIGIIVLAALMPLIAPFCEHLFAEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|222112238|ref|YP_002554502.1| flagellar biosynthetic protein flir [Acidovorax ebreus TPSY]
 gi|221731682|gb|ACM34502.1| flagellar biosynthetic protein FliR [Acidovorax ebreus TPSY]
          Length = 247

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 100/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +     P  SM  IP++ R+  A   ++     L +   +      
Sbjct: 2   AWLSPVLWPFLRVLALFTSAPVFSMRVIPVRTRIGLAFLVAVCAQAVLPEQPVISLNSRE 61

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A  +  V+ ++ +G   G  +R+    ++  G +I   +GLN  +    + +   + +  
Sbjct: 62  A--AGAVVQQVGIGLAMGFAVRLVFAAVELAGEIIGLQMGLNFASFFDPASNAQVSAVAR 119

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G I +L   VI+ H  V  A+VKS+ + P+G              +  + F   L ++
Sbjct: 120 FFGNISMLLFVVINGHLMVLMAVVKSFDSFPVGGNFLQAIGQMRLHELGASLFSSALWIA 179

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 180 LPMIALLLFVNLTLGIISRVAPQMNIYAVGFPVTLTVGMLGITATLPMLEQPMLALLQQS 239


>gi|115350083|ref|YP_771922.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria AMMD]
 gi|115280071|gb|ABI85588.1| flagellar biosynthetic protein FliR [Burkholderia ambifaria AMMD]
          Length = 260

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 110/241 (45%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F   
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHAAVPVRVKIGIAAFMALVVAPTLGAMPDVTVFSAP 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++    ++  G  I  ++GL   T      + A   +  
Sbjct: 71  GIWI--VVTQFLIGIALGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +LA   +D H QVF AL  S+ T+P+  +L     + +      T F + L L+
Sbjct: 129 FLNAIAMLAFLAVDGHLQVFAALAASFQTLPVSGDLLHAPGWRTLAAFGATVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|71906400|ref|YP_283987.1| flagellar biosynthesis protein FliR [Dechloromonas aromatica RCB]
 gi|71846021|gb|AAZ45517.1| Flagellar biosynthesis protein FliR [Dechloromonas aromatica RCB]
          Length = 260

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 96/241 (39%), Gaps = 2/241 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  +++    + R+   I   P  S + IP + RL  A++ ++ + P L     +Q    
Sbjct: 10  DAWIVAFVFPLARILGFIAAAPLWSTAGIPRRTRLILAISIAVAITPTLPPMPGVQPGSL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              +      ++ +G   G   ++        G  IS  +GL   T     +S     + 
Sbjct: 70  PGLWIL--AQQMLIGIGMGFAAKIVFTAFDIAGEFISFQMGLGFATFYDPLNSSQTPVIT 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             I +I LL    ++ H      L +S+  IP+       + + +   +    F   L L
Sbjct: 128 EFISLIALLLFLSMNGHLLYLATLAQSFSAIPVSATPLGASSWLNLAELGSKIFSAGLLL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +   ++ N+++ +L +  PQ+ ++ +  P  +  G + L +S+  +       F +
Sbjct: 188 SLPIIVALMITNVALAVLTRAAPQLNLFALGFPLTLMGGFVALAISLNYLASPLQGIFEF 247

Query: 246 G 246
           G
Sbjct: 248 G 248


>gi|288553047|ref|YP_003424982.1| flagellar biosynthesis protein FliR [Bacillus pseudofirmus OF4]
 gi|288544207|gb|ADC48090.1| flagellar biosynthesis protein FliR [Bacillus pseudofirmus OF4]
          Length = 258

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 99/242 (40%), Gaps = 7/242 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ +  L+  RV +   +LP      IP   ++  A+  S +++  L    D    +  A
Sbjct: 7   LLPAFLLVFVRVLAFFSVLPIYGHRSIPTTHKIGLALMLSWIMIFTL----DTPEVLIDA 62

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  LV+ E+ +G   GL+  +    +Q  G  I   +G  +   +          +   
Sbjct: 63  VFFLLVIKEILVGLSVGLIAMILLYAVQVAGGFIDFNMGFMIANVVDPQTGAQSPLIGGY 122

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLR 184
           +    LL L  ++ HH +   +  SY  +P+ Q        NI           F+I  +
Sbjct: 123 LYTFALLFLLAVNGHHLLLDGIFYSYQFVPMDQVFLPFGQENIVHYIATTFNAMFIIAFQ 182

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ P +    + ++++G++++ VPQ+ ++ +  P  I +G   L + + + +      F 
Sbjct: 183 MAFPIVGSLFLVDVALGMVSRAVPQMNVFVVGMPLKILVGLPLLIVYMSVFIMVVQKLFD 242

Query: 245 YG 246
             
Sbjct: 243 QM 244


>gi|297538206|ref|YP_003673975.1| flagellar biosynthetic protein FliR [Methylotenera sp. 301]
 gi|297257553|gb|ADI29398.1| flagellar biosynthetic protein FliR [Methylotenera sp. 301]
          Length = 270

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 107/245 (43%), Gaps = 3/245 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +   +  ++SL   + R+   I   P  + + IP QV+L   +  ++++ P L      +
Sbjct: 6   SDLLQTWIVSLLWPLTRILGVIAAAPIFNHTAIPNQVKLGLGIMLTLIIAPTLPAMPHFE 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
            F  +     +   +L +G   G  +R+    ++  G +I  ++GL              
Sbjct: 66  IFSFQGLLILV--QQLVIGLAIGFSMRLVFSAVELAGQLIGMSMGLGFAGFYDPQSQGQS 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
           T +N  + ++ +L    +D H  +  A+  S+ T+PI    +  +         +T F +
Sbjct: 124 TAVNQFLVLLAMLIFLSLDGHLLIITAVANSFLTMPITVGSSGIDPLK-IAMWGETIFSV 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L L+ P +   ++ N+++G+L K  PQ+ ++ I  P  + +G + + LS+  ++    +
Sbjct: 183 GLILALPAVAALLITNMALGILTKTAPQLNLFGIGFPVTLSIGLVVIALSLPGMLKPIEN 242

Query: 242 SFLYG 246
               G
Sbjct: 243 FIEQG 247


>gi|307546960|ref|YP_003899439.1| flagellar biosynthetic protein FliR [Halomonas elongata DSM 2581]
 gi|307218984|emb|CBV44254.1| K02421 flagellar biosynthetic protein FliR [Halomonas elongata DSM
           2581]
          Length = 266

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 104/240 (43%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +++      R+   ++  P    S +P Q ++  A A ++V+ P L    D+     +
Sbjct: 11  AWLVAFLWPFARITGLMLSSPLWGHSSVPRQAKIALAGALTVVIAPMLPPMPDVAIVSWQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                ++  +L +G   GL++RV    +Q TG  I   +GL   T    S       L+ 
Sbjct: 71  G--LGILTEQLLIGAAMGLVMRVTLAVVQATGEFIGLQMGLAFATFFDPSSGTNMMVLSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ +I LL    +D H  V   L  S+ ++PIG        F   V    T F   + L+
Sbjct: 129 LLYMITLLMFLALDVHLVVLEVLANSFRSLPIGIGRFDPAAFMMLVRYGATIFTSGMLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+S+G+LN+  PQ+ ++ I  P  + +G + L + +  +       F  G
Sbjct: 189 LPLVASLLIINLSLGILNRAAPQLTVFNIGFPTSLTVGIILLMVLMTDLDRFLERLFGQG 248


>gi|315122292|ref|YP_004062781.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495694|gb|ADR52293.1| flagellar biosynthesis protein FliR [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 247

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 191/247 (77%), Positives = 217/247 (87%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M  SPEII+MSLFLI CR+GSCIM LPG SM Y+PMQVR  F+M FSIVLLPFLWDTIDL
Sbjct: 1   MIASPEIIIMSLFLICCRIGSCIMFLPGFSMPYVPMQVRFFFSMTFSIVLLPFLWDTIDL 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q F +RAYY KLV+VELFLGCVHG+L+R+YT GLQF GSVISTAIGLNLQ+SMGISDS+ 
Sbjct: 61  QIFADRAYYLKLVIVELFLGCVHGVLVRIYTFGLQFMGSVISTAIGLNLQSSMGISDSIP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET  +SLIG IGLLALW+IDFHHQ+FYALVKSYGT PIG+EL+F NIFSS +N+LQ TF+
Sbjct: 121 ETSFSSLIGTIGLLALWIIDFHHQIFYALVKSYGTTPIGKELHFDNIFSSLINILQMTFI 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           IMLRLSSPFLFFY+VFNISIG LNK+VPQIP+YFISTPY++GLG LFL  SIE+I+YQF 
Sbjct: 181 IMLRLSSPFLFFYVVFNISIGFLNKIVPQIPVYFISTPYMVGLGFLFLYSSIEMIIYQFI 240

Query: 241 HSFLYGF 247
           HSF   F
Sbjct: 241 HSFNGIF 247


>gi|395392|emb|CAA52219.1| flagellar biosynthetic protein [Bacillus subtilis]
          Length = 259

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 96/239 (40%), Gaps = 6/239 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+ +  + +P      +P   R+ FA   +++    +     L+      
Sbjct: 7   LFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTIDKPPSLEI---DE 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +Y  L   E  +G   GL+  +    +Q  GS I   +G ++   +          +   
Sbjct: 64  HYMLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVIDPQTGAQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN---IFSSFVNMLQTTFMIMLR 184
           I  + LL +  ++ HH +   +  S+  I + Q                 L   F+I  +
Sbjct: 124 IYTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEQFAYFIAKSLNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + +I     + F
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVRNVF 242


>gi|304404262|ref|ZP_07385924.1| flagellar biosynthetic protein FliR [Paenibacillus curdlanolyticus
           YK9]
 gi|304347240|gb|EFM13072.1| flagellar biosynthetic protein FliR [Paenibacillus curdlanolyticus
           YK9]
          Length = 263

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 107/243 (44%), Gaps = 7/243 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
                LI CR+ +  ++ P  SM  +P   ++      ++++          ++ V  A 
Sbjct: 8   FPIFLLIFCRMTAFFVVAPLFSMRGVPTTFKIGLGFFLTLIVFLTYGVK---ESIVPDAT 64

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y   V+ E+ +G + G ++ ++   +Q  G+++  ++G  +   +      +   L +L 
Sbjct: 65  YILFVIREVLVGLLLGFVVYLFFTVVQTAGALMDISMGFAMSNVVDPMTGASSPMLGNLK 124

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN----FGNIFSSFVNMLQTTFMIMLR 184
            +I +L    ++ HH +  AL+ SY  +P+  +L      G +    V     TFM+  +
Sbjct: 125 YMILVLVFLSMNGHHYMLTALMDSYKWMPLDNDLFARIYSGKVSEFIVLAFSETFMLAFQ 184

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++SP +    + ++ +G L K  PQ  ++ I  P  I +G   L L +  +   F H F 
Sbjct: 185 IASPIIVAMFLTDVGLGFLAKTAPQYNVFVIGMPLKILIGVFMLTLILPSMSGVFEHLFS 244

Query: 245 YGF 247
             F
Sbjct: 245 TMF 247


>gi|78485087|ref|YP_391012.1| flagellar biosynthetic protein FliR [Thiomicrospira crunogena
           XCL-2]
 gi|78363373|gb|ABB41338.1| flagellar biosynthetic protein FliR [Thiomicrospira crunogena
           XCL-2]
          Length = 247

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 101/235 (42%), Gaps = 2/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M   F    R+   ++++P LS SY+PM VRL  A+  +  + P L     +  F    +
Sbjct: 1   MGLYFWPFIRISGMLLMVPILSGSYVPMNVRLLLAVFITFAVAPSLALPPPVDPFT--WH 58

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ +L +G   GL+  +        G + S ++GL + + +  +  +    +    
Sbjct: 59  GILLIVQQLGIGVAIGLIFALIFQAFVIAGHLASMSMGLAMASMVDPATGVNTPIIGRYF 118

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            II  L   +++ H  VF A+++S+ T+PIG      +            F   + ++ P
Sbjct: 119 TIIATLLFLLMNGHVLVFKAVLQSFETLPIGLHFFTQDSLKLIYGFGSQMFESGVTIALP 178

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   ++ NI+ G++ +  P + I+ +  P  + +G + L     ++        
Sbjct: 179 LVTALLLVNIAFGVVARAAPALNIFAVGFPVTLLVGLIMLVFITPLLYPNLQILM 233


>gi|302392377|ref|YP_003828197.1| flagellar biosynthetic protein FliR [Acetohalobium arabaticum DSM
           5501]
 gi|302204454|gb|ADL13132.1| flagellar biosynthetic protein FliR [Acetohalobium arabaticum DSM
           5501]
          Length = 258

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 51/247 (20%), Positives = 109/247 (44%), Gaps = 1/247 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M ++   ++    LI+ R+    +  P      IP +++   A   +++L P + D  +L
Sbjct: 1   MDLALIELIYQGALIMLRLTGLFLTAPFFGSRVIPKRIKAALAFLVTLILSPVV-DGSNL 59

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +   N        + EL +G + G +  +    +Q  G +IS  +GL +   M   +  +
Sbjct: 60  ELPTNILILLFNFLSELTIGLIFGFITILIFASIQLAGQMISMRMGLAMANIMDPMNGSS 119

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              +     ++  L   VI+ HHQ+  AL  S+  IP+        +F   + M    F 
Sbjct: 120 IAVIGQFKNVLATLLFLVINGHHQLLRALKHSFDVIPLTGLRISDALFMKLLRMAGDLFP 179

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +  +++ P +    + +++ GL+ + VPQ+ ++ +  P  + +GSL L +++ + +    
Sbjct: 180 LAFQIALPIIAALFLTDVAFGLVARTVPQMNVFVMGLPTKLLVGSLLLLITVPVYISLIR 239

Query: 241 HSFLYGF 247
             F   F
Sbjct: 240 GLFDDLF 246


>gi|113969637|ref|YP_733430.1| flagellar biosynthesis protein FliR [Shewanella sp. MR-4]
 gi|113884321|gb|ABI38373.1| flagellar biosynthetic protein FliR [Shewanella sp. MR-4]
          Length = 265

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S    + RV S +M++     +  P +VRL  A+A ++ + P L    D + F   
Sbjct: 10  QTIASYMWPLFRVTSMLMVMVVFGATTTPTRVRLLLAVAITLAIAPVLPPVKDAELFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +          + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVTQMVMQTFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI  +      + +        F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRALAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F   +   
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFEEVWASA 247


>gi|24374728|ref|NP_718771.1| flagellar biosynthesis protein FliR [Shewanella oneidensis MR-1]
 gi|24349388|gb|AAN56215.1|AE015759_7 flagellar biosynthetic protein FliR [Shewanella oneidensis MR-1]
          Length = 265

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S    + RV S +M++     +  P +VRL  A+A ++ + P L    D Q F   
Sbjct: 10  QTIASYMWPLFRVASMLMVMVVFGAATTPTRVRLLLAIAITLAIAPVLPPVKDAQLFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +  S       + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVTQMVMQTFVLTGQIIGMQTSLGFASMVDPSSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI         + S        F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFDTLPISNVGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F   +   
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFDEVWASA 247


>gi|114046867|ref|YP_737417.1| flagellar biosynthesis protein FliR [Shewanella sp. MR-7]
 gi|113888309|gb|ABI42360.1| flagellar biosynthetic protein FliR [Shewanella sp. MR-7]
          Length = 265

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S    + RV S +M++     +  P +VRL  A+A ++ + P L    D + F   
Sbjct: 10  QTIASYMWPLFRVTSMLMVMVVFGATTTPTRVRLLLAVAITLAIAPVLPPVKDAELFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +          + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVTQMVMQTFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI  +      + S        F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F   +   
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFEEVWASA 247


>gi|292669765|ref|ZP_06603191.1| flagellar protein required for flagellar formation [Selenomonas
           noxia ATCC 43541]
 gi|292648562|gb|EFF66534.1| flagellar protein required for flagellar formation [Selenomonas
           noxia ATCC 43541]
          Length = 260

 Score =  118 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 45/247 (18%), Positives = 105/247 (42%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    +  + +  L + R+    ++ P      I    R+  A+A ++VL P +     +
Sbjct: 3   LYELLQGHIAAFLLTLTRISGIFLISPFFGSMNIAPFFRVGIALAMTVVLFPVIDRLGVV 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   ++   + ELF+G + G +  +    +   G V+   +G  +   +  +    
Sbjct: 63  TAPETIIMFAVAAVGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAIVNVVDPTSGQQ 122

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              + S +  + ++ L V + HH +  ALV+S+  +P+       +I     N     F+
Sbjct: 123 IPLIGSFLYNLAVIILLVTNGHHMIIAALVESFRAVPLAGMEPNLSIALLLANFTGGIFV 182

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             ++++ P  F  ++ N+ +G+L++ +PQ+ I+ +  P  + +G + L + I   V    
Sbjct: 183 TGMKIAMPITFAILLTNVGLGILSRTMPQMNIFVVGIPMQLMIGIVVLSMIIPFYVLFLD 242

Query: 241 HSFLYGF 247
             F   +
Sbjct: 243 VLFNEMY 249


>gi|83814762|ref|YP_446684.1| flagellar biosynthetic protein FliR [Salinibacter ruber DSM 13855]
 gi|294508620|ref|YP_003572679.1| flagellar biosynthetic protein FliR [Salinibacter ruber M8]
 gi|83756156|gb|ABC44269.1| flagellar biosynthetic protein FliR [Salinibacter ruber DSM 13855]
 gi|294344949|emb|CBH25727.1| flagellar biosynthetic protein FliR [Salinibacter ruber M8]
          Length = 258

 Score =  118 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 55/245 (22%), Positives = 112/245 (45%), Gaps = 2/245 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++     ++ + L+  RV   ++  P      IP++VR+  ++  +  L  F    +  
Sbjct: 1   MSLLDTEYILRVLLVFVRVSGLMLAAPFFQQKTIPVRVRVLASVVLAYSLAGFATGPLP- 59

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           ++  +   +  +V+VE   G V G   R+    + F G+++   + L+L  +       +
Sbjct: 60  EHVTHDVGFMLVVLVEAGTGLVMGFTARIIFWAVSFAGTIMGYQMALSLAQTYNPISGTS 119

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
             PL  ++    LLA  + D HH +  AL +S+  +P+G     G      +  +   F 
Sbjct: 120 SNPLGQILSYTFLLAFLLADGHHFLLRALAQSFEVVPLGGAELSGAG-PPMLGWMGDFFR 178

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + +RL++PFL    + +I++G+  +LVPQ  ++ +S P  + +G     + I+  V  F 
Sbjct: 179 LAVRLAAPFLVILFLTDIALGIFARLVPQANLFTLSLPAKLLVGIGIFLVFIQGAVPFFP 238

Query: 241 HSFLY 245
             F  
Sbjct: 239 SLFGE 243


>gi|206561838|ref|YP_002232603.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           J2315]
 gi|198037880|emb|CAR53824.1| flagellar biosynthetic protein FliR [Burkholderia cenocepacia
           J2315]
          Length = 260

 Score =  118 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 108/241 (44%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P++V++  A   ++V+ P L    D+  F   
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHAAVPVRVKIGLAAFMALVVAPTLGAMPDVTVFSAP 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   +  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWILV--TQFLIGVAMGFTMQLVFAAVEAAGDFIGLSMGLGFATFFDPHTSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H Q+F AL  S+ ++P+  +L     + +        F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQMFAALAASFQSLPVSGDLLHAPGWRTLATFGAVVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ +  P  + +G L + L +  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGVFQVGFPVTMLVGLLLVQLMVPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|121596082|ref|YP_987978.1| flagellar biosynthetic protein FliR [Acidovorax sp. JS42]
 gi|120608162|gb|ABM43902.1| flagellar biosynthetic protein FliR [Acidovorax sp. JS42]
          Length = 256

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 100/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +     P  SM  IP++ R+  A   ++     L +   +      
Sbjct: 11  AWLSPVLWPFLRVLALFTSAPVFSMRVIPVRTRIGLAFLVAVCAQAVLPEQPVISLNSRE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A  +  V+ ++ +G   G  +R+    ++  G +I   +GLN  +    + +   + +  
Sbjct: 71  A--AGAVVQQVGIGLAMGFAVRLVFAAVELAGEIIGLQMGLNFASFFDPASNAQVSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G I +L   VI+ H  V  A+VKS+ + P+G              +  + F   L ++
Sbjct: 129 FFGNISMLLFVVINGHLMVLMAVVKSFDSFPVGGNFLQAIGQMRLHELGASLFSSALWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 189 LPMIALLLFVNLTLGIISRVAPQMNIYAVGFPVTLTVGMLGITATLPMLEQPMLALLQQS 248


>gi|241763643|ref|ZP_04761693.1| flagellar biosynthetic protein FliR [Acidovorax delafieldii 2AN]
 gi|241367118|gb|EER61484.1| flagellar biosynthetic protein FliR [Acidovorax delafieldii 2AN]
          Length = 256

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +   + P  SM  IPM+V++  A   ++     L +   +      
Sbjct: 11  AWLSPILWPFLRVLAVFTVAPVFSMRAIPMRVKVGLAFLVALCAQAVLTNQPVISVNGRE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     V  ++ +G   G  +R+    ++  G +I   +GLN  +    + +   + +  
Sbjct: 71  A--LGAVAQQVTVGLAIGFAVRLVFSAVELAGELIGLQMGLNFASFFDPASNAQVSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G +  L   VI+ H  V  A+VKS+ + P                +  + F   L ++
Sbjct: 129 FFGHMATLLFVVINGHLMVLMAVVKSFDSFPADGSFLQALGQMHLHELGASLFSSALWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +      N+++G+++++ PQ+ IY +  P  + +G L +  ++ ++           
Sbjct: 189 LPMIALLTFVNLTLGIISRVAPQMNIYAVGFPVTLTVGLLGIAATLPMLEQPVLTLMQQA 248


>gi|330808230|ref|YP_004352692.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376338|gb|AEA67688.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 260

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 110/242 (45%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + RV + +M +P    + +P +VRL FA+A ++V+ P L     +     
Sbjct: 12  SSWVASFVLPLFRVTAVLMSMPVFGTTLVPRRVRLYFALAITVVIAPGLPPMPSVHALDL 71

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    LV  ++ +G + G  ++++       G +IS  +G+   + +  ++ +    + 
Sbjct: 72  SA--LMLVAEQILIGTLMGFSLQLFFQAFVVAGQIISIQMGMAFASMVDPTNGVTTAVIG 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    ++ H  VF  L +S+ T+P+G  L   N F      L       + L
Sbjct: 130 QFLTMLVTLLFLAMNGHLVVFEVLTESFTTMPVGSALLV-NHFWEIAGKLGWVLGAAMVL 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   +V NI+ G++ +  PQ+ I+ I  P ++ LG +   +S+  I+ Q+    + 
Sbjct: 189 VLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLILTLGMVIFWISLGDILNQYQPLAIQ 248

Query: 246 GF 247
             
Sbjct: 249 AL 250


>gi|39995533|ref|NP_951484.1| flagellar biosynthesis protein FliR [Geobacter sulfurreducens PCA]
 gi|39982296|gb|AAR33757.1| flagellar biosynthesis protein FliR [Geobacter sulfurreducens PCA]
 gi|298504534|gb|ADI83257.1| flagellar biogenesis protein FliR [Geobacter sulfurreducens KN400]
          Length = 264

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 51/235 (21%), Positives = 111/235 (47%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L++ R+      +P      +P  ++     A ++V  P + + +  Q   +   
Sbjct: 14  VAFFTLVMGRMAGIFAAIPIFGGRRVPTPIKALLVFAMTMVCFPIIKEKMP-QLPTDVLS 72

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G   GLL  +    ++F G ++S  IGL + T    S     + ++ ++
Sbjct: 73  LGFLMVQEVLVGVSLGLLSLIIFAAVEFAGQIVSVQIGLTIVTEFDPSQGGQLSIMSIIL 132

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L    +  HH    ALV+SY  +P+G     G +    V  +   F++ +RL++P
Sbjct: 133 EMLATLLFLSLGMHHIFIGALVQSYDVLPLGAWHMSGALLQFIVTTIGEVFVLAVRLAAP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   +  ++ +G++ +  PQ+ ++F+S P  IG+G + L LS+ + ++     F
Sbjct: 193 VMVTLLATSVMLGIMARSFPQMNVFFVSMPLNIGIGFIVLGLSLPLFLHTVQGHF 247


>gi|121997284|ref|YP_001002071.1| flagellar biosynthetic protein FliR [Halorhodospira halophila SL1]
 gi|121588689|gb|ABM61269.1| flagellar biosynthetic protein FliR [Halorhodospira halophila SL1]
          Length = 263

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 41/242 (16%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + R+G+  ++ P      +P+QVR+   +A +I +LP + +   +      
Sbjct: 10  AWVGTFMYPLMRIGAAALVAPVFGNDMVPLQVRVFIGVALTIAVLPAVGEVPPVDPLSPD 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + E+ +G   G+++ +        G  I+ A+GL   T +     ++   ++ 
Sbjct: 70  G--LLIAVQEILVGLTIGMVLALALNTAVIAGESIALAMGLGFATMVDPQTGMSVPVISQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+  I  L    +  H  +   L  S+  +PIG+ +   ++F          +   + ++
Sbjct: 128 LLLTIVTLLFLAVGGHLMLIQLLADSFSAVPIGEIVLDRDVFWGVAAWGTQMYAGAVLIA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFL-CLSIEIIVYQFSHSFLY 245
            P +   +V N+S+G++ +  PQ+ ++ +  P  I +G + +  L +  +  + +  +  
Sbjct: 188 LPLVTVLLVINLSLGVMTRAAPQMNVFSVGLPLTILVGGVLMPILVLPALPARMAMMWSE 247

Query: 246 GF 247
            +
Sbjct: 248 AY 249


>gi|304438442|ref|ZP_07398382.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304368525|gb|EFM22210.1| flagellar biosynthetic protein FliR [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 260

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 47/247 (19%), Positives = 104/247 (42%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    +  +    L++ RV    ++ P      I +  R+  A+A +I+L P +      
Sbjct: 3   LYELLQGHIAVFLLMLVRVSGIFLISPFFGSMNISIYFRVGTALAITILLFPVVDGLGTP 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               N   +    + ELF+G + G +  +    +   G V+   +G  +   +  +    
Sbjct: 63  YVPENVIMFGVTALGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAIVNVVDPTSGQQ 122

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              + S +  + ++ L   + HH +  ALV+S+  +PI       ++     N   T F+
Sbjct: 123 IPLIGSFLYNLAVIVLLATNGHHMILAALVESFRVVPIAGMEGNLSLAMLIANFTGTIFL 182

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             ++++ P  F  ++ N+ +G+L++ +PQ+ I+ +  P  + +G   L + I   V    
Sbjct: 183 TGMKIAMPITFAILLTNVGLGILSRTMPQMNIFVVGIPMQLMIGITVLSMIIPFYVLFLD 242

Query: 241 HSFLYGF 247
             F   +
Sbjct: 243 VLFNEMY 249


>gi|1066865|gb|AAB81321.1| fliR [Salmonella enterica subsp. enterica serovar Typhimurium]
          Length = 264

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRVRALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|222530121|ref|YP_002574003.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312621586|ref|YP_004023199.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|222456968|gb|ACM61230.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312202053|gb|ADQ45380.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 260

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 98/233 (42%), Gaps = 2/233 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    ++ P      IP   ++ FA   S++++     +       N   Y  
Sbjct: 15  FFLVLARMSGLFIVSPIFGRRNIPAYFKIGFAFFLSLLVVSTYRFSYSAP--SNLLEYIF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + + 
Sbjct: 73  VVIKEFIVGLLIGYISYMIFSAILLAGQIIDNAIGFGMANVIDPMSEVQVPLLGNFLYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A++ SY  +PIG E        +F       F+I + +S P L 
Sbjct: 133 MLVVFFGTDAHHLLIRAVIYSYKLVPIGYEGFRREFTWNFFRFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L +    +         
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVIIFPFMNKMIFVLID 245


>gi|260438788|ref|ZP_05792604.1| flagellar biosynthetic protein FliR [Butyrivibrio crossotus DSM
           2876]
 gi|292808777|gb|EFF67982.1| flagellar biosynthetic protein FliR [Butyrivibrio crossotus DSM
           2876]
          Length = 258

 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 105/234 (44%), Gaps = 2/234 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI+ R+ S +   P  +M+  P + +L  A   S+++   + D      + +   Y+ 
Sbjct: 14  FLLILVRIASFVYTAPFFNMANTPQRTKLGLAFFISLIVFTLVPDR--TLEYSSILEYAI 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E  +G + G    V    + F G++I + IGL++ +    +     T   +L    
Sbjct: 72  LVIKESVVGLLLGFSCMVCVQTITFAGNIIDSNIGLSMASEYDPTLRDQTTVSGTLYYYT 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L L V   +  +  A+V +Y  IPI       +++SS V ++   F+I  R++ P   
Sbjct: 132 VFLLLMVSGLYQFLISAIVDTYTIIPINGLSVNPSLYSSVVTLVSDYFIIGFRIALPVFV 191

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             ++ N  +G+L K+  Q+ ++ +     I  G + + +++ ++    +  +  
Sbjct: 192 SLLIVNCVLGILAKVASQLNMFAVGIQIKILAGLVIMFVTVGLLPQIANFIYQN 245


>gi|90423032|ref|YP_531402.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisB18]
 gi|90105046|gb|ABD87083.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           BisB18]
          Length = 256

 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 123/238 (51%), Gaps = 1/238 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +  +  L+  R+ + +ML+PG   + IP++++L  A+  ++V+LP       +    + 
Sbjct: 10  ALAAAFMLVFARIAAMVMLMPGFGETNIPVRIKLAIALVLTLVILPLHRSDYQVD-MTSL 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ E+ +G V G   RV    LQ  GSVI+  +GL   TS+  +       + +
Sbjct: 69  TPLIVLMLHEIVIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTSVDPTQGQQGAVIGN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++GL  L+  D HH V  AL +SY     G+ ++ G++ S         F I ++LS
Sbjct: 129 FLTLLGLTLLFATDTHHLVIAALNESYRIFSPGEFMSSGDVASLATRAFAAAFKIGMQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +PFL F +VFNI +G+L +L+PQ+ +YF+  P  I  G L     +  +++ F   F+
Sbjct: 189 APFLVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIFAGFLIFGAVLATMMHTFLDYFI 246


>gi|146307832|ref|YP_001188297.1| flagellar biosynthesis protein FliR [Pseudomonas mendocina ymp]
 gi|145576033|gb|ABP85565.1| flagellar biosynthetic protein FliR [Pseudomonas mendocina ymp]
          Length = 258

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 107/242 (44%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              +    L + R+ + +M++P +    +P +VRL  A+A S+VL+P L     +     
Sbjct: 10  SGWVGQFLLPLFRIAAMLMVMPIIGTQLVPNRVRLYLALAISVVLVPTLPPMPQVD--AL 67

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L++ ++ +G + G +++++       G +I+  +GL   + +  ++ ++   L 
Sbjct: 68  SLRSLLLILEQVLIGAMFGFILQLFFHLFAVAGQIIAMQMGLGFASMVDPTNGVSVPVLG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    I+ H  V   L +S+ ++P GQ L  G+ +      L       L L
Sbjct: 128 QFMLMLVTLLFLAINGHLVVLEVLAESFVSLPPGQGLMIGHYWE-LAGKLGWVIGAGLLL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +V N++ G++ +  PQ+ I+ I  P  + +G +   + +      F      
Sbjct: 187 TLPMVTALLVINLAFGVMTRAAPQLNIFSIGFPLTLAMGLVIFWIGLSDFGSLFQALASE 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|114332027|ref|YP_748249.1| flagellar biosynthetic protein FliR [Nitrosomonas eutropha C91]
 gi|114309041|gb|ABI60284.1| flagellar biosynthetic protein FliR [Nitrosomonas eutropha C91]
          Length = 266

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 56/241 (23%), Positives = 104/241 (43%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             ++ L   + R+ + +   P L  S IP+QV+L  A+  +I++ P L     +      
Sbjct: 11  GWLIILIWPLARILALMTATPLLGSSSIPIQVKLGLAVLLTILIAPLLPPLPQIDPGSGV 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G   G  IR+    ++  G +    +GL   T      S     +  
Sbjct: 71  GPIVLL--QQIIIGLAMGFSIRIVFTAVEMAGEITGLQMGLGFATFFDPQQSGQVQLVGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G++  L    ID H QV   L +S+  +PIG +      F++ VN     F + L L+
Sbjct: 129 FYGLLATLLFLAIDGHLQVIAVLAQSFTILPIGADGMNVTSFTTLVNWGAEIFTLGLHLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P L   ++ N+++G+L +  PQ+ I+ +  P  +G+G L +  ++       +  F   
Sbjct: 189 LPVLAALLITNLALGILTRAAPQLNIFAVGFPLTLGIGLLVMSWALPYFTPVLTQMFQES 248

Query: 247 F 247
           F
Sbjct: 249 F 249


>gi|332994109|gb|AEF04164.1| flagellar biosynthesis protein FliR [Alteromonas sp. SN2]
          Length = 259

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 95/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L L   R+    + + GLS   IP QVR    +  +++++P +            
Sbjct: 10  QFLADLMLPFMRISGLFVAMIGLSAQSIPPQVRALLGIMLTLIIMPVVPPAPVDDLVNLG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +   +   +L +G   G +  +        G +I+   GL   + +   + +    +  
Sbjct: 70  TFILGI--QQLLIGVAIGFVSMMVLNTFVLAGQIIAMQTGLGFASIVDPVNGINVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  W +D H  + + +V S+   PIG+    G  F    +     F+  + LS
Sbjct: 128 FYLILATLLFWTLDGHLAMIHMIVLSFHAFPIGEAWWTGEQFREIAHWGGWMFVSAITLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N++ G++ K  PQ+ I+ I       +G L + ++++     F   +L  
Sbjct: 188 LAPIVSLLIVNLAFGVMTKAAPQLNIFSIGFSIAQVMGLLIIWITLDNFTAHFETQWLRA 247


>gi|117919802|ref|YP_868994.1| flagellar biosynthesis protein FliR [Shewanella sp. ANA-3]
 gi|117612134|gb|ABK47588.1| flagellar biosynthetic protein FliR [Shewanella sp. ANA-3]
          Length = 265

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 95/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S    + RV S +M++     +  P +VRL  A+  ++ + P L    D + F   
Sbjct: 10  QTIASYMWPLFRVTSMLMVMVVFGATTTPTRVRLLLAVTITLAIAPVLPPVKDAELFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +          + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVTQMVMQTFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI  +      + S        F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F   +   
Sbjct: 188 LSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFEEVWASA 247


>gi|331269330|ref|YP_004395822.1| flagellar biosynthetic protein FlhB [Clostridium botulinum
           BKT015925]
 gi|329125880|gb|AEB75825.1| flagellar biosynthetic protein FlhB [Clostridium botulinum
           BKT015925]
          Length = 594

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 100/227 (44%), Gaps = 1/227 (0%)

Query: 19  VGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELF 78
           + S + ++P       P  V++ F +  S +++P + D   + N           ++E+ 
Sbjct: 1   MFSFVEVVPVFFPKGTPNVVKIMFTVILSFMIIPGI-DYSSMININGNLQLIMYCLIEIT 59

Query: 79  LGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWV 138
            G   G +  +    +++ G+ +   +G  + T    + +   T +  L+    L+   +
Sbjct: 60  TGLTFGFVTNICFSCIRYAGAFMDLQVGFAMMTMFDPNSNSNVTLIERLLYWFSLIVFTI 119

Query: 139 IDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNI 198
           +D    +    ++S+  I IG+ +   N     +N+    F + +R++ P +   I+ ++
Sbjct: 120 VDGPRMIIKIFIESFNVIHIGKFILNQNSAMHVINVFIKYFQLGIRIAIPIVLIIILTDL 179

Query: 199 SIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           ++GL+ K VPQ+ I  +  P  I LG   L LS+ +I      SF  
Sbjct: 180 TMGLVAKTVPQLNIMILGMPVKIILGLSVLGLSLPVIFNIIISSFDN 226


>gi|134294168|ref|YP_001117903.1| flagellar biosynthetic protein FliR [Burkholderia vietnamiensis G4]
 gi|134137325|gb|ABO53068.1| flagellar biosynthetic protein FliR [Burkholderia vietnamiensis G4]
          Length = 260

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 57/241 (23%), Positives = 108/241 (44%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +    +PM+V++  A   ++V+ P L     +  F  +
Sbjct: 11  GWLTAFLWPFVRMLALVATAPLVGHGAVPMRVKIGLAAFMALVVAPTLGAMPGVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  + +    ++  G  I  ++GL   T      + A   +  
Sbjct: 71  GIWI--VVTQFLIGVSMGFTMHLVFAAVEAAGDFIGLSMGLGFATFFDPHSNGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QVF AL  S+ T+P+  EL     + +      T F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQVFAALAASFQTLPVSAELLHAPGWHTLAAFGVTVFQMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P  + +G L + L I  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMIPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|148256776|ref|YP_001241361.1| flagellar biosynthesis protein FliR [Bradyrhizobium sp. BTAi1]
 gi|146408949|gb|ABQ37455.1| Flagellar biosynthetic protein fliR [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 120/238 (50%), Gaps = 1/238 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +     L   R+G+ +MLLPGL    IP++++L  A+  ++++LP       +      
Sbjct: 10  TLAAVFMLAFARIGAMVMLLPGLGEVNIPVRIKLATALLLTMIVLPLHRQAYQVD-LQAL 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    +++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + +
Sbjct: 69  SPLLVMMVHEIVIGIVLGATARVTLSALQVAGSVIAQQMGLGFVTAVDPTQGQQGVLIGN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G+  L+  D HH V  AL  SY     G+ +  G++ S         F I L+LS
Sbjct: 129 FLTMLGVTLLFSTDSHHLVIAALSDSYKIFAPGEVIPSGDVASLATRAFAAAFKIGLQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +PFL F +VFNI +G+L +L+PQ+ +YF+  P  I +G L   L +  ++  F   F 
Sbjct: 189 APFLVFGLVFNIGLGVLARLMPQMQVYFVGAPLSILIGFLIFGLVLAAMMGTFLGYFE 246


>gi|126175116|ref|YP_001051265.1| flagellar biosynthesis protein FliR [Shewanella baltica OS155]
 gi|153001440|ref|YP_001367121.1| flagellar biosynthesis protein FliR [Shewanella baltica OS185]
 gi|160876165|ref|YP_001555481.1| flagellar biosynthesis protein FliR [Shewanella baltica OS195]
 gi|304409947|ref|ZP_07391566.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|307302340|ref|ZP_07582098.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
 gi|125998321|gb|ABN62396.1| flagellar biosynthetic protein FliR [Shewanella baltica OS155]
 gi|151366058|gb|ABS09058.1| flagellar biosynthetic protein FliR [Shewanella baltica OS185]
 gi|160861687|gb|ABX50221.1| flagellar biosynthetic protein FliR [Shewanella baltica OS195]
 gi|304351356|gb|EFM15755.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|306914378|gb|EFN44799.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
 gi|315268361|gb|ADT95214.1| flagellar biosynthetic protein FliR [Shewanella baltica OS678]
          Length = 265

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 94/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + RV S +M++     +  P +VRL  AMA +  + P L    +   F   
Sbjct: 10  QTIAAYMWPLFRVASMLMVMVVFGAATTPSRVRLLLAMAITFAIAPVLPPVQNADLFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +          + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVTQMVMQVFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI  +      + +  +     F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRALADWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G   L L++  ++  F   +   
Sbjct: 188 ISAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLFILWLTLTPVMEHFDEVWAAA 247


>gi|317048611|ref|YP_004116259.1| flagellar biosynthetic protein FliR [Pantoea sp. At-9b]
 gi|316950228|gb|ADU69703.1| flagellar biosynthetic protein FliR [Pantoea sp. At-9b]
          Length = 262

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 108/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ +     P LS   IP +V++  A+  + +L+P L     ++  +  
Sbjct: 11  HWVSQFFWPMVRLLALFASAPVLSEKSIPNRVKIGLAVLTTWILMPLLP---PVETTLFT 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L++ ++ +G   GL ++     ++  G VI   +GL+  T       L    L  
Sbjct: 68  AAGFWLLLQQILIGVGLGLTMQFAFGAVRMAGEVIGLQMGLSFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ ++ +L     + H  +   LV S+ T+PI       N F + V      F+  + L+
Sbjct: 128 ILDMLAMLLFLTFNGHLWLISMLVDSFHTMPISDHPLNANAFMALVKAAGLIFLNGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ +  P  + +G L L L + ++     H F   
Sbjct: 188 LPLIVLLLTLNMALGLLNRVTPQLSVFVVGFPITLTVGILSLGLMMPLLAPFCEHLFSEV 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|212639549|ref|YP_002316069.1| flagellar biosynthesis protein FliR [Anoxybacillus flavithermus
           WK1]
 gi|212561029|gb|ACJ34084.1| Flagellar biosynthesis pathway, component FliR [Anoxybacillus
           flavithermus WK1]
          Length = 259

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 101/243 (41%), Gaps = 6/243 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  LI  RV S  + +P  S   +P   ++ FA   S ++   L            
Sbjct: 8   TYVPTFLLIFARVASFFVTMPLFSYRNVPNVHKIGFAFFISWLMFFSLDPKP----LDID 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             Y  L++ E+ +G + GL+  +    +Q  G  I   +G  +   +          +  
Sbjct: 64  GTYMMLLIKEVLVGLLIGLVAFIIMSAIQIAGGFIDFQMGFAIANVIDPQTGAQSPLMGQ 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN--IFSSFVNMLQTTFMIMLR 184
            +  I L  L  ++ HH +   +  SY  IP+   ++FGN  I    V + Q  F+I L+
Sbjct: 124 YLYTIALFFLLAVNGHHMLLDGIFYSYQFIPLDHLVSFGNEQIAEQVVRLFQAMFVIALQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ P +    + ++++G++ + VPQ+ I+ I  P  I +  +   +    +       F 
Sbjct: 184 MAIPIVGCLFLVDVALGIVARTVPQMNIFVIGLPVKIIVSFVLFVIVFSSMFAVTKQLFE 243

Query: 245 YGF 247
           + F
Sbjct: 244 FAF 246


>gi|84514804|ref|ZP_01002167.1| Flagellar protein FliR [Loktanella vestfoldensis SKA53]
 gi|84510963|gb|EAQ07417.1| Flagellar protein FliR [Loktanella vestfoldensis SKA53]
          Length = 275

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 94/237 (39%), Gaps = 2/237 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            M+  FL   R+ +  +  P    + IP+QVR+  ++A +      +   +     +   
Sbjct: 25  FMLVFFLHTLRLSAFFLSAPFFGAAAIPVQVRVIVSVAIAFGFYGLI--DVPDPQNLPFL 82

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
              ++ ++E+ +G   GL   +    +  TG  I+ + GL     M  +       ++  
Sbjct: 83  SMIEVALIEVVIGLSLGLAFTIAFSAVALTGEKIAASAGLGFAAQMDPNSGGQTPVISQF 142

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +  + A   +D H  +   +  SY  +P+GQ   F    +  +      F I  +L  
Sbjct: 143 LNLFAIAAFLSLDGHLHMIGLIRMSYEVLPLGQPFKFSAFITGGLAAAGHMFTIASQLML 202

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           P +   ++ NI++G++ +  PQ+ ++    P  I    + L +S        +    
Sbjct: 203 PVVSILLLANITVGVVTRSAPQLNLFSFGFPLTILTCFVALYVSTAPFASGIAEMIE 259


>gi|204931027|ref|ZP_03221853.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204320071|gb|EDZ05276.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 264

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAIQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|218549275|ref|YP_002383066.1| flagellar biosynthesis protein FliR [Escherichia fergusonii ATCC
           35469]
 gi|218356816|emb|CAQ89444.1| flagellar export pore protein [Escherichia fergusonii ATCC 35469]
          Length = 267

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   +P + +L   +  ++ + P L         +  
Sbjct: 16  QWLSLGFWPLLRVLALISTAPILSERSVPKRAKLGLGLMITLAIAPMLPPH---DVPIFS 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  
Sbjct: 73  YAAVWVAIQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLAR 132

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+
Sbjct: 133 ILDMLVLLLFLTFNGHLWLISILVDTFHTLPIGGEPLNSNAFLALTRAGGLIFLNGLMLA 192

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G   +   + +I     H F   
Sbjct: 193 LPVITLLLTLNLALGLLNRMAPQLSVFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEV 252

Query: 247 F 247
           F
Sbjct: 253 F 253


>gi|217972628|ref|YP_002357379.1| flagellar biosynthesis protein FliR [Shewanella baltica OS223]
 gi|217497763|gb|ACK45956.1| flagellar biosynthetic protein FliR [Shewanella baltica OS223]
          Length = 265

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 94/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + RV S +M++     +  P +VRL  AMA +  + P L    +   F   
Sbjct: 10  QTITAYMWPLFRVASMLMVMVVFGAATTPSRVRLLLAMAITFAIAPVLPPVQNADLFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +          + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVTQMVMQVFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI  +      + +  +     F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRALADWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G   L L++  ++  F   +   
Sbjct: 188 ISAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLFILWLTLTPVMEHFDEVWAAA 247


>gi|238927447|ref|ZP_04659207.1| flagellar biosynthesis protein FliR [Selenomonas flueggei ATCC
           43531]
 gi|238884729|gb|EEQ48367.1| flagellar biosynthesis protein FliR [Selenomonas flueggei ATCC
           43531]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 104/247 (42%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    +  +    L++ R     ++ P      IP+  R+  A++ ++VL P +      
Sbjct: 3   LYELLQGHIAVFLLMLVRTSGIFLISPFFGSMNIPIFFRVGTALSMTVVLFPVVDGLGTP 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               N   ++   + ELF+G + G +  +    +   G V+   +G  +   +  +    
Sbjct: 63  YVPENLIMFALTAVGELFIGWLIGFVAYISFAAITMAGKVMDMQVGFAIVNVVDPTSGQQ 122

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              + S +  +  + L   + HH +  ALV+S+  +PI       ++     N   T F+
Sbjct: 123 IPLIGSFLYNLAAIILLATNGHHMILAALVESFRAVPIAGMEGNVSLALLIANFTGTIFL 182

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             ++++ P  F  ++ N+ +G+L++ +PQ+ I+ +  P  + +G   L + I   V    
Sbjct: 183 TGMKIAMPITFAILLTNVGLGILSRTMPQMNIFVVGIPLQLMIGITVLSMIIPFYVLFLD 242

Query: 241 HSFLYGF 247
             F   +
Sbjct: 243 VLFNEMY 249


>gi|88813213|ref|ZP_01128453.1| Flagellar biosynthesis pathway, component FliR [Nitrococcus mobilis
           Nb-231]
 gi|88789535|gb|EAR20662.1| Flagellar biosynthesis pathway, component FliR [Nitrococcus mobilis
           Nb-231]
          Length = 258

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/242 (17%), Positives = 99/242 (40%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        RV + ++  P  S   IP+++R+   +  ++ +LP + +   L      
Sbjct: 10  AWLGQFLWPFIRVSAVLLTAPLFSNILIPVRLRVLLGVGLTVAVLPAVGNVPQLDPLSPE 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +   ++ +G   GLL+ +    +   G  +S  +GL   T +     ++ + ++ 
Sbjct: 70  G--VLVAGQQVLIGAAIGLLLAMAFQAVAIAGETLSITMGLGFATMISPQTGVSSSVISQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+ +L    +  H  +   L +S+ T+PI      G    + V      F   + L+
Sbjct: 128 FLLILAMLLFLAVGAHLMLIQLLAESFRTLPIAASGLGGQDVYALVGWAGEMFAGGVLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGS-LFLCLSIEIIVYQFSHSFLY 245
            P +   ++ N+ IG++ +  PQ+ I+ +  P  +  G  + L + +  +    +  +  
Sbjct: 188 LPAVAVLLIVNLIIGVMTRTAPQMNIFSVGLPLTLLAGFVVVLIILLPALPEHMTDLWRS 247

Query: 246 GF 247
            F
Sbjct: 248 AF 249


>gi|167736441|ref|ZP_02409215.1| flagellar biosynthetic protein FliR [Burkholderia pseudomallei 14]
          Length = 263

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 105/241 (43%), Gaps = 1/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF-VN 65
             + +      R+ + + + P       P++V++  A   ++V+ P L     +    V 
Sbjct: 11  GWLTAFLWPFVRMLALVAIAPVTGHRSTPVRVKIGLAGFMALVVAPTLPPMPPMPVATVF 70

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    +++ +  +G   G  +++    ++  G +I  ++GL   T      S A   + 
Sbjct: 71  SAQGVWIIVNQFLIGAALGFTMQIVFAAIEAAGDIIGLSMGLGFATFFDPHSSGATPVMG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             +  + +LA    D H QVF ALV S+  +P+  +L     + + V      F + L L
Sbjct: 131 RFLNAVAILAFLAFDGHLQVFAALVDSFRLVPVSADLLRAAGWQTLVAFGAAIFEMGLLL 190

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   ++ N+++G+LN+  PQI I+ +  P  + +G L + L    ++      F  
Sbjct: 191 ALPVVAALLIANLALGILNRAAPQIGIFQVGFPVTMLVGLLLVQLMAPNLIPFVGRLFDT 250

Query: 246 G 246
           G
Sbjct: 251 G 251


>gi|170722842|ref|YP_001750530.1| flagellar biosynthesis protein FliR [Pseudomonas putida W619]
 gi|169760845|gb|ACA74161.1| flagellar biosynthetic protein FliR [Pseudomonas putida W619]
          Length = 258

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 105/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P ++RL  A+A ++V++P L    +      R
Sbjct: 11  TWVATFILPLFRVTAVLMTMPIFGTRMLPARIRLYAAVAITVVIVPALPPLPEFDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + G  +++        G +I+  +G+   + +  ++ +    ++ 
Sbjct: 71  G--LLLCGEQIIVGALFGFSLQLLFQAFVIAGQIIAIQMGMAFASMVDPANGVNVAVVSQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   V++ H  VF  L +S+ T+P+G  L   N F      L   F   L L 
Sbjct: 129 FMTMLVSVLFLVMNGHLVVFEVLTESFTTLPVGNALVV-NHFWEMAGRLSWVFGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V NI+ G++ +  PQ+ I+ I  P  + LG     + +  ++  +       
Sbjct: 188 LPAIAALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIFWVGLADVLSHYQALASEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|120598262|ref|YP_962836.1| flagellar biosynthesis protein FliR [Shewanella sp. W3-18-1]
 gi|146293660|ref|YP_001184084.1| flagellar biosynthesis protein FliR [Shewanella putrefaciens CN-32]
 gi|120558355|gb|ABM24282.1| flagellar biosynthetic protein FliR [Shewanella sp. W3-18-1]
 gi|145565350|gb|ABP76285.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens CN-32]
 gi|319427059|gb|ADV55133.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens 200]
          Length = 265

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 94/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S    + RV S +M++     +  P +VRL  AMA +  + P L    +   F   
Sbjct: 10  QTIASYMWPLFRVASMLMVMVVFGAATTPARVRLLLAMAITFAIAPVLPPVENADLFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +      ++ +G   G + ++       TG +I     L   + +          + +
Sbjct: 70  AVFIT--AQQIIIGVAMGFVSQMVMQTFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+PI  +      + S        F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRSLAEWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  ++  F   +   
Sbjct: 188 ISAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHFDEVWAAA 247


>gi|254491753|ref|ZP_05104932.1| flagellar biosynthetic protein FliR [Methylophaga thiooxidans
           DMS010]
 gi|224463231|gb|EEF79501.1| flagellar biosynthetic protein FliR [Methylophaga thiooxydans
           DMS010]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 105/241 (43%), Gaps = 1/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            I+ +      R+ + +M+ P  S ++I  + R+  A+A SIV++P +   +   + ++ 
Sbjct: 10  GILGAYLWPFFRIAAMVMVAPIFSSNFISQRSRILMAVAISIVIVPNIPVQVPQVDALS- 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    ++  ++ +G   G ++++        G +I+  +GL   + +   + +    ++ 
Sbjct: 69  AEGLLIIAHQILIGACMGFMLQLLFNAFIVAGQIIAMQMGLGFASMVDPQNGVMVPVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +   L    I+ H  +   + +S+ T+PI         F   V      +   + ++
Sbjct: 129 FYLVFITLIFVSINGHLILIQVMSESFVTLPIAATGLSPVDFRDIVAQASWMYAAGVIIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N++ G+L++  PQI  + I  P  I LG + + +++  +     +   Y 
Sbjct: 189 LPAIGSLMMVNLAFGILSRAAPQISPFSIGFPMTIILGFVVMLITLPNVAGHLVNMSDYM 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|319787088|ref|YP_004146563.1| flagellar biosynthetic protein FliR [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465600|gb|ADV27332.1| flagellar biosynthetic protein FliR [Pseudoxanthomonas suwonensis
           11-1]
          Length = 264

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 94/242 (38%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +M +P +    +P+++R+  A A ++ L P L    +       
Sbjct: 16  GMIGTVMWTMLRTGALLMAMPLIGTRAVPLRLRVLVAGALAMALAPMLPKPPEFAGLDAA 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                 V  EL +G   G  +R+      + G +IS  +GL+           +   +  
Sbjct: 76  TVLG--VARELAVGVTMGFCLRLVFEAGAYAGELISHGMGLSFAQMNDPLRGTSSGVVAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRL 185
              I   L  +  D H  V   LV+SY  +PIG   ++     ++ V +        L L
Sbjct: 134 WFYIAFGLLFFTSDGHLAVITMLVRSYQALPIGAAWVDAAAGLATPVELFSAVLRGGLGL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G+L K  P +    +  P  +  G L L +    I       F  
Sbjct: 194 ALPLMVAMLATNLTFGVLAKAAPSLHPVQLGLPVAVLTGLLLLSVLAGEIARPVQALFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|296157444|ref|ZP_06840279.1| flagellar biosynthetic protein FliR [Burkholderia sp. Ch1-1]
 gi|295892216|gb|EFG71999.1| flagellar biosynthetic protein FliR [Burkholderia sp. Ch1-1]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 107/240 (44%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P L    +P++V++  A   +I++ P L     +  F   
Sbjct: 11  AWLTAFLWPFVRILALVATAPVLGNRSLPIRVKIGLAAFVTIIVAPTLGALPQVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G+ +++    +  TG  +   +GL   T      S +   L+S
Sbjct: 71  GVWI--IVNQFLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDSQASSSSQVLSS 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +L   VID H Q+  AL+ ++ ++P+   +     + +  N   T F   L LS
Sbjct: 129 YMNTIAMLVFLVIDGHLQMISALLATFQSVPVSANILGAPGWRTLANFGSTVFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L L L    ++  F   F  G
Sbjct: 189 LPVVVALLITNLALGILNRAAPQIGVFQIGFPLTMLIGMLLLQLMTPNMIPFFMRLFDVG 248


>gi|205352325|ref|YP_002226126.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205272106|emb|CAR36959.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627375|gb|EGE33718.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 264

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAILLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|91785624|ref|YP_560830.1| flagellar biosynthesis protein FliR [Burkholderia xenovorans LB400]
 gi|91689578|gb|ABE32778.1| Flagellar biosynthesis protein FliR [Burkholderia xenovorans LB400]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 106/240 (44%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P L    +P++V++  A   +I++ P L        F   
Sbjct: 11  AWLTAFLWPFVRILALVATAPVLGNRSLPIRVKIGLAAFVTIIVAPTLGALPQFTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G+ +++    +  TG  +   +GL   T      S +   L+S
Sbjct: 71  GVWI--IVNQFLIGIALGMTMQIVFQAISATGDFVGLGMGLGFATFFDSQASSSSQVLSS 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +L   VID H Q+  AL+ ++ ++P+   +     + +  N   T F   L LS
Sbjct: 129 YMNTIAMLVFLVIDGHLQMISALLATFQSVPVSANILGAPGWRTLANFGGTVFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  I +G L L L    ++  F   F  G
Sbjct: 189 LPVVVALLITNLALGILNRAAPQIGVFQIGFPLTILIGMLLLQLMTPNMIPFFMRLFDVG 248


>gi|462612|sp|P34202|FLIR_PECCC RecName: Full=Flagellar biosynthetic protein fliR; AltName:
           Full=Flagellar biosynthetic protein mopE
 gi|397347|emb|CAA51478.1| mopE [Pectobacterium carotovorum]
          Length = 261

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 100/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P  +   I  +V++   +  ++++ P+L         V   
Sbjct: 12  WVSQFFWPFVRILALISTAPVFNERAIGNRVKIGLGVLITLLVAPYLPLNTTPIFSVAG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   GL +++    ++  G +I   +GL   T    +       +   
Sbjct: 71  --VWLLIQQILIGVTLGLSMQLAFAAIRHAGELIGLQMGLAFATFFDPTGGPNMQVVARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI       + F +        F+  L L+ 
Sbjct: 129 LNILAILLFLTFDGHLWMISLLADSFYTLPISANPIISHAFLALARAGGLIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ I+ +  P  + +G + L L + +I     H F   F
Sbjct: 189 PIITLLLTINLALGMLNRVAPQLSIFVVGFPITLTVGIMTLGLLLPLIPPFAEHLFSEVF 248


>gi|198244152|ref|YP_002215105.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197938668|gb|ACH76001.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
          Length = 264

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLTMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|261855326|ref|YP_003262609.1| flagellar biosynthetic protein FliR [Halothiobacillus neapolitanus
           c2]
 gi|261835795|gb|ACX95562.1| flagellar biosynthetic protein FliR [Halothiobacillus neapolitanus
           c2]
          Length = 258

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 99/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S   ++ RV + +M++P      +P + R+  A+ FS+++ P L     +      
Sbjct: 10  GWVGSYVWVLVRVAALLMVVPIFGARGVPKRWRILAALVFSLIIAPTLPPVPTIDPLSVA 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                LV  ++ +G   G ++ +        G  ++  +GL    ++   + ++   ++ 
Sbjct: 70  G--ILLVAQQIIIGVTMGFVLGLIVSSFVVAGESMALGMGLGFAQTVDPQNGVSVPIVSQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  L    +D    +   L  S+  +PI         F   V   Q+ F+  + ++
Sbjct: 128 FLTVVATLLFISLDGPALIVKMLADSFVWLPIAPVGLSPETFWRVVGFGQSMFINAILIA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G++ +  PQ+ I+ I  P  + +G   + +S    V    H     
Sbjct: 188 LPVIISLLMVNLAMGVITRAAPQLNIFSIGFPATLLIGFFLILVSSPTWVPILEHFLQQT 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|74055046|gb|AAZ95851.1| FliR [Aeromonas hydrophila]
          Length = 274

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 93/239 (38%), Gaps = 2/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S+   + RV   +M++        P ++R+  A+A + ++ P L     ++ F   
Sbjct: 19  EWLSSILWPLARVSGLLMVMAVFGSRLTPARIRIGLALALTFMIAPLLPPMPKIELFSIG 78

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           ++       +L +G   GL+ +         G VI+    L   T +   +  +   +  
Sbjct: 79  SFLVL--AQQLLIGIALGLMTQFLMESFVMAGQVIAMQTSLGFATLVDPMNGQSAPVVGQ 136

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   +V S+ ++P+           S V  L   +   L ++
Sbjct: 137 FYLMLATLVFLAVDGHLIMLRMVVLSFDSLPVSDAGLTLPAIRSLVGFLGVMYQASLVMA 196

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
              +   ++ N + G++ +  PQ+ I+ I     +  G L L L+I   +  F   +  
Sbjct: 197 LSAIIALLLINFAFGVMTRAAPQLNIFSIGFAVSMMSGLLILWLTIGGFLGHFDSMWER 255


>gi|16765319|ref|NP_460934.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56413106|ref|YP_150181.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62180556|ref|YP_216973.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161613450|ref|YP_001587415.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167993556|ref|ZP_02574650.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234154|ref|ZP_02659212.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168239221|ref|ZP_02664279.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168244832|ref|ZP_02669764.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259732|ref|ZP_02681705.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462477|ref|ZP_02696408.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168823024|ref|ZP_02835024.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194444159|ref|YP_002041246.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194449212|ref|YP_002046032.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472341|ref|ZP_03078325.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736717|ref|YP_002115015.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197265429|ref|ZP_03165503.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197362032|ref|YP_002141669.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207856506|ref|YP_002243157.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224583520|ref|YP_002637318.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912446|ref|ZP_04656283.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|20141401|sp|P54702|FLIR_SALTY RecName: Full=Flagellar biosynthetic protein fliR
 gi|16420516|gb|AAL20893.1| putative flagellar biosynthetic protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56127363|gb|AAV76869.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62128189|gb|AAX65892.1| putative flagellar biosynthetic protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161362814|gb|ABX66582.1| hypothetical protein SPAB_01167 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402822|gb|ACF63044.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194407516|gb|ACF67735.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194458705|gb|EDX47544.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194712219|gb|ACF91440.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634515|gb|EDX52867.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197093509|emb|CAR58970.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197243684|gb|EDY26304.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288058|gb|EDY27445.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|205328394|gb|EDZ15158.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331896|gb|EDZ18660.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205336365|gb|EDZ23129.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340657|gb|EDZ27421.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205350805|gb|EDZ37436.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708309|emb|CAR32612.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224468047|gb|ACN45877.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247147|emb|CBG24970.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993970|gb|ACY88855.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158495|emb|CBW18005.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912971|dbj|BAJ36945.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321224626|gb|EFX49689.1| Flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616974|gb|EFY13882.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618213|gb|EFY15105.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625884|gb|EFY22703.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626336|gb|EFY23146.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632751|gb|EFY29496.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639093|gb|EFY35786.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640409|gb|EFY37065.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647230|gb|EFY43729.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649885|gb|EFY46307.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655530|gb|EFY51838.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660308|gb|EFY56546.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662989|gb|EFY59196.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668174|gb|EFY64333.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674067|gb|EFY70161.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675581|gb|EFY71655.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683008|gb|EFY79024.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686702|gb|EFY82680.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322715032|gb|EFZ06603.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323130260|gb|ADX17690.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195410|gb|EFZ80590.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198062|gb|EFZ83179.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204466|gb|EFZ89472.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207556|gb|EFZ92504.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211005|gb|EFZ95865.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217541|gb|EGA02260.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220726|gb|EGA05170.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226687|gb|EGA10884.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231563|gb|EGA15676.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323236006|gb|EGA20085.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240576|gb|EGA24619.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245468|gb|EGA29468.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247586|gb|EGA31537.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253951|gb|EGA37775.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255521|gb|EGA39282.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262119|gb|EGA45682.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266242|gb|EGA49732.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270649|gb|EGA54090.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|332988870|gb|AEF07853.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 264

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|312884899|ref|ZP_07744589.1| flagellar biosynthesis protein FliR [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367376|gb|EFP94938.1| flagellar biosynthesis protein FliR [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 93/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + S F    R+G+ +M++      ++  +VRL   +A +  ++P +         ++ A
Sbjct: 11  WIASYFWPYTRIGAMLMVMSVTGARFVSTRVRLYLGLAITFAVMPVIPAAPQNIELLSFA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   V+ ++ +G   G + +         G ++     L   + +  ++      L  L
Sbjct: 71  GFIT-VLEQILIGVAMGTVTQFLIQTFVILGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ ++P+G        F      L   F   L +S 
Sbjct: 130 FMFLATMFFLATDGHLKMITFVVMSFQSLPVGVGALTNVDFRELALWLGIMFQFALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     I  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLICWYLIAGLYNHYDLLWHEG 248


>gi|229591838|ref|YP_002873957.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens SBW25]
 gi|229363704|emb|CAY51086.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens SBW25]
          Length = 258

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 108/242 (44%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + R+ + +M +P    + +P ++RL FA+A ++VL+P L     +     
Sbjct: 10  STWVASFILPLFRITAMLMAMPVFGTTLVPRRIRLYFAVAITVVLVPGLPPMPPVNALDL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G + G  ++++       G +IS  +G+   + +  ++ ++   + 
Sbjct: 70  SA--LMLIAEQVLIGTLLGFSLQLFFQAFVIAGQIISIQMGMGFASMVDPTNGVSAAVIG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    ++ H   F  L +S+ T+P+G  L   N F   V  L       L L
Sbjct: 128 QFLTMLVTLLFLAMNGHLVAFEVLTESFTTLPVGSGLVV-NHFWEVVGRLGWVLGASLLL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG     + +  I+ Q+      
Sbjct: 187 VLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMGIFWVGLADILNQYQPLATD 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|197250835|ref|YP_002146042.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|200389554|ref|ZP_03216165.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|197214538|gb|ACH51935.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|199601999|gb|EDZ00545.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 264

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + R+ + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRILALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|162138518|ref|YP_487378.2| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           HaA2]
          Length = 255

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 70/234 (29%), Positives = 122/234 (52%), Gaps = 1/234 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  RVG+ +MLLP L  S IP +++L  A+  ++++LP   +   +    +    
Sbjct: 13  AAFMLVFARVGAMVMLLPTLGESNIPTRIKLSIALGLTLIILPLHRNAYQVD-MSSLTPL 71

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             L++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + + 
Sbjct: 72  LVLMIQEIIIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFLT 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           I+G+  L+  D HH V  AL  SY     G+ LN G++ +        +F I ++L++PF
Sbjct: 132 ILGVTMLFATDSHHLVIEALSDSYKIFAPGELLNSGDVAALATKAFAASFKIGMQLAAPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           L F +VFNI +G+L +L+PQ+ +YF+  P  I +G +     +  ++  F   F
Sbjct: 192 LVFGLVFNIGLGILARLMPQMQVYFVGVPLSIMIGFVIFAAVLTTMMGTFLAYF 245


>gi|255099431|ref|ZP_05328408.1| bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium
           difficile QCD-63q42]
          Length = 516

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 69/145 (47%), Gaps = 1/145 (0%)

Query: 101 ISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ 160
           +   +GL++      +     T +++L+    L+  + +D HH +   +  S+  IPIG+
Sbjct: 1   MDQQMGLSMINMFDPNSMTQTTLIDNLMNWTALMIFFNMDGHHVLIRGIRYSFELIPIGK 60

Query: 161 ELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYL 220
                NI    +N+    F+   +++ P +   ++ +  +GL+++ VPQ+ +  +  P  
Sbjct: 61  PFVDNNI-DYIINIFVQCFLTGFKIAIPIVLCLLMADFILGLISRSVPQLNVMIVGMPLK 119

Query: 221 IGLGSLFLCLSIEIIVYQFSHSFLY 245
           I +G     +SI +IV Q SH    
Sbjct: 120 ILVGIALFIISIPLIVNQISHLLSQ 144


>gi|86146124|ref|ZP_01064450.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218708835|ref|YP_002416456.1| flagellar biosynthesis protein FliR [Vibrio splendidus LGP32]
 gi|85836071|gb|EAQ54203.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218321854|emb|CAV17831.1| Flagellar biosynthetic protein fliR [Vibrio splendidus LGP32]
          Length = 260

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 91/240 (37%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + F    R+ + +M++      ++  ++RL   +A +  ++P +         ++ 
Sbjct: 10  EWLANYFWPYTRISAMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPKEIELLSF 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V  ++ +G   G + +         G ++     L   + +  ++      L  
Sbjct: 70  QGFLT-VFEQIVIGVAMGFVTQFMIQTFVMLGQILGMQSSLGFASMVDPANGQNTPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  ++  +     D H ++   +V S+ T+PIG        +      L   F   L +S
Sbjct: 129 LFMLLATMFFLETDGHLKMLQLVVFSFKTLPIGSGSLTSVDYRELALWLGIMFKTALAMS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   ++  
Sbjct: 189 LSGIIALLTINLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYILGGLFSHYELFWIQT 248


>gi|160896099|ref|YP_001561681.1| flagellar biosynthetic protein FliR [Delftia acidovorans SPH-1]
 gi|160361683|gb|ABX33296.1| flagellar biosynthetic protein FliR [Delftia acidovorans SPH-1]
          Length = 256

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +   + P  S   IPM++++  A   ++   P L D   +     +
Sbjct: 11  AWLSPVLWPFLRVLAMFSVAPVFSQRVIPMRLKIGLAFLVAVCAQPVLGDQPVIGINSPQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     ++ ++ +G   G  +R+    ++  G V+   +GLN  +    + +   + +  
Sbjct: 71  A--LGTLIQQVGVGLAVGFAVRLVFAAVEVAGEVVGLQMGLNFASFFDPTTNAQLSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I  L   VI+ H  V  A++KSY   P+               M    F     ++
Sbjct: 129 FMVQISTLLFIVINGHLLVLMAVLKSYEAFPVDGSFLQAINQMRLHEMGAAVFASAFWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +G+++++ PQ+ IY +  P  + +G   L  ++ ++          G
Sbjct: 189 LPMVAMLLFVNLVLGIISRVAPQMNIYAVGFPVTLTVGLTGLMATLPLLEQPLVALLQRG 248


>gi|302343744|ref|YP_003808273.1| flagellar biosynthetic protein FliR [Desulfarculus baarsii DSM
           2075]
 gi|301640357|gb|ADK85679.1| flagellar biosynthetic protein FliR [Desulfarculus baarsii DSM
           2075]
          Length = 258

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 103/236 (43%), Gaps = 1/236 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           M   LI+ R  + + LLP    + IP  V+   +MA ++ L P +     L        +
Sbjct: 12  MHFLLILTRCSALVALLPFFGSANIPDTVKAGLSMALAVFLHPIVKIDPAL-FPTGLDSF 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             L   EL +G + G  +R+    +Q  G +    +G ++   +        + +     
Sbjct: 71  LILAFGELMIGAILGFAVRLLFSAVQIMGHLAGFQMGFSVANVLDPMGGEQVSVIGQFCY 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           +I +L  + +  HH  F A  +S+  +P GQ      +F     M    F + L+L +P 
Sbjct: 131 VIAILVFFAVGGHHWFFSAAAESFAIVPPGQFAFSRILFDQLTTMTADMFELALKLGAPV 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           +   +  ++++G+L K VPQ+ I  +  P  IG+G  FL L++  ++     SF  
Sbjct: 191 IGVLLAADVAMGVLAKTVPQMNILIVGMPLKIGVGLFFLALTMGFMIVTMGASFRD 246


>gi|212637761|ref|YP_002314286.1| flagellar biosynthesis protein FliR [Shewanella piezotolerans WP3]
 gi|212559245|gb|ACJ31699.1| Flagellar biosynthesis protein FliR [Shewanella piezotolerans WP3]
          Length = 259

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + + +   CR+    M++P L  SY+P+ VR+  A++ S+++ P L    ++     
Sbjct: 10  STFIATFWWPFCRIMGAFMVMPFLGSSYVPVMVRILLAISISVLIAPILPPFPEVDAISL 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
           +A +  +   +L +G +  L + +    +   G+++S  +GL +      ++  +   L 
Sbjct: 70  QALFLGI--EQLLVGFMLALFLTIMIHVMSLVGAMMSMQMGLAMAIMNDPANGGSNPILG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               + G L    +D H      LV S+   PIG  +    +    +  +   F     L
Sbjct: 128 QWFLLYGTLLFLALDGHLVALGILVDSFRLWPIGMGVFDLPLM-GLIGRISWIFAASFML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   ++ N++ G+L++  P + ++ +  P  + +G L +  S   +  ++S   L 
Sbjct: 187 ALPAVLAMLMVNVTFGVLSRAAPSLNVFALGFPMSMLMGLLCVFFSFSGLPSRYSDLCLD 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|75675329|ref|YP_317750.1| flagellar biosynthesis protein FliR [Nitrobacter winogradskyi
           Nb-255]
 gi|74420199|gb|ABA04398.1| Flagellar biosynthesis protein FliR [Nitrobacter winogradskyi
           Nb-255]
          Length = 256

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 68/235 (28%), Positives = 120/235 (51%), Gaps = 1/235 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  RVG+ +MLLPG    YIP++V+L  A+  + ++LP       +    + A  
Sbjct: 13  AAFMLVFARVGAMVMLLPGFGEGYIPVRVKLAIALLLTFIILPLHRAAYHVD-MQSVAPL 71

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           + L++ E+ +G V G   RV    L   GSVI+  +GL   TS+  +       + + + 
Sbjct: 72  AVLLVHEIIIGVVLGATARVTLAALHVAGSVIAQQLGLGFVTSVDPTQGQQGALMGNFLT 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++G+  L+  D H+ V  AL  SY     G+ +  G++ +         F I L+LS+PF
Sbjct: 132 LLGIALLFATDTHYLVIAALNDSYKIFSPGELMPSGDVAALATRAFAGAFKIGLQLSAPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           L F +VFNI +G+L +L+PQ+ +YF+  P  I +G +     +  ++  +    +
Sbjct: 192 LVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIFIGFMIFAAVLASMMGTYMDYLI 246


>gi|332305671|ref|YP_004433522.1| flagellar biosynthetic protein FliR [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173000|gb|AEE22254.1| flagellar biosynthetic protein FliR [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 259

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M  + L   R+   +  + GLS   +P  VR    +  ++++LP +      + F   
Sbjct: 10  QFMGDMLLPFMRISGMLATMVGLSAKTVPTTVRALLTLFITLIILPVIPPVQVDEVFSVG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +   LV+ +L +G   G +  +        G V++   GL   + +   + +    +  
Sbjct: 70  TFM--LVIQQLIIGISLGFISTMVLNTFVLAGQVVAMQTGLGFASIVDPVNGINVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  W +D H  +   +V S+   P+G+       F    +     F+  + LS
Sbjct: 128 FYLILATLLFWALDGHLAMIRMVVMSFTAFPVGEAWLQPEQFREIAHWAGWMFISAVTLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N++ G++ K  PQ+ I+ +       +G + + ++++   Y F   +   
Sbjct: 188 LAPIVSLLIVNLAFGVMTKAAPQLNIFSLGFSIAQIMGLVIIWITMDNFTYHFEVQWDRA 247


>gi|148266207|ref|YP_001232913.1| flagellar biosynthetic protein FliR [Geobacter uraniireducens Rf4]
 gi|146399707|gb|ABQ28340.1| flagellar biosynthetic protein FliR [Geobacter uraniireducens Rf4]
          Length = 261

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/235 (21%), Positives = 110/235 (46%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L+V R+      +P      +P++V+    M  +++L P +   I      +   
Sbjct: 13  LTLFSLVVGRMAGLFAAIPLFGSKSVPVRVKAAVIMVMALLLYPVIRTQIP-PLPSDSIS 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            S LV+ E  +G   G++ +     ++F G ++   +G+++ +    +       +  L 
Sbjct: 72  LSLLVVRETLIGLTIGIISQAIFAAVEFCGQIVGMQMGISMASLFDPNTQANVPTVALLQ 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           GI+ +L    +  HH    A+V+SY  IP+G     G +    +      F++ ++LS+P
Sbjct: 132 GILAMLLFLSLGVHHIFIRAIVESYRVIPVGAWHMSGGLMQFIITTTGAIFILAIKLSAP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   +  ++++G++ +  PQ+ I+ +S P  IG+G L L LS+   +    ++F
Sbjct: 192 IMVALLATSVALGIMARSFPQMNIFMVSMPLNIGIGFLALGLSLLTFLRTLENAF 246


>gi|145297439|ref|YP_001140280.1| lateral flagellar biosynthetic protein LfiR [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850211|gb|ABO88532.1| lateral flagellar biosynthetic protein LfiR [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 260

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 103/236 (43%), Gaps = 3/236 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +    R+ +   ++P      IP QVRL FA   S+++ P L +   +  F   
Sbjct: 14  AWLGQWWWPFIRIATAFWVMPVFGDGRIPPQVRLLFAFIISLLIAPMLKEMPVVDPFSTG 73

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L + +L  G + GL +++  + +   G ++S  +GL +      S+  +   ++ 
Sbjct: 74  A--LVLTVEQLLFGLLFGLCVQMLFMIMTMAGQILSMQMGLAMAVMNDPSNGDSAPIVSQ 131

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ I   L    ++ H      LV+S  + P G  L+  +     + +        L L+
Sbjct: 132 LMLIFCSLLFLGLNGHLVTLDVLVQSLRSWPPGSSLDLLD-MKGVIGLFGWCIGAALILT 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P +   ++ N++ G++N+  P + I+ +  P  + LG + + +SI  +  ++   
Sbjct: 191 LPAVVAMLMVNLTFGVMNRTAPSLNIFSLGFPMTLLLGLVTMAISISGVPARYLDL 246


>gi|15615003|ref|NP_243306.1| flagellar biosynthesis protein FliR [Bacillus halodurans C-125]
 gi|10175060|dbj|BAB06159.1| flagellar protein required for flagellar formation [Bacillus
           halodurans C-125]
          Length = 258

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 103/244 (42%), Gaps = 7/244 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++    L+  R+ + +M +P  S   IP   ++  A+  + +L   L   I     +  
Sbjct: 6   QLLPMFLLVFVRMLAFLMTMPLFSYRNIPAMFKVGIALFLAWILTFSLEPEI----ILFD 61

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             Y  L+M E+ +G + GL+  V    +Q  G+ I   IG  +   +          + S
Sbjct: 62  GTYVILIMKEVLVGLMVGLIAMVLLYAIQAAGAFIDVKIGFLIANIVDPQTGAQSPLIGS 121

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIML 183
            +    LL +   + HH +   +  SY  IP+ Q        N+       L T F+I  
Sbjct: 122 YLYTFALLFMLATNGHHLLIDGMYYSYQFIPLNQPFLNVSDENMIELIATTLNTMFIIAF 181

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +++ P +    + ++++G++++ VPQ+ ++ +  P  I +G   L + + +     S+ F
Sbjct: 182 QMAFPLVGSLFLVDVALGMVSRAVPQMNVFVVGMPLKILVGLPLLMIFMGVFFMSVSYLF 241

Query: 244 LYGF 247
               
Sbjct: 242 ERML 245


>gi|330445378|ref|ZP_08309030.1| flagellar biosynthetic protein FliR [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489569|dbj|GAA03527.1| flagellar biosynthetic protein FliR [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 260

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 93/240 (38%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M +      ++  ++RL  A+A +  ++PFL         ++ A
Sbjct: 11  WLANYFWPFTRISSMMMAMTFFGARFVSPKIRLYLALAITFAVMPFLPKVPQDIELLSLA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +       +      GL+ +  T      G ++     L   + +  ++      L   
Sbjct: 71  GFIITGQQIIIG-VAMGLVTQFVTQTFVLLGQILGMQSSLGFASMVDPANGQNTPVLGQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + +L     D H ++  A+V S+ T+P+G  +     +          F   L ++ 
Sbjct: 130 YMFLAILLFLATDGHLEMLNAVVLSFKTLPVGTAMLGQQDYYELAGWFGHMFKAGLNMAL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +   +  N+S G++ +  PQ+ I+ +   + + LG       +  IV Q+   +  GF
Sbjct: 190 AGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLLGLAISWFIVLGIVPQYEALWQVGF 249


>gi|83747849|ref|ZP_00944882.1| HrcT [Ralstonia solanacearum UW551]
 gi|207724593|ref|YP_002254990.1| hrp protein hrct [Ralstonia solanacearum MolK2]
 gi|207739228|ref|YP_002257621.1| hrp protein hrct [Ralstonia solanacearum IPO1609]
 gi|83725496|gb|EAP72641.1| HrcT [Ralstonia solanacearum UW551]
 gi|206589815|emb|CAQ36776.1| hrp conserved protein hrct [Ralstonia solanacearum MolK2]
 gi|206592601|emb|CAQ59507.1| hrp conserved protein hrct [Ralstonia solanacearum IPO1609]
          Length = 282

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/232 (15%), Positives = 83/232 (35%), Gaps = 4/232 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R       +I++       + L   +N A    L   E
Sbjct: 30  VRIMTLFAILPATNDQMLTGIARNGVVYTLAILVA--AGQPVGLAEHLNVAQLFILTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  + +   
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTLIDNVSGYNNVQMTNPLRGDQNTPIGNTLVNLAVTLF 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   N  +    +    + F   ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFKWWPLGASLPDMNAVAQSFLLQQTDSIFSTAVKLAAPVMMTLL 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           + +  IGLL++   ++    +S P    +  L +   +  +  Q   +  Y 
Sbjct: 208 LIDAGIGLLSRAADKLEPASLSQPIKGAVALLMVMALVTALSTQVKGTLTYA 259


>gi|312962261|ref|ZP_07776753.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens WH6]
 gi|311283598|gb|EFQ62187.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens WH6]
          Length = 261

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 107/242 (44%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + RV + +M +P    + +P ++RL FA+A ++V++P L     +     
Sbjct: 13  STWVASFILPLFRVTAMLMAMPVFGTTLVPRRIRLYFAVAITVVIVPGLPPMPAVNALDL 72

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L+  ++ +G + G  + ++       G +IS  +G+   + +  ++ ++   + 
Sbjct: 73  SA--LMLIAEQVLIGAMLGFSLSLFFQAFVIAGQIISIQMGMGFASMVDPTNGVSAAVIG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++  L    ++ H   F  L +S+ T+P+G  L   N F   V  L       L L
Sbjct: 131 QFLTMLVTLLFLAMNGHLVAFEVLTESFTTLPVGSGLVV-NHFWEVVGRLGWVLGASLLL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG     + +  I+ Q+      
Sbjct: 190 VLPAITALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMWIFWVGMADILNQYQPLATD 249

Query: 246 GF 247
             
Sbjct: 250 AL 251


>gi|283832655|ref|ZP_06352396.1| flagellar biosynthetic protein FliR [Citrobacter youngae ATCC
           29220]
 gi|291072329|gb|EFE10438.1| flagellar biosynthetic protein FliR [Citrobacter youngae ATCC
           29220]
          Length = 261

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 99/241 (41%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ + I   P LS   IP +V+L   +  +IV+ P +         +  
Sbjct: 11  QWLNLYFWPLLRILALISTAPILSERAIPKRVKLGLGVIITIVIAPSIP---PADVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                  M ++ +G   G  ++     ++  G +I   +GL+  T       L    L  
Sbjct: 68  IGALWQAMQQILIGIALGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           LI ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+
Sbjct: 128 LIDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGGNPVNSNAFLALARAGSLIFINGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I       F   
Sbjct: 188 LPVMTLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCERLFSEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|324114207|gb|EGC08180.1| flagellar biosynthetic protein FliR [Escherichia fergusonii B253]
 gi|325497692|gb|EGC95551.1| flagellar biosynthesis protein FliR [Escherichia fergusonii ECD227]
          Length = 262

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   +P + +L   +  ++ + P L         +  
Sbjct: 11  QWLSLGFWPLLRVLALISTAPILSERSVPKRAKLGLGLMITLAIAPMLPPH---DVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  
Sbjct: 68  YAAVWVAIQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+
Sbjct: 128 ILDMLVLLLFLTFNGHLWLISILVDTFHTLPIGGEPLNSNAFLALTRAGGLIFLNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G   +   + +I     H F   
Sbjct: 188 LPVITLLLTLNLALGLLNRMAPQLSVFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEV 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|296330852|ref|ZP_06873327.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674370|ref|YP_003866042.1| flagellar export machinery protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151857|gb|EFG92731.1| flagellar biosynthesis protein FliR [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412614|gb|ADM37733.1| component of the flagellar export machinery [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 259

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 94/239 (39%), Gaps = 6/239 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+ +  + +P      +P   R+ FA   +++    +     L+      
Sbjct: 7   LFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTIDKPPSLEI---DG 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  L   E  +G   GL+  +    +Q  GS I   +G ++   +          +   
Sbjct: 64  QYMLLTFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVIDPQTGAQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN---IFSSFVNMLQTTFMIMLR 184
           I  + LL +  ++ HH +   +  S+  I + Q                     F+I  +
Sbjct: 124 IYTMALLFMLSVNAHHLLLDGIFYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + ++     + F
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAISFIMLIVCMSVMFVVVRNVF 242


>gi|254251036|ref|ZP_04944354.1| Flagellar biosynthesis pathway component FliR [Burkholderia dolosa
           AUO158]
 gi|124893645|gb|EAY67525.1| Flagellar biosynthesis pathway component FliR [Burkholderia dolosa
           AUO158]
          Length = 260

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 107/241 (44%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P +  + +P + ++  A   ++++ P L     +  F   
Sbjct: 11  GWLTAFLWPFVRMLALVATAPVVGHASVPARAKIGVAAFMALIVAPTLGAMPGVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+++  +G   G  +++    ++  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWI--VVMQFLIGAAMGFTMQIVFAAVEAAGDYIGLSMGLGFATFFDPHSSGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA   +D H QVF AL  S+ T+P+   L     + +      T F + L L+
Sbjct: 129 FLNAVAMLAFLAVDGHLQVFAALAASFQTLPVSAALLHAPGWRTLAAFGATVFEMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P  + +G L + L +  +V   SH F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVTMLVGLLLVQLMVPNLVPFVSHLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|312135836|ref|YP_004003174.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           owensensis OL]
 gi|311775887|gb|ADQ05374.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           owensensis OL]
          Length = 260

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/224 (22%), Positives = 98/224 (43%), Gaps = 2/224 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    +  P      IP   ++ FA   S+++      T  + +  N   Y  
Sbjct: 15  FFLVLARMSGLFIASPIFGRRNIPAYFKVGFAFFLSMIVFTAYNFTYSIPD--NVVEYVF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + + 
Sbjct: 73  VVIKEFIIGLLIGYISYMIFSAILLAGQIIDNAIGFGMANVVDPMSEVQVPLLGNFLYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A+  SY  +PIG          SF+      F+I + LS P L 
Sbjct: 133 MLVVFFGTDAHHLLIRAIFYSYKLVPIGYGGFKTEFAWSFLRFFSELFLIGVELSLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L + +  +
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPVKIAIGFLVLVIILPFM 236


>gi|237731998|ref|ZP_04562479.1| flagellar biosynthesis protein FliR [Citrobacter sp. 30_2]
 gi|226907537|gb|EEH93455.1| flagellar biosynthesis protein FliR [Citrobacter sp. 30_2]
          Length = 261

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 100/241 (41%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   IP +V+L   +  ++V+ P +     +   +  
Sbjct: 11  HWLNLYFWPLLRVLALISTAPILSERAIPKRVKLGLGLMITVVIAPSIPA---VDVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                  M ++ +G   G  ++     ++  G +I   +GL+  T       L    L  
Sbjct: 68  VGALWQAMQQILIGIALGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           LI ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+
Sbjct: 128 LIDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGGNPVNSNAFLALARAGSLIFLNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G   +   + +I       F   
Sbjct: 188 LPVMTLLLTLNLALGLLNRMAPQLSVFVIGFPLTLTVGISLMAALMPLIAPFCERLFSEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|322833208|ref|YP_004213235.1| flagellar biosynthetic protein FliR [Rahnella sp. Y9602]
 gi|321168409|gb|ADW74108.1| flagellar biosynthetic protein FliR [Rahnella sp. Y9602]
          Length = 261

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 100/241 (41%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ + I   P  S   +P +V+L   M  + ++ P L     +   +  
Sbjct: 11  GWLSMYFWPLLRILALISTAPITSEKSVPNRVKLGLGMMITFLIAPSLP---PVDTPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L M ++ +G   G+ +++    ++  G ++   +G++  T    S+ L    L  
Sbjct: 68  TPALWLAMQQIMIGTALGITMQLAFAAIRMAGEIMGLQMGISFATFYDPSNRLNTPLLAQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L     + H  +   L  S+ T+PI         F +        F   + L+
Sbjct: 128 FLNLLAVLLFLSFNAHLWLISLLADSFHTLPISHNPVNAEGFMAVAKAGSIVFSGGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G L + L + ++     H F   
Sbjct: 188 LPIVTLLLTLNMALGLLNRVTPQLSVFVIGFPLTLSIGILAISLMMPMLAPFSEHLFSEI 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|145298358|ref|YP_001141199.1| flagellar biosynthesis protein FliR [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851130|gb|ABO89451.1| flagellar biosynthetic protein FliR [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 265

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 92/239 (38%), Gaps = 2/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S+   + RV   +M++        P ++R+  A+A + ++ P L     ++ F   
Sbjct: 10  EWLSSILWPLARVSGLLMVMAVFGSRLTPARIRIGLALALTFMIAPLLPPMPKVELFSVG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           ++       +L +G   GL+ +         G VI+    L   T +   +  +   +  
Sbjct: 70  SFLVLT--QQLLIGIALGLMTQFLMESFVMAGQVIAMQTSLGFATLVDPMNGQSAPVVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   +V S+ T+P+           S V  L   +   L ++
Sbjct: 128 FYLMLATLVFLAVDGHLIMLRMVVLSFETLPVSDAGLTLPAIRSLVGFLGIMYQASLVMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
              +   ++ N + G++ +  PQ+ I+ I     +  G   L L+I   +  F   +  
Sbjct: 188 LSAIVALLLINFAFGVMTRAAPQLNIFSIGFAVSMMSGLFILWLTIGGFLGHFDSMWER 246


>gi|312126837|ref|YP_003991711.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776856|gb|ADQ06342.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 260

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 99/233 (42%), Gaps = 2/233 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    +  P      IP   ++ FA   S++++     +  +    N   Y  
Sbjct: 15  FFLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSLLVVTTYRFSYSVP--ANLLEYIF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + + 
Sbjct: 73  AVIKEFIVGLLVGYISYMIFSAILLAGQIIDNAIGFGMANVIDPMSEIQVPLLGNFLYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A+V SY  +PIG E        SF+      F+I + +S P L 
Sbjct: 133 MLVVFFGTDAHHLLIRAVVYSYKLVPIGHESFRSEFTWSFLRFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L + +  +         
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVIILPFMNKMIFVLID 245


>gi|193071154|ref|ZP_03052078.1| flagellar biosynthetic protein FliR [Escherichia coli E110019]
 gi|192955549|gb|EDV86028.1| flagellar biosynthetic protein FliR [Escherichia coli E110019]
          Length = 261

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FTLWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTQNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|148976241|ref|ZP_01812965.1| putative flagellar biosynthetic protein FliR [Vibrionales bacterium
           SWAT-3]
 gi|145964335|gb|EDK29590.1| putative flagellar biosynthetic protein FliR [Vibrionales bacterium
           SWAT-3]
          Length = 260

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 95/239 (39%), Gaps = 3/239 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L+    R     ++ P      IP++V+L FA  FS++L P + +      F   
Sbjct: 11  QWLGVLWWPFVRFTGLFLIAPFFGDKAIPVRVKLLFAFIFSLLLAPMVKEVPPFNPFSID 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                    +L  G + G  + ++       G  IS  +GL +      ++ ++   +  
Sbjct: 71  TLLFS--FYQLIFGFLIGFAVMIFFTIFSIAGQAISMQMGLAMAVMNDPANGVSIAIIGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ I  +L    +D H  V     +S+   P+     F N     + M+   F   L ++
Sbjct: 129 IMFITSMLLFLSLDGHLVVLLVFKESFEYWPLNSPFPF-NSIEYVLKMVSWMFATGLLVA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   ++ NI+ GL+NK  P + ++ +  P  + LG   L  S+  I   +    L 
Sbjct: 188 VPAIVVMLLSNITFGLMNKAAPSLNVFALGFPMTMLLGLFALMASLTGIGDHYFDLVLE 246


>gi|260598459|ref|YP_003211030.1| flagellar biosynthesis protein FliR [Cronobacter turicensis z3032]
 gi|260217636|emb|CBA31937.1| Flagellar biosynthetic protein fliR [Cronobacter turicensis z3032]
          Length = 262

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 103/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + RV + I   P LS   I ++V++  A+  +I L P +  +      +  
Sbjct: 11  HWLTLYFWPLLRVLALISTAPILSERAISIRVKIGLALLITIALAPNIPGS---NVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L + ++ +G   G  ++     ++  G +I   +GL+  T       L    L  
Sbjct: 68  LEGLWLGLQQMLIGVAIGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I ++ +L    ++ H  +   L  ++ T+PIG +    N F +        F+  + ++
Sbjct: 128 FIDMLAMLLFLTVNGHLWLISILADTFYTLPIGGDAINSNAFMALARAGGLIFVNGVMMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G + L   + +I     H F   
Sbjct: 188 LPMITLLLSLNLALGLLNRMAPQLTVFAIGFPLTLSIGIIVLAALMPLIAPFCEHLFAEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|16760925|ref|NP_456542.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141383|ref|NP_804725.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213025463|ref|ZP_03339910.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213163374|ref|ZP_03349084.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213417180|ref|ZP_03350324.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213424993|ref|ZP_03357743.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213612733|ref|ZP_03370559.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650741|ref|ZP_03380794.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855266|ref|ZP_03383506.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|25346403|pir||AF0753 flagellar biosynthetic protein FliR [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503222|emb|CAD05729.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137010|gb|AAO68574.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 264

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|222833216|gb|EEE71693.1| predicted protein [Populus trichocarpa]
          Length = 314

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 95/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +   + P  S   IPM++++  A   ++   P L D   +     +
Sbjct: 69  AWLSPVLWPFLRVLAMFSVAPVFSQRVIPMRLKIGLAFLVAVCAQPVLGDQPVIGINSPQ 128

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     ++ ++ +G   G  +R+    ++  G V+   +GLN  +    + +   + +  
Sbjct: 129 A--LGTLIQQVGVGLAVGFAVRLVFAAVEVAGEVVGLQMGLNFASFFDPTTNAQLSAVAR 186

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I  L   VI+ H  V  A++KSY   P+               M    F     ++
Sbjct: 187 FMVQISTLLFIVINGHLLVLMAVLKSYEAFPVDGSFLQAINQMRLHEMGAAVFASAFWIA 246

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +G+++++ PQ+ IY +  P  + +    L  ++ ++          G
Sbjct: 247 LPMVAMLLFVNLVLGIISRVAPQMNIYAVXFPVTLTVXLTGLMATLPLLEQPLVALLQRG 306


>gi|148976425|ref|ZP_01813131.1| flagellar biosynthesis protein R [Vibrionales bacterium SWAT-3]
 gi|145964248|gb|EDK29504.1| flagellar biosynthesis protein R [Vibrionales bacterium SWAT-3]
          Length = 260

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 92/240 (38%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + F    R+ + +M++      ++  ++RL   +A +  ++P +         ++ 
Sbjct: 10  EWLANYFWPYTRISAMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPKEIELLSF 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V  ++ +G   G + +         G ++     L   + +  ++      L  
Sbjct: 70  QGFLT-VFEQIVIGVAMGFVTQFMIQTFVMLGQILGMQSSLGFASMVDPANGQNTPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  ++  +     D H ++   +V S+ T+PIG        F      L   F   L +S
Sbjct: 129 LFMLLATMFFLATDGHLKMLQLVVFSFKTLPIGSGSLTSVDFRELALWLGIMFKAALAMS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   ++ G
Sbjct: 189 LSGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALLVGLLLCWYILGGLYSHYELFWMQG 248


>gi|162139929|ref|YP_339328.2| flagellar biosynthesis protein FliR [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 259

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/240 (20%), Positives = 99/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +    L + R+ S IM++ GL    +P ++++  A+  + V +P L        F   
Sbjct: 10  QWLSDFLLPLVRISSMIMVMAGLGAKNVPTRIKMGLAIVVTFVAVPMLPPATFTNLFS-- 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ ++ +G   G    +        G +++   GL   + +  S+ L+   +  
Sbjct: 68  FEMILVVIQQMLIGIAIGFASTLLLNTFVLAGQILAMQTGLGFASVVDPSNGLSVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  +V + H  +   +V S+  +PI       + +   V      F   L LS
Sbjct: 128 FYLILATLLFFVFNGHLMMIQMVVHSFEVLPIDGNWWSVDHYWDIVTWGGWMFTTALVLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              L   +V N+S G++ +  PQ+ I+ I  P+ +  G + +  ++   V QF   +L  
Sbjct: 188 LAPLTAMLVINMSFGIMTRAAPQLNIFSIGFPFTLVAGLIIIWATLGNFVSQFEFQWLKM 247


>gi|114562372|ref|YP_749885.1| flagellar biosynthesis protein FliR [Shewanella frigidimarina NCIMB
           400]
 gi|114333665|gb|ABI71047.1| flagellar biosynthetic protein FliR [Shewanella frigidimarina NCIMB
           400]
          Length = 267

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 99/241 (41%), Gaps = 2/241 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + +  L   R+ S +M++     +  P +VRL  ++A ++ + P L    +++    
Sbjct: 9   SQTIAAYLLPFFRISSMLMVMAVFGANTTPARVRLMLSVAITMAVAPILPPIENVELLAL 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            + +   +  ++ +G   G +  +       TG +I     L   + +          ++
Sbjct: 69  SSVFV--IAQQILIGVTMGFVTLMVMQTFVLTGQIIGMQTSLGFASMVDPGSGEQTPVVS 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +   ++  L    +D H  +   LV S+ TIPI  +      + +  +     F   L +
Sbjct: 127 NFFLLLATLIFLAVDGHLLMIRMLVASFETIPISNQGISIANYRALADWGSFMFGSALTM 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S   +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  I+  F   ++ 
Sbjct: 187 SISAIVALLLINLSFGVMTRASPQLNIFSIGFPVTMVSGLLILWLTLAPIMAHFDEVWMA 246

Query: 246 G 246
            
Sbjct: 247 A 247


>gi|83589640|ref|YP_429649.1| flagellar biosynthesis protein FliR [Moorella thermoacetica ATCC
           39073]
 gi|83572554|gb|ABC19106.1| flagellar biosynthetic protein FliR [Moorella thermoacetica ATCC
           39073]
          Length = 255

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 109/235 (46%), Gaps = 2/235 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R  +  +  P   +  +P  V+        + LL       D   F +   Y+ 
Sbjct: 10  FFLVLVRTTAFFVTAPFFGIRGVPTMVKAGLGFL--VALLLLPVLPADQPVFNSSWVYAL 67

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            V+ E   G   G L  +    +Q  G ++   +GL + T     ++ + T +     I+
Sbjct: 68  AVLNESLAGLALGYLASLIFSAIQMAGQLLDIHMGLAMATLFDPQNAASTTIMGQFFAIL 127

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           GLL  + +D HH +  AL +S+  +P+G     GN+  + V +   TF + L++++P + 
Sbjct: 128 GLLLFFQLDGHHTLLLALQESFRLLPLGGVHFDGNLLWAVVKLFAGTFALALQIAAPLIA 187

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             ++ ++++ L+ + VPQ+ ++ +  P  +GLG L +   + ++   FS+ F   
Sbjct: 188 VLLIADLALSLVARTVPQLNVFILGFPLKVGLGLLVMIALLPLLATVFSNIFSQM 242


>gi|89094443|ref|ZP_01167383.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
 gi|89081335|gb|EAR60567.1| flagellar biosynthesis protein [Oceanospirillum sp. MED92]
          Length = 256

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 103/241 (42%), Gaps = 2/241 (0%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
            +  E  + +    + R+GS  M +P L    +  ++RL  A+A + V+ P L +     
Sbjct: 6   ILQIEQWVAAFLWPLFRIGSFFMAVPLLGSQLVNARIRLMLALAVTAVIAPMLPEMPAFN 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                +Y    +  ++ +G + G L +V+       G +I+  +GL   +    ++ ++ 
Sbjct: 66  GLSVESYLI--IAQQVIVGAMLGFLFQVFYQVFVLGGQMIAMQMGLGFASMTDPANGISV 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             L      + ++    ++ H  +   +V+S+  +P+  +    + F          F  
Sbjct: 124 VMLGQFYLTLIMMIFVALNGHLIMIEIVVRSFEVLPVSLQAIDRDSFMKVALSGTWMFSA 183

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            + ++ P +   +V N++ G++++  PQ+ I  +  P+ + LG     +++   + Q+  
Sbjct: 184 AMLMALPAVTALLVVNMAFGIMSRAAPQLNILAVGFPFTMVLGLFINWVNLGGFLDQYMR 243

Query: 242 S 242
            
Sbjct: 244 I 244


>gi|17549093|ref|NP_522433.1| Hrp conserved HRCT transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17431344|emb|CAD18023.1| hrp conserved hrct transmembrane protein [Ralstonia solanacearum
           GMI1000]
          Length = 282

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 79/227 (34%), Gaps = 4/227 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R     A +I++       + L   ++      L   E
Sbjct: 30  VRIMTLFSILPATNDQMLTGIARNGVVYALAILVA--AGQPVGLAAHLSAGQLFMLTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  + +   
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTLIDNVSGFNNVQMTNPLRGDQNTPIGNTLVNLAVTLF 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   N  +    +    + F   ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFKWWPLGAALPDMNAVAQSFLLQQTDSIFSTAVKLAAPVMMTML 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  IGLL +   ++    +  P    +  L +   +  +  Q   
Sbjct: 208 LIDAGIGLLARAADKLEPTSLGQPIKGAVALLMVMALVTALSTQVKG 254


>gi|153834119|ref|ZP_01986786.1| flagellar biosynthetic protein FliR [Vibrio harveyi HY01]
 gi|156975418|ref|YP_001446325.1| flagellar biosynthesis protein FliR [Vibrio harveyi ATCC BAA-1116]
 gi|148869489|gb|EDL68487.1| flagellar biosynthetic protein FliR [Vibrio harveyi HY01]
 gi|156527012|gb|ABU72098.1| hypothetical protein VIBHAR_03149 [Vibrio harveyi ATCC BAA-1116]
          Length = 260

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  ++RL   +A +  + P +         ++  
Sbjct: 11  WIANYFWPYTRISAMLMVMTVTGARFVSPRIRLYLGLAITFAVAPAIPAVPQDIELLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQIVIGVAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F    + L   F   L +S 
Sbjct: 130 FMFLATMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMASWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYELFWAVG 248


>gi|23099028|ref|NP_692494.1| flagellar biosynthesis protein FliR [Oceanobacillus iheyensis
           HTE831]
 gi|22777256|dbj|BAC13529.1| flagellar protein required for flagellar formation [Oceanobacillus
           iheyensis HTE831]
          Length = 259

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 105/242 (43%), Gaps = 6/242 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + +  LI  RV +  +++P  S   +P+Q ++  +   +I+++     T+D        
Sbjct: 9   TLPAFLLIFVRVLAFFVIMPLFSYRSVPVQFKIGISFFLAIIMI----STVDTAGIAVNN 64

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  L++ E+ +G   GL+  +    +Q  G  I   +G  +   +              
Sbjct: 65  LYIFLIVKEILVGICIGLIAYIIVSAIQVAGGFIDFQMGFAIANVVDPQTGAQSPLTGQY 124

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN--IFSSFVNMLQTTFMIMLRL 185
           + II LL L  ++ HH +   +  SY  IP+ Q L FG   I    +    T F++  ++
Sbjct: 125 LYIISLLFLLSVNGHHIIIDGIFNSYSYIPLNQFLPFGEESIVQFVLTTFNTMFLVAFQI 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +    + ++++G++ + VPQ+ ++ +  P  I +    + + + + +      F  
Sbjct: 185 AIPIVGCLFLVDVALGIIARTVPQMNVFVVGLPLKILVSFAAILVFLALYINLAQRLFET 244

Query: 246 GF 247
            +
Sbjct: 245 MY 246


>gi|91976175|ref|YP_568834.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisB5]
 gi|91682631|gb|ABE38933.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           BisB5]
          Length = 255

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 67/234 (28%), Positives = 123/234 (52%), Gaps = 1/234 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  R+G+ +ML P L  S IP++++L  A+  ++++LP       +    +    
Sbjct: 13  AAFMLVFARIGAMVMLFPTLGESNIPVRIKLSIALGLTLIILPLHRSAYQVD-MSSLTPL 71

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             +++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + + + 
Sbjct: 72  LVMMIQEIIIGIVLGATARVTLSALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFLT 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           I+G+  L+  D HH V  AL  SY     G+ L+ G++ +        +F I ++L++PF
Sbjct: 132 ILGVTMLFATDSHHLVIQALSDSYKIFAPGELLSSGDVAALATKAFAASFKIGMQLAAPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           L F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L   +  ++  F + F
Sbjct: 192 LVFGLVFNIGLGILARLMPQMQVYFVGVPLSIAIGFIILAAVLTTMMSTFLNYF 245


>gi|119775420|ref|YP_928160.1| flagellar biosynthesis protein FliR [Shewanella amazonensis SB2B]
 gi|119767920|gb|ABM00491.1| flagellar biosynthetic protein FliR [Shewanella amazonensis SB2B]
          Length = 262

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 93/240 (38%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + R+ +  M++P    +  P++VRL  ++A +  + P L      + F   
Sbjct: 10  ETIKAYTWPLFRISAMFMVMPVFGANTTPVRVRLLLSVAVTFAVSPMLPPMPQGELFALS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           + +      ++ +G   GL+  +       TG +I     L     +          L +
Sbjct: 70  SVFIS--AQQVLIGVAMGLVALMMLQIFVLTGQIIGMQTSLGFSFMVDPGSGQQTPVLGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   LV S+ T+P+         + S        F   L +S
Sbjct: 128 FFLLLATLIFLAVDGHLTMIRMLVMSFDTLPVSMTGITLANYHSLALWGSYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P ++  G   L L++  ++  F   +   
Sbjct: 188 LSAIVALLLINLSFGVMTRAAPQLNIFAIGFPVVMISGLFILWLTLAPVMSHFGEIWEAA 247


>gi|300697474|ref|YP_003748135.1| Hrp conserved hrct protein, type III secretion system inner
           membrane protein [Ralstonia solanacearum CFBP2957]
 gi|299074198|emb|CBJ53743.1| Hrp conserved hrct protein, Type III secretion system inner
           membrane protein [Ralstonia solanacearum CFBP2957]
          Length = 282

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 82/232 (35%), Gaps = 4/232 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R       +I++       + L   +N      L   E
Sbjct: 30  VRIMTLFAILPATNDQMLTGIARNGVVYTLAILVA--AGQPVGLAEHLNAGQLFILTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  + +   
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTLIDNVSGYNNVQMTNPLRGDQNTPIGNTLVNLAVTLF 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   +  +    +    + F   ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFKWWPLGASLPDMSAVAQSFLLQQTDSIFSTAVKLAAPVMMTLL 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           + +  IGLL++   ++    +S P    +  L +   +  +  Q   +  Y 
Sbjct: 208 LIDAGIGLLSRAADKLEPASLSQPIKGAVALLMVMALVTALSTQVKGTLTYA 259


>gi|242280057|ref|YP_002992186.1| flagellar biosynthetic protein FliR [Desulfovibrio salexigens DSM
           2638]
 gi|242122951|gb|ACS80647.1| flagellar biosynthetic protein FliR [Desulfovibrio salexigens DSM
           2638]
          Length = 267

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 105/234 (44%), Gaps = 1/234 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +MS +L + RV   + LLP    + IP  V+    +  ++ + P +     L    +   
Sbjct: 11  LMSFYLTLFRVSIVLFLLPFFGGNSIPKTVKAALTIVLTLGIWPHVTFEGSLM-PASPYN 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + +++ E+ LG V G+ + V    +Q  G++I   +G ++   +       E      +
Sbjct: 70  IALMILGEMVLGLVMGISVHVMFAAIQTGGNLIGVQMGFSMVNVLDPLTGTNEAVTAHFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +  +L    I+ H  +  A+V+S+  IP GQ      + S  +++ +  F++ ++++SP
Sbjct: 130 YMCAILVFLSINGHLYLMSAMVESFKYIPPGQIFISSTLTSQIMSISKDLFVLAVKVASP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            +    V ++ + L++K+ PQ+ +  +  P  I  G   L L   ++       
Sbjct: 190 IIATIFVVDLGLALISKMAPQMNVLMLGFPLKILAGFFVLSLVFTVLSLHVGEF 243


>gi|226313052|ref|YP_002772946.1| flagellar biosynthesis protein FliR [Brevibacillus brevis NBRC
           100599]
 gi|226096000|dbj|BAH44442.1| flagellar biosynthetic protein FliR [Brevibacillus brevis NBRC
           100599]
          Length = 260

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 98/243 (40%), Gaps = 6/243 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +    L+  R+ +  +  P  S+  +P Q ++  A   +++    L    ++       
Sbjct: 7   YLPIFMLVFVRMSAFFVTAPFFSIRGVPNQFKIALAFIIAVISFQSLPVQGEIP---MDL 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   V+ E  +G + G +  +  + +Q  G ++   +GL +   +            + 
Sbjct: 64  TFVMYVIKEALVGVILGYICEMMFIAIQVAGGLMDMQMGLAMANVIDPKTGAYIPVTGNF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIP---IGQELNFGNIFSSFVNMLQTTFMIMLR 184
             I+ +L  + ID HH +   ++ SY  IP   +       N+  + V    T F     
Sbjct: 124 KNILAVLYFFSIDGHHMLIRGVISSYQVIPVDIMWAAFGSENVMMTAVKTFLTMFTSAFM 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +++P +    + ++S+G++ K VPQ  I+ +  P  +  G L L + +   +   +  F 
Sbjct: 184 IAAPIVVALFLVDLSLGIIAKSVPQFNIFVVGLPIKLLAGFLLLIVVMPAFLLTLNGLFG 243

Query: 245 YGF 247
             F
Sbjct: 244 NMF 246


>gi|312792665|ref|YP_004025588.1| flagellar biosynthetic protein flir [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179805|gb|ADQ39975.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 260

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 99/233 (42%), Gaps = 2/233 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    +  P      IP   ++ FA   S++++     +  +    N   Y  
Sbjct: 15  FFLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSLLVVTTYRFSYSVP--ANLLEYIF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L +   + 
Sbjct: 73  VVIKEFIVGLLIGYISYMVFSAILLAGQIIDNAIGFGMANVIDPMSEIQVPLLGNFFYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A+V SY  +PIG E        SF+      F+I + +S P L 
Sbjct: 133 MLVVFFGTDAHHLLIRAVVYSYKLVPIGYESVKREAALSFLKFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L + +  +         
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVIILPFMNKMIFVLID 245


>gi|312876515|ref|ZP_07736498.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796726|gb|EFR13072.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 260

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 100/224 (44%), Gaps = 2/224 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    +  P      IP   ++ FA   S++++     +  +    N   Y  
Sbjct: 15  FFLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSLLVVTTYRFSYSVP--ANLLEYIF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + + 
Sbjct: 73  VVIKEFIVGLLIGYISYMIFSAILLAGQIIDNAIGFGMANVIDPMSEIQVPLLGNFLYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A+V SY  +P+G E        SF+      F+I + +S P L 
Sbjct: 133 MLVVFFGTDAHHLLIRAVVYSYKLVPLGYESVKKEAALSFLKFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L + +  +
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGLPIKIAIGFLVLVIILPFM 236


>gi|83594154|ref|YP_427906.1| flagellar biosynthesis protein FliR [Rhodospirillum rubrum ATCC
           11170]
 gi|83577068|gb|ABC23619.1| Flagellar biosynthesis protein FliR [Rhodospirillum rubrum ATCC
           11170]
          Length = 253

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 128/239 (53%), Gaps = 1/239 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L+  R+G+ +++LPGLS +Y+ + +R+  A+  ++V LP +   +      N A+
Sbjct: 10  LFHFLLVFVRLGTAMLVLPGLSSTYVSVNIRILLAVTITLVALPTVGAALP-PAPDNTAF 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L+ VE  +G   G++ +   + + F G+++  + GL +  +   + +     +   +
Sbjct: 69  LVLLIAVEATIGVFLGMMAQFLLVPVSFAGNIMGFSTGLMMAQAFDPTTAQQSALIAGFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           G + ++ ++V   HH +  A+V SY   P GQ  + G++    V +L + F + L+L++P
Sbjct: 129 GEVAMVMVFVTGMHHLMIEAVVNSYDAFPPGQMPDTGDMVQLLVTILSSGFRLGLQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           F+ + I+FN ++G++ +L+PQ+ + F++ P  I  G   L  ++  ++Y F   F  G 
Sbjct: 189 FIIYAIIFNATLGVIARLMPQLNVLFVAMPAQILFGLALLMTTVPFLIYSFLGHFERGL 247


>gi|91792696|ref|YP_562347.1| flagellar biosynthesis protein FliR [Shewanella denitrificans
           OS217]
 gi|91714698|gb|ABE54624.1| flagellar biosynthetic protein FliR [Shewanella denitrificans
           OS217]
          Length = 267

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 99/241 (41%), Gaps = 2/241 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + +    + R+ S +M++     +  P +VRL  A+AF+  + P L +  +++ F  
Sbjct: 9   SQTIAAYLWPLFRISSMLMIMAVFGANTTPSRVRLMLAVAFTFAIAPVLPEIKNVELFAF 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A +  L   ++ +G V G +  +       TG +I     L   + +          + 
Sbjct: 69  SAVFITL--QQILIGAVMGFVTLMLMQTFVLTGQIIGMQTSLGFASMVDPGSGEQTPVVG 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +   ++  L    ID H  +F  +V S+ +IP+  +      +          F   L +
Sbjct: 127 NFFLLLATLIFLSIDGHLLMFRMIVASFESIPVSNQGIEIANYKILAEWGGYMFGAALTM 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S   +   ++ N+S G++ +  PQ+ I+ I  P  +  G L L L++  I+  F   +  
Sbjct: 187 SMSAIVALLLINLSFGVMTRAAPQLNIFSIGFPVTMVSGLLILWLTLGPIMAHFDEVWYA 246

Query: 246 G 246
            
Sbjct: 247 A 247


>gi|115523574|ref|YP_780485.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisA53]
 gi|115517521|gb|ABJ05505.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           BisA53]
          Length = 256

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 70/226 (30%), Positives = 120/226 (53%), Gaps = 1/226 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R+G+ +ML+PG   S IP +++L  A+  ++++LP       +    + A    L++ E+
Sbjct: 21  RIGTMVMLMPGFGESNIPARIKLSIALGLTLIILPLHRSAYQVD-MTSMAPLIVLMLHEI 79

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G V G  +RV    LQ  GSVI+  +GL   T++  +       + + + ++GL  L+
Sbjct: 80  VIGIVLGATVRVTLAALQVAGSVIAQQLGLGFVTAVDPTQGQQGLLIGNFLTLLGLTLLF 139

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
             D HH V  AL +SY     G+ L  G+I +         F I ++L++PFL F +VFN
Sbjct: 140 ATDSHHLVIAALNESYRVFSPGELLPSGDIAALATRAFSAAFKIGMQLAAPFLVFGLVFN 199

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           I +G+L +L+PQ+ +YF+  P  I +G L L   +  ++  F   F
Sbjct: 200 IGLGVLARLMPQMQVYFVGVPLSIVVGFLILIGVLAAMMGTFMDYF 245


>gi|325917836|ref|ZP_08180015.1| flagellar biosynthetic protein FliR [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535947|gb|EGD07764.1| flagellar biosynthetic protein FliR [Xanthomonas vesicatoria ATCC
           35937]
          Length = 263

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   S+VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLSMVLAPILPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  A--VLSIARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  +     F+     +        L L
Sbjct: 134 WFYIGFGLLFFAANGHLAVISLLVDSYKALPIGTAIPDARAFAEVAPTLFLQIMRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPMQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|37680653|ref|NP_935262.1| flagellar biosynthesis protein FliR [Vibrio vulnificus YJ016]
 gi|37199402|dbj|BAC95233.1| flagellar biosynthesis pathway, component FliR [Vibrio vulnificus
           YJ016]
          Length = 260

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 94/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL  ++A ++ L+P +    +    ++  
Sbjct: 11  WIANYFWPFTRISSMLMVMTVTGARFVSPRIRLYLSLAITLALMPAIPAVPEDLQLLSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +      ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GFLTT-FEQIVIGVAMGMVTQFIIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   ++ S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLSTMFFLATDGHLKMLQLVLFSFKTLPIGSGSLNAVDFRELALWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +L G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALLVGLLICWYILAGLYSHYELYWLQG 248


>gi|84388123|ref|ZP_00991019.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
 gi|84377190|gb|EAP94060.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
          Length = 260

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 92/240 (38%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + F    R+ + +M++      ++  ++RL   +A +  ++P +         ++ 
Sbjct: 10  EWLANYFWPYTRISAMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPKEIELLSF 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V  ++ +G   G + +         G ++     L   + +  ++      L  
Sbjct: 70  QGFLT-VFEQIVIGVAMGFVTQFLIQTFVMLGQILGMQSSLGFASMVDPANGQNTPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  ++  +     D H ++   +V S+ T+PIG        F      L   F   L +S
Sbjct: 129 LFMLLATMFFLATDGHLKMLQLVVFSFKTLPIGSGSLTAVDFRELALWLGIMFKTALAMS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   ++ G
Sbjct: 189 LSGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALLVGLLLCWYILGGLFSHYELFWIQG 248


>gi|205373391|ref|ZP_03226195.1| flagellar biosynthesis protein FliR [Bacillus coahuilensis m4-4]
          Length = 258

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 99/241 (41%), Gaps = 6/241 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
                LI+ RV S  + +P  S   IP Q RL  +   + ++      +++    V    
Sbjct: 8   FSVYLLILMRVASFFVTMPLFSYRTIPAQHRLGLSAILAFLMY----YSVEADPLVIDGL 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L++ E  +G + G    +    +Q  G  I   +G  +   +     +        +
Sbjct: 64  YFLLILKEAMVGLLIGFAAYMIISAIQIAGGFIDFQMGFAIANVVDPQTGMQSPITGQYL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN--IFSSFVNMLQTTFMIMLRLS 186
               LL L  ++ HH +   +  SY  IPI   L F N  I           F+I  ++S
Sbjct: 124 YTFALLLLLSVNGHHIMLDGIFHSYQFIPIDSMLPFENESIVLFITTAFSRVFVIAFQIS 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           +P +    + +I++G++ + VPQ+ I+ +  P  I +  + L L +  ++     +F Y 
Sbjct: 184 APVVATLFLVDIALGIVARTVPQLNIFVVGFPIKIAVSFIILILVMGSMMIVIQQTFEYM 243

Query: 247 F 247
           F
Sbjct: 244 F 244


>gi|220925377|ref|YP_002500679.1| flagellar biosynthetic protein FliR [Methylobacterium nodulans ORS
           2060]
 gi|219949984|gb|ACL60376.1| flagellar biosynthetic protein FliR [Methylobacterium nodulans ORS
           2060]
          Length = 254

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 126/242 (52%), Gaps = 1/242 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M +    +  S  L   RVG+ IML+PG+  + +  ++RL FA+  ++VL P +   +  
Sbjct: 1   MNLLLPGLAASYLLTFARVGTLIMLMPGIGEAVVSPRLRLAFALLVALVLFPAVRPLLPQ 60

Query: 61  QNFVNRAY-YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
            +          +++ E+ +G V GL +R     LQ TG++I+  +GL    ++  + + 
Sbjct: 61  PDGAGAGPRLIGVLIGEVAVGLVLGLSVRAVLAALQTTGTIIAQQLGLAYAMTVDPTAAG 120

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
            +  L + + ++G+  +   D HH     +  SY  +P       G+     +  +   F
Sbjct: 121 QQATLGTFLTLLGITLVLAADLHHLAIAGIRDSYALMPPVGVPATGDAADLVIRAVARGF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            + +++S+PF+ F I+FN+ +G+L++L+PQ+ ++F++TP  I +G + L  +I +++  F
Sbjct: 181 ALAVQISAPFIAFGILFNLGLGVLSRLMPQMQVFFVATPASILIGMMVLLATIGVVMGVF 240

Query: 240 SH 241
             
Sbjct: 241 VD 242


>gi|255021384|ref|ZP_05293432.1| Flagellar biosynthesis protein FliR [Acidithiobacillus caldus ATCC
           51756]
 gi|254969247|gb|EET26761.1| Flagellar biosynthesis protein FliR [Acidithiobacillus caldus ATCC
           51756]
          Length = 262

 Score =  115 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 104/243 (42%), Gaps = 3/243 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  + + F    R+ + +   P  S S +P+QVR+  A   S+ + P L     +     
Sbjct: 10  EHWIGAFFWPFVRILALLSTAPVFSASAVPIQVRVGLAAIISVAIAPALPTLPAVHFLSG 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L++ ++ +G   G  + +    +QF GSVIS  +GL   +    +  +    L+
Sbjct: 70  AG--LVLLVEQIVIGTALGFAVTLIFSAVQFAGSVISLQMGLGFSSFFDPTTGVQVPTLS 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNIFSSFVNMLQTTFMIMLR 184
           + + +  LL    ++    V   L++S+  +P+   L      +          F + + 
Sbjct: 128 NFLNLAVLLFFMALNGQLLVLVVLMRSFTVLPVDPNLVVHATAWHVLAAAGAAVFSLGMA 187

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +++P L    + NI++G+L+KL PQ+ ++ +  P LIG+G + L L    +         
Sbjct: 188 IAAPVLGALFLVNIALGVLSKLAPQLNLFVVGFPLLIGVGLIGLYLLAPALELVVRQLLD 247

Query: 245 YGF 247
              
Sbjct: 248 LAL 250


>gi|163750538|ref|ZP_02157776.1| flagellar biosynthesis protein [Shewanella benthica KT99]
 gi|161329693|gb|EDQ00682.1| flagellar biosynthesis protein [Shewanella benthica KT99]
          Length = 265

 Score =  115 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 95/239 (39%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + S    + RV S  M++     +  P++VR   +MA +  ++P L    ++  F   A
Sbjct: 11  TIASYMWPLFRVSSMFMVMVVFGANTTPVRVRALLSMAITFAIVPVLPPVENVALFAASA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L   +L +G   G +  +        G +I     L   + +  S       + +L
Sbjct: 71  IFITL--QQLLIGISMGFVTLMVMQCFVLAGQIIGMQTSLGFASMVDPSSGQQTPVIGNL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  +    +D H  +   LV S+ TIPI  +      +          F   L +S 
Sbjct: 129 FLLLTTMIFLAVDGHLVMIRMLVLSFETIPISDQGLSVTSYRLLAEWGGYMFGAALTMSM 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F   +   
Sbjct: 189 TPIVALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLVILWLTLTPIMEHFGEVWTSA 247


>gi|302037620|ref|YP_003797942.1| flagellar biosynthetic protein FliR [Candidatus Nitrospira
           defluvii]
 gi|300605684|emb|CBK42017.1| Flagellar biosynthetic protein FliR, export component [Candidatus
           Nitrospira defluvii]
          Length = 263

 Score =  115 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 93/237 (39%), Gaps = 3/237 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +  +++ R+   + + P L+   IPM V+        +VL P +          +   
Sbjct: 15  FQAFSILLVRIAGIVSVFPILNTRTIPMPVKTGLVATLGLVLAPIIHL---PNLPNDPVL 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               +  E  +G   GL +R+   G Q  G +I T +G +               +    
Sbjct: 72  VIAGIGSEFLIGLTIGLAVRLLFSGFQVAGDMIGTQMGFSAIQMFDPMSHQNTPIIAQFQ 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             +G L    ++ H  V +A+  SY  +P         I    +++ Q    + L+L++P
Sbjct: 132 LTLGSLVFLSLNAHLLVVHAIGMSYEYVPPFGASLSDGIAQDIIHLAQNMLGVALKLAAP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
                ++ N  + +L + VPQ+ ++  S P  IG G L + L++   +  F   F  
Sbjct: 192 VFATLLIVNTVLAILGRAVPQMNVFVTSFPITIGAGFLAMSLAMPFTLLLFEKEFET 248


>gi|238755317|ref|ZP_04616660.1| Flagellar biosynthetic protein fliR [Yersinia ruckeri ATCC 29473]
 gi|238706453|gb|EEP98827.1| Flagellar biosynthetic protein fliR [Yersinia ruckeri ATCC 29473]
 gi|328496287|gb|AEB21291.1| FliR [Yersinia ruckeri]
          Length = 260

 Score =  115 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 106/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             ++   F  + RV + I   P L+   I  +V++  A+  +I++ P L     +   V 
Sbjct: 10  SHLVSQYFWPLVRVLALISTAPVLNEKSINRKVKVGLAVMITILIAPSLP---PIAIPVF 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 ++M ++ +G   GL ++     ++  G +I   +GL+  T    S       L 
Sbjct: 67  SVGAIWVLMQQVLIGIAIGLTMQFAFAAIRLAGEIIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L    ++ H  +   L  S+ T+PI      G  F +   +    F+  L L
Sbjct: 127 RLLNLLAMLLFLSLNGHLWMISMLADSFHTLPIQFAPLNGGGFRALTEIGSLIFLSGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G L L L +  +     H F  
Sbjct: 187 ALPMITILLTLNMALGMLNRMTPQLSVFVIGFPLTLTIGMLTLGLIMPALAPYCEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|89098626|ref|ZP_01171508.1| flagellar biosynthesis protein R [Bacillus sp. NRRL B-14911]
 gi|89086588|gb|EAR65707.1| flagellar biosynthesis protein R [Bacillus sp. NRRL B-14911]
          Length = 260

 Score =  115 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 97/238 (40%), Gaps = 7/238 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +  LI  RV S  +L+P  S   IP   ++      + ++        D   F     
Sbjct: 8   FPAFLLIFVRVTSFFLLMPLFSYRSIPNTHKIGLGFFLAWIIF----YAADAPAFEINGA 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L+M E  +G V G +  +    +Q  G +I   +G  +   +          +   +
Sbjct: 64  YYLLIMKEALVGLVIGFISYLILSAIQIAGGLIDFQMGFAIANVIDPQTGAQSPLMGQYL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLRL 185
             I L  L +++ HH +   +  SY  IP+ Q         +    +    + F+   ++
Sbjct: 124 YTISLFFLLMVNGHHLLIDGIFYSYQAIPLDQPWIPFGDEGMAEYMLRAFNSMFISAFQM 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           S P +    + ++++G++ + VPQ+ ++ +  P  IG+  + L   + +++Y  S  F
Sbjct: 184 SVPVVGCLFLVDVALGIVARTVPQLNVFVVGIPLKIGVSFIVLVAVMSVLLYVVSQLF 241


>gi|302872553|ref|YP_003841189.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575412|gb|ADL43203.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 260

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 95/234 (40%), Gaps = 2/234 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    +  P      IP   ++ FA   S++++             N   Y  
Sbjct: 15  FFLVLARMSGLFIASPIFGRRNIPAYFKIGFAFFLSMIVVTT--YNFSYSVPTNVEEYIF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E  +G + G +  +    +   G +I  AIG  +   +     +    L + + + 
Sbjct: 73  VVIKEFIVGLLIGYISYMIFSAILLGGQIIDNAIGFGMANVIDPMSEIQVPLLGNFLYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A+  SY  +PIG          +F+      F+I + +S P L 
Sbjct: 133 MLVMFFGTDAHHLLIRAIFYSYKLVPIGYGGFKTEFTWNFLRFFSELFLIGVEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             ++ +I + +L++ VPQ+ ++ +  P  I +G L L +    +          
Sbjct: 193 SMLIVDIILAVLSRAVPQMNVFMVGIPIKITIGFLVLVIIFPFMSKMIFVLIDR 246


>gi|269961632|ref|ZP_06175994.1| flagellar biosynthesis protein [Vibrio harveyi 1DA3]
 gi|269833673|gb|EEZ87770.1| flagellar biosynthesis protein [Vibrio harveyi 1DA3]
          Length = 260

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  ++RL   +A +  + P +         ++  
Sbjct: 11  WIANYFWPYTRISAMLMVMTVTGARFVSPRIRLYLGLAITFAVAPAIPAVPQDIELLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQIIIGVAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F    + L   F   L +S 
Sbjct: 130 FMFLATMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMASWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYELFWAVG 248


>gi|117619054|ref|YP_855916.1| flagellar biosynthesis protein FliR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560461|gb|ABK37409.1| flagellar biosynthetic protein FliR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 263

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 93/239 (38%), Gaps = 2/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S+   + RV   +M++        P +VR+  A+A ++++ P L     ++ F   
Sbjct: 10  EWLSSIVWPLARVSGLLMVMAVFGSRLTPARVRISLALALTLMIAPLLPPMPKIELFSVG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           ++       +L +G   GL+ +         G +I+    L   T +   +  +   +  
Sbjct: 70  SFLVL--GQQLLIGVALGLMTQFLMESFVMAGQIIAMQTSLGFATLVDPMNGQSAPVVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   +V S+ T+P+             +  L   +   L ++
Sbjct: 128 FYLMLATLVFLAVDGHLIMLRMVVLSFDTLPVSDSGLSLPSIRDLIGFLGVMYQASLVMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
              +   ++ N + G++ +  PQ+ I+ I     +  G L L L+I   +  F   +  
Sbjct: 188 LSAIVALLLINFAFGVMTRAAPQLNIFSIGFAVSMMSGLLILWLTIGGFLGHFDSMWER 246


>gi|188496134|ref|ZP_03003404.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
 gi|188491333|gb|EDU66436.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
          Length = 261

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTQNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|219566962|dbj|BAH04993.1| Hrp conserved transmembrane protein [Ralstonia solanacearum]
          Length = 282

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 79/227 (34%), Gaps = 4/227 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R     A +I++       + L   ++      L   E
Sbjct: 30  VRIMTLCSILPATNDQMLTGIARNGVVYALAILVA--AGQPVGLAAHLSAGQLFMLTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  + +   
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTLIDNVSGFNNVQMTNPLRGDQNTPIGNTLVNLAVTLF 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   N  +    +    + F   ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFKWWPLGAALPDMNAVAQSFLLQQTDSIFSTAVKLAAPVMMTML 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  IGLL +   ++    +  P    +  L +   +  +  Q   
Sbjct: 208 LIDAGIGLLARAADKLEPTSLGQPIKGAVALLMVMALVTALSTQVKG 254


>gi|27365292|ref|NP_760820.1| flagellar biosynthesis protein FliR [Vibrio vulnificus CMCP6]
 gi|320155676|ref|YP_004188055.1| flagellar biosynthesis protein FliR [Vibrio vulnificus MO6-24/O]
 gi|27361439|gb|AAO10347.1| flagellar biosynthetic protein FliR [Vibrio vulnificus CMCP6]
 gi|319930988|gb|ADV85852.1| flagellar biosynthesis protein FliR [Vibrio vulnificus MO6-24/O]
          Length = 260

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 94/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL  ++A ++ L+P +    +    ++  
Sbjct: 11  WIANYFWPFTRISSMLMVMTVTGARFVSPRIRLYLSLAITLALMPAIPAVPEELQLLSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +      ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GFLTT-FEQIVIGVAMGMVTQFIIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   ++ S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLSTMFFLATDGHLKMLQLVLFSFKTLPIGSGSLNAVDFRELALWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +L G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALLVGLLICWYILAGLYSHYELYWLQG 248


>gi|157961201|ref|YP_001501235.1| flagellar biosynthesis protein FliR [Shewanella pealeana ATCC
           700345]
 gi|157846201|gb|ABV86700.1| flagellar biosynthetic protein FliR [Shewanella pealeana ATCC
           700345]
          Length = 266

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 90/238 (37%), Gaps = 2/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +      + R+ S  M++     +  P +VRL  ++  +  + P L    ++  F   A 
Sbjct: 12  IAGYLWPLTRISSMFMVMAVFGATTTPTRVRLLLSVTVTAAVAPVLPAMPNIDLFSLSAA 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +      ++ +G   G    +       TG +I     L   + +  S       + +  
Sbjct: 72  FVT--AQQIIIGVAMGFATLLLMQTFVLTGQIIGMQTSLGFASMVDPSSGQQTPVVGNFF 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  +    +D H  +   ++ S+ +IP+  +      +  F   +   F   L +S  
Sbjct: 130 LLLTTMIFLAVDGHLLLIKMVIASFESIPVSMQGLSLASYRLFTEFVGYMFGAALTMSLS 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +   +  N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F   +   
Sbjct: 190 AIVALLTINLSFGVMTRASPQLNIFAIGFPVTMVAGLFILWLTLSPIMSHFDEVWRET 247


>gi|159184373|ref|NP_353608.2| flagellar biosynthesis protein FliR [Agrobacterium tumefaciens str.
           C58]
 gi|159139686|gb|AAK86393.2| flagellar biosynthetic protein FLIR [Agrobacterium tumefaciens str.
           C58]
          Length = 240

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 94/236 (39%), Positives = 147/236 (62%), Gaps = 1/236 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-DLQNFVNRAYYSK 71
           FL +CR+G+C M +PG S S I  Q+R+   +A S+ LLP LWDTI    +  ++     
Sbjct: 2   FLAICRIGACFMTMPGFSSSRISPQIRMLLCVAVSMALLPVLWDTIYPKVSGASQGAVVG 61

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L+  E+ +G ++GL+ R YTLG QFTG++I  +IGL+        + + E  + + I   
Sbjct: 62  LIFSEVLIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGADPIEDVQENQIANFITFG 121

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
           GLL L+++DFHH V  ALV SY   P+G  ++   +  +  + L+ +F IMLRL+SPF+ 
Sbjct: 122 GLLVLFMMDFHHIVLKALVDSYSATPVGALISGQKMLITLTDTLRASFSIMLRLASPFVI 181

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           + ++FN+++GL+NKL PQIP++FISTP+++  G   L LS+  ++ QF   F   F
Sbjct: 182 YGLMFNVAVGLINKLAPQIPVFFISTPFVLAGGLFMLYLSVAALIRQFVDGFGPVF 237


>gi|318605251|emb|CBY26749.1| flagellar biosynthesis protein FliR [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 260

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + R+ + I   P LS   I  +V++  A+  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLIRILALISTAPVLSEKQINRKVKVGLAVLITFLIAPSLP---PVNIPLV 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L 
Sbjct: 67  SSGALWVAGQQVLIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L     D H  +   L  S+ T+PI  E   GN F +        FM  L L
Sbjct: 127 RLLNLLAMLLFLSFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTQAGSWIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|316932837|ref|YP_004107819.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           DX-1]
 gi|315600551|gb|ADU43086.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           DX-1]
          Length = 268

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 123/237 (51%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +  +  L+  R+G+ +ML+P L  S IP +++L  A+  ++++LP       +    + 
Sbjct: 23  ALAATFMLVFARIGAMVMLMPALGESNIPTRIKLSIALLLTMIMLPLHRSAYQID-MSSL 81

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ E+ +G V G   RV    LQ  G+VI+  +GL   +++  +       + +
Sbjct: 82  TPLLVLMVQEIAIGIVLGATARVTLSALQVAGAVIAQQLGLGFVSAVDPTQGQQGVLVGN 141

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G+  L+  D HH V  AL  SY     G+ LN G++ +         F + L+L+
Sbjct: 142 FLTLLGVTMLFATDMHHLVIQALSDSYKVFAPGELLNTGDVAALATQAFAAAFKLGLQLA 201

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +PFL F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L + +  ++  F   F
Sbjct: 202 APFLVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIVIGFIVLAVVLTTMMGAFLGYF 258


>gi|163801857|ref|ZP_02195754.1| flagellar biosynthesis protein R [Vibrio sp. AND4]
 gi|159174365|gb|EDP59169.1| flagellar biosynthesis protein R [Vibrio sp. AND4]
          Length = 260

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 92/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  ++RL   +A +  + P +         ++  
Sbjct: 11  WIANYFWPYTRISAMLMVMTVTGARFVSPRIRLYLGLAITFAVAPAIPAVPQDIELLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++  +   L  L
Sbjct: 71  GF-MTIAEQIIIGVAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQSTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLVTMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNALDFRELAGWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G LF    +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFTFALIIGLLFCWYILAGLYSHYELFWNVG 248


>gi|238025695|ref|YP_002909926.1| flagellar biosynthetic protein FliR [Burkholderia glumae BGR1]
 gi|237874889|gb|ACR27222.1| Flagellar biosynthetic protein FliR [Burkholderia glumae BGR1]
          Length = 259

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 106/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + +      R+ + +   P +  + +P++V++  +   +I + P L        F   
Sbjct: 11  VWLTAFLWPFVRILALVAAAPLIGNAAVPVRVKIGLSALTAIAVAPALGPLPQATVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   +  +G   G ++++    ++  G  I   +GL   T            +  
Sbjct: 71  GIWILV--NQFLIGVSMGFVMQIVFAVVEAAGDYIGLQMGLGFATFFDPHAGT-TPMMGR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++    +LA    D H Q+  ALV+S+ ++PI  +L     + +        F + L L+
Sbjct: 128 ILNAFAMLAFVAFDGHLQLIAALVESFASVPISADLLHPAGWQTLAGAGINVFAMGLLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI I+ I  P L+ +G L + L +  ++  FS  F  G
Sbjct: 188 LPVVAALLIANLALGILNRAAPQIGIFQIGFPVLMLVGLLLVQLMVPNMMPFFSRLFDNG 247

Query: 247 F 247
           +
Sbjct: 248 Y 248


>gi|323703183|ref|ZP_08114836.1| flagellar biosynthetic protein FliR [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531842|gb|EGB21728.1| flagellar biosynthetic protein FliR [Desulfotomaculum nigrificans
           DSM 574]
          Length = 255

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 104/239 (43%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ + FL+  R+ S     P  ++  IP  V+   +   +I++ P +   +        
Sbjct: 5   TLITTFFLVFMRMVSFTFACPLYAIPGIPPLVKAGLSFILAILITPMVKP-VSADLPGGL 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +V  E+ +G V GL+       ++  G ++   IG  + + M        T ++ 
Sbjct: 64  WGFGLVVFSEVGVGLVLGLVCTFVFNVIRMAGQLLDFQIGFAMASVMDPLSGSVNTLVSR 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + L+    +D HH +  AL KSY  +P+      G +    + +   TF + +++ 
Sbjct: 124 FLYFLTLVLFLNVDGHHVLIRALAKSYELVPLNAAGINGEVTLLIIRIFADTFALAVQIC 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           +P +   ++ ++++GL+ K  PQ+ I+ +  P  I +G   L + +  +   F   F  
Sbjct: 184 APVVAVLVITDLAMGLVGKTAPQMNIFQLGFPLKIAVGVASLAILLPALTSVFKILFDT 242


>gi|299069239|emb|CBJ40499.1| Hrp conserved hrct protein, Type III secretion system inner
           membrane protein [Ralstonia solanacearum CMR15]
          Length = 282

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 79/227 (34%), Gaps = 4/227 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R     A +I++       + L   ++      L   E
Sbjct: 30  VRIMTLFSILPATNDQMLTGVARNGVVYALAILVA--AGQPVGLAAHLSAGQLFMLTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  + +   
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTIIDNVSGFNNVQMTNPLRGDQNTPIGNTLVNLAVTLF 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   N  +    +    + F   ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFTWWPLGAALPDMNAVAQSFLLQQTDSIFSTAVKLAAPVMMTVL 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  IGLL +   ++    +  P    +  L +   +  +  Q   
Sbjct: 208 LIDAGIGLLARAADKLEPTSLGQPIKGAVALLMVMALVSALSTQVKG 254


>gi|23016624|ref|ZP_00056378.1| COG1684: Flagellar biosynthesis pathway, component FliR
           [Magnetospirillum magnetotacticum MS-1]
          Length = 254

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 118/247 (47%), Gaps = 1/247 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +T   ++ +   FL+  R+G+ +ML PGL  S +  ++RL  A+A + V++P +      
Sbjct: 2   LTDLLQLDIFRFFLVFTRIGAALMLFPGLGGSLVSTRIRLLLALAVAFVIMPVVAPVFPA 61

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               +       V  E  +G   G ++      L   GS+I    GL    S        
Sbjct: 62  -VPKSVGGMLLSVFGEAVVGAYIGTVVMFIMSTLNMAGSMIGYQTGLTNAFSFDPISQQQ 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              L   +  IGL+A++  D HH +F A  +SY   P GQ L FG+   +  ++   TF 
Sbjct: 121 SQLLTGFLSNIGLVAVFATDLHHLMFQAAYESYALFPPGQPLQFGDYAETLGHLATDTFK 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +  + ++P + F +VF   +GLL++LVPQ+ ++F++ P  + +G     ++I +++  F 
Sbjct: 181 VGTQFAAPLVVFGLVFYTGLGLLSRLVPQLQVFFVAMPVQVMVGMWLFMVTIPLVISLFL 240

Query: 241 HSFLYGF 247
             F  G 
Sbjct: 241 RFFESGL 247


>gi|222053618|ref|YP_002535980.1| flagellar biosynthetic protein FliR [Geobacter sp. FRC-32]
 gi|221562907|gb|ACM18879.1| flagellar biosynthetic protein FliR [Geobacter sp. FRC-32]
          Length = 260

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 110/235 (46%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
                L+V R+      +P      +PM++++   M+ +++L P +   +      +   
Sbjct: 12  FTLFSLVVGRMAGLFSAIPLFGGKSVPMRIKMAVIMSMALLLFPIIKMQVP-PLPGDSIS 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV+ E  +G   G++ +     ++  G ++   +G+++      +       ++   
Sbjct: 71  IGLLVIRETLIGLTLGIISQAIFAAVEMCGQIVGMQMGISIAALFDPNTQSNVPTMSLFQ 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           GI+ +L    +  HH    A+V+SY  IP+G     G +   F+  +   F++ ++L++P
Sbjct: 131 GILAMLLFVALGVHHIFIRAIVESYQVIPVGAWHMSGELMQFFITSIGAVFILGVKLAAP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   +  ++++G++ +  PQ+ I+ +S P  IG+G L L LS+   +    +SF
Sbjct: 191 VMVALLATSVALGIMARAFPQMNIFMVSMPLNIGIGFLALGLSLLAFLRTLQNSF 245


>gi|22126371|ref|NP_669794.1| flagellar biosynthesis protein FliR [Yersinia pestis KIM 10]
 gi|45441392|ref|NP_992931.1| flagellar biosynthesis protein FliR [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108812466|ref|YP_648233.1| flagellar biosynthesis protein FliR [Yersinia pestis Nepal516]
 gi|149366234|ref|ZP_01888269.1| flagellar biosynthetic protein FliR [Yersinia pestis CA88-4125]
 gi|162100178|ref|YP_651106.2| flagellar biosynthesis protein FliR [Yersinia pestis Antiqua]
 gi|165926001|ref|ZP_02221833.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938779|ref|ZP_02227334.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010957|ref|ZP_02231855.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166210878|ref|ZP_02236913.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167401187|ref|ZP_02306690.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167420441|ref|ZP_02312194.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425768|ref|ZP_02317521.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467508|ref|ZP_02332212.1| flagellar biosynthesis protein FliR [Yersinia pestis FV-1]
 gi|218928939|ref|YP_002346814.1| flagellar biosynthesis protein FliR [Yersinia pestis CO92]
 gi|229896263|ref|ZP_04511433.1| flagellar biosynthetic protein FliR [Yersinia pestis Pestoides A]
 gi|229897200|ref|ZP_04512356.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229897927|ref|ZP_04513078.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902842|ref|ZP_04517959.1| flagellar biosynthetic protein FliR [Yersinia pestis Nepal516]
 gi|270486629|ref|ZP_06203703.1| flagellar biosynthetic protein FliR [Yersinia pestis KIM D27]
 gi|294504014|ref|YP_003568076.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|21959356|gb|AAM86045.1|AE013852_7 flagellar biosynthesis protein [Yersinia pestis KIM 10]
 gi|45436252|gb|AAS61808.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108776114|gb|ABG18633.1| flagellar biosynthetic protein FliR [Yersinia pestis Nepal516]
 gi|115347550|emb|CAL20459.1| flagellar biosynthetic protein FliR [Yersinia pestis CO92]
 gi|149292647|gb|EDM42721.1| flagellar biosynthetic protein FliR [Yersinia pestis CA88-4125]
 gi|165913393|gb|EDR32015.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922205|gb|EDR39382.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990301|gb|EDR42602.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166208058|gb|EDR52538.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166962136|gb|EDR58157.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049576|gb|EDR60984.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167055167|gb|EDR64964.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229680289|gb|EEO76388.1| flagellar biosynthetic protein FliR [Yersinia pestis Nepal516]
 gi|229688968|gb|EEO81033.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229693537|gb|EEO83586.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701186|gb|EEO89215.1| flagellar biosynthetic protein FliR [Yersinia pestis Pestoides A]
 gi|262361800|gb|ACY58521.1| flagellar biosynthesis protein [Yersinia pestis D106004]
 gi|262366064|gb|ACY62621.1| flagellar biosynthesis protein [Yersinia pestis D182038]
 gi|270335133|gb|EFA45910.1| flagellar biosynthetic protein FliR [Yersinia pestis KIM D27]
 gi|294354473|gb|ADE64814.1| flagellar biosynthesis protein [Yersinia pestis Z176003]
 gi|320015444|gb|ADV99015.1| flagellar biosynthetic protein FliR [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 260

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + RV + I   P LS   I  +V++   +  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLVRVLALIGTAPLLSEKQINKKVKIGLGVLITFLIAPSLP---PVNIPLF 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    + + ++ +G   G+ ++     ++ +G VI   +GL+  T    S       L+
Sbjct: 67  SSAALWVAIQQILIGVALGVTMQFAFAAVRLSGEVIGLQMGLSFATFFDPSGGPNMPVLS 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ I+  L     D H  +   L  S+ T+PI      GN F +        FM  L L
Sbjct: 127 RLLNILVTLLFLSFDGHLWLISLLADSFHTLPIQFAPLNGNGFLTLAQSGSMIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLFSE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|332981451|ref|YP_004462892.1| flagellar biosynthetic protein FliR [Mahella australiensis 50-1
           BON]
 gi|332699129|gb|AEE96070.1| flagellar biosynthetic protein FliR [Mahella australiensis 50-1
           BON]
          Length = 259

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 106/240 (44%), Gaps = 1/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + +  L+  R+    +L P      +P  +++  +   ++VLL  +     +    N  
Sbjct: 9   YIPTFLLVFMRMTGLFVLSPVFGRRNVPAYLKIGMSFMMAMVLLNTIPLQ-SIDIVNNIW 67

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  ++  E+ +G   G +  +    +   G ++   IG  +  +    + +A   + +L
Sbjct: 68  LYVWILFKEMLIGLAMGYITTLAFSAILIAGQIMDFQIGFGMVNAFDPVNEVAVPIVGNL 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I ++ LL  + ++ HH +   L  SY  +PIG      +I    + +   TF+  ++L+ 
Sbjct: 128 INMMALLLFFGMNGHHVLISLLFDSYTVLPIGDFSIKPDILWYILEIFVQTFVWAIKLAI 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++  + +G+L++ +PQ+ ++ +  P  + +G + L L + + +      F   F
Sbjct: 188 PLMAVLLLTEVMLGVLSRALPQMNVFVMGMPIRLMIGLIMLLLVLPVYINLMEPLFADMF 247


>gi|330828811|ref|YP_004391763.1| flagellar biosynthetic protein fliR [Aeromonas veronii B565]
 gi|328803947|gb|AEB49146.1| Flagellar biosynthetic protein fliR [Aeromonas veronii B565]
          Length = 265

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 95/239 (39%), Gaps = 2/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S+   + RV S +M++        P +VR+  A+A + ++ P L     ++ F   
Sbjct: 10  EWLSSILWPLARVSSLLMVMAVFGSRLAPARVRMGLALAITFLIAPLLPKMPPIELFSAG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           ++       +L +G   GL+ +         G VI+    L   T +   +  +   +  
Sbjct: 70  SFLVL--GQQLLIGIALGLMTQFLMESFVMAGQVIAMQTSLGFATLVDPMNGQSAPVVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   ++ S+ T+P+ +     +   +    L   +   L +S
Sbjct: 128 FYLMLATLVFLALDGHLVMLRLVILSFETLPVSEHGLSVSSMKTLSAFLGVMYQAALVMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
              +   ++ N + G++ +  PQ+ I+ I     +  G L L L+I   +  F   +  
Sbjct: 188 LSAIVALLLINFAFGVMTRAAPQLNIFSIGFAVSMMSGLLILWLTIGGFLGHFDIMWER 246


>gi|226944500|ref|YP_002799573.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
 gi|226719427|gb|ACO78598.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
          Length = 264

 Score =  115 bits (288), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 51/242 (21%), Positives = 104/242 (42%), Gaps = 2/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  +++ F   CR+ + ++  P    S +P +V++  A+  S++L P L    ++  F  
Sbjct: 10  QQWLLAFFWPFCRITAFLLATPLFGHSGVPARVKIALAVLLSVLLGPNLPPLPEVALFSW 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 + + ++ +G   G+++RV     Q  G +I   +GL   T            L+
Sbjct: 70  PG--LGITVEQMLIGLAIGMVMRVTFAAAQTAGDIIGLQMGLGFATFFSPDTGTNSMVLS 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+  I LL     D H      L  ++ ++PIG      + +        T F+  L L
Sbjct: 128 RLLYTIALLLFLAFDGHLLELELLAGTFASLPIGLPRLDPSAWEMLARYGGTLFVSGLLL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   ++ N+++G+LN+  PQ+ ++ +  P  + LG L L + +  +          
Sbjct: 188 ALPLVASLLIVNLAMGILNRSAPQLTVFSVGFPLSLSLGLLLLTVLMGNLGGFIQGLLRA 247

Query: 246 GF 247
           G 
Sbjct: 248 GL 249


>gi|121592128|gb|ABD36818.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens]
          Length = 261

 Score =  114 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 106/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + S  L + RV S +M++P    + +P +VRL FA+A ++V+ P L     +     
Sbjct: 13  STWVASFMLPLFRVASMLMVMPVFGTTLVPRRVRLYFALAITVVITPNLPPMPAVSPLDL 72

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G V G  ++++       G +++  +G+   + +  ++ ++   + 
Sbjct: 73  SG--LLLIGEQILVGAVLGFSLQLFFQAFAVAGQIVAIQMGMGFASMVDPANGVSVAVIG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  VF  L +S+ T+P+G  L     +      L       L L
Sbjct: 131 QFFTMLVTLLFLSMNGHLVVFEVLTESFTTLPVGGGLMTAQYWE-LAGKLGWVLGAALLL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG   + + +  I+ Q+      
Sbjct: 190 VLPAVTALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGLFIVWVGLADILNQYQPLASE 249

Query: 246 GF 247
             
Sbjct: 250 AL 251


>gi|149191145|ref|ZP_01869403.1| putative flagellar biosynthetic protein FliR [Vibrio shilonii AK1]
 gi|148834983|gb|EDL51962.1| putative flagellar biosynthetic protein FliR [Vibrio shilonii AK1]
          Length = 259

 Score =  114 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 99/239 (41%), Gaps = 3/239 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L+    R+    ++ P    + IP++V+L FA  FS++L P + +      F   
Sbjct: 10  QWLGILWWPFVRLTGLFLIAPFFGDNAIPVRVKLLFAFIFSLLLAPLVHEVPPFNPFSID 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   +L  G + G  + ++       G  IS  +GL +      ++ ++   +  
Sbjct: 70  TLLFSL--YQLIFGFLVGFAVMIFFTIFSIAGQAISMQMGLAMAVMNDPANGISIAIIGR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ I  +L    +D H  V     +S+   P+     F +I    + M+   F   L ++
Sbjct: 128 IMFITSMLLFLSLDAHLVVLLVFKESFTYWPLDSTFPFSSI-DYVLKMVSWMFATGLLVA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   ++ NI+ GL+NK  P + ++ +  P  + LG   L  S+  I   +    L 
Sbjct: 187 VPAIVVMLLSNITFGLMNKAAPSLNVFALGFPMTMLLGLFALMASLTGIGDHYFDLVLE 245


>gi|90406807|ref|ZP_01214999.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
 gi|90312044|gb|EAS40137.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
          Length = 264

 Score =  114 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 98/240 (40%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ +     CR+ + +M++  +     P+++RL +A+A +I +LP L   +     +  
Sbjct: 10  ELLATYLWSFCRIAAMLMVMVAVGSRTTPVRIRLFYALAITIAVLPVL-PIVQTNIELFS 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
              + +++ +L +G   G +           G +I+    L   +     +  +   +  
Sbjct: 69  LGSAFIILQQLLIGIAIGTISVFVVQTFVVAGQIIAMQTSLGFASMADPMNGQSSPVVGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L  + +D H  +   +++S+ T+P+         +          F   L  S
Sbjct: 129 FYVLLVTLLFFGVDGHLLMIEFIIRSFDTLPVSMHGLLATDYKKLAGWFSVMFSAALAFS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ K  PQ+ I+ +     +  G   L +++  +   F + +L G
Sbjct: 189 LASMVAMLLVNLSFGIMTKAAPQLNIFSLGFSISMVFGLFVLWVTLVNVPAHFENQWLRG 248


>gi|213580028|ref|ZP_03361854.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 253

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 1   WLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 57

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 58  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 117

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 118 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 177

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 178 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 237


>gi|322421719|ref|YP_004200942.1| flagellar biosynthetic protein FliR [Geobacter sp. M18]
 gi|320128106|gb|ADW15666.1| flagellar biosynthetic protein FliR [Geobacter sp. M18]
          Length = 261

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 102/235 (43%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++   L++ RV    M +P      +P +V+     A ++++ P +     +    +   
Sbjct: 13  LIPFALVLARVAGLFMAIPMFGARLVPNRVKAVLIFALALLIFPIIRLH-AIPAADDSLS 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV+ E  +G   G + +     ++F G ++ T +G+++      +       +    
Sbjct: 72  LMLLVLRESLIGLTLGAISQFVFAAVEFCGQLVGTQMGISIAAQFDPTTQNNVPTMAIFQ 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           G +  L    +  HH     +V+SY  IP+G     G +    +      F+I ++L++P
Sbjct: 132 GALATLIFLSLGVHHFFIRGIVESYQLIPLGAWHTSGGLLKFLIEASTGIFVIGIKLAAP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
                +  ++ +G++ +  P + ++ +S P  IG+G L L +S+ + +     SF
Sbjct: 192 VSVALLATSVVLGIVARSFPAMNVFMVSMPLNIGIGFLILGISLPVFLRVLQGSF 246


>gi|167464150|ref|ZP_02329239.1| flagellar biosynthesis protein FliR [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 259

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 45/245 (18%), Positives = 103/245 (42%), Gaps = 7/245 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ +  L+ CR+ +  +++P  S   +P Q ++  ++  ++++   L     +      
Sbjct: 5   QLLPNAMLVFCRITAFFVVVPTFSSRNVPSQFKIGLSLVITLIVFTALGMNNPV---TMD 61

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             Y   +  E+ +G   G +  ++   +Q  GS I   +G  +   +      +   L +
Sbjct: 62  GTYLLAIFREILVGITLGFVAYLFFTAVQIAGSFIDIQMGFGIANVIDPMTGASAPILGN 121

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPI----GQELNFGNIFSSFVNMLQTTFMIM 182
              +I  L     + HH +  A++ SY  +P+       +  G +    V    T F + 
Sbjct: 122 FKYMIATLLFLSFNGHHLLLQAIMNSYDWVPMTNEVFARVFEGQVSEWIVRSFTTMFGLA 181

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            +L++P      + ++ +GLL ++ PQ  I+ +  P+ + LG + L + +  +   F   
Sbjct: 182 FQLAAPIAAALFLTDLGLGLLTRVAPQFNIFVVGAPFKMLLGFVLLLMLLPELGSMFEKV 241

Query: 243 FLYGF 247
           F   F
Sbjct: 242 FTTMF 246


>gi|51596027|ref|YP_070218.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis IP
           32953]
 gi|153948291|ref|YP_001401273.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis IP
           31758]
 gi|170024629|ref|YP_001721134.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis
           YPIII]
 gi|186895132|ref|YP_001872244.1| flagellar biosynthesis protein FliR [Yersinia pseudotuberculosis
           PB1/+]
 gi|51589309|emb|CAH20930.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis IP
           32953]
 gi|152959786|gb|ABS47247.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis IP
           31758]
 gi|169751163|gb|ACA68681.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis
           YPIII]
 gi|186698158|gb|ACC88787.1| flagellar biosynthetic protein FliR [Yersinia pseudotuberculosis
           PB1/+]
          Length = 260

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + RV + I   P LS   I  +V++   +  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLVRVLALIGTAPLLSEKQINKKVKIGLGVLITFLIAPSLP---PVNIPLF 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    + + ++ +G   G+ ++     ++ +G VI   +GL+  T    S       L+
Sbjct: 67  SSAALWVAIQQILIGVALGVTMQFAFAAVRLSGEVIGLQMGLSFATFFDPSGGPNMPVLS 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ I+  L     D H  +   L  S+ T+PI      GN F +        FM  L L
Sbjct: 127 RLLNILVTLLFLSFDGHLWLISLLADSFHTLPIQFAPLNGNGFLTLAQSGSMIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|294140215|ref|YP_003556193.1| flagellar biosynthetic protein FliR [Shewanella violacea DSS12]
 gi|293326684|dbj|BAJ01415.1| flagellar biosynthetic protein FliR [Shewanella violacea DSS12]
          Length = 265

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 99/239 (41%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + S    + RV S  M++     +  P++VR   +MA +  ++P L    +++ F   A
Sbjct: 11  TIASYMWPLFRVSSMFMVMAVFGANTTPVRVRALLSMAITFAIVPVLPPVENVELFAASA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L   +L +G   G +  +       TG +I     L   + +  S       + +L
Sbjct: 71  MFITL--QQLLIGIAMGFVTLLVMQTFVLTGQIIGMQTSLGFASMVDPSSGQQTPVIGNL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  +    +D H  +   LV S+ TIPI  +      +    +     F   L +S 
Sbjct: 129 FLLLTTMIFLAVDGHLVMIRMLVMSFETIPISDQGLSITSYRMLADWGGYMFGAALTMSI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F+  +   
Sbjct: 189 TPIVALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLVILWLTLTPIMEHFNEVWTSA 247


>gi|311030113|ref|ZP_07708203.1| flagellar biosynthesis protein FliR [Bacillus sp. m3-13]
          Length = 258

 Score =  114 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 51/244 (20%), Positives = 103/244 (42%), Gaps = 7/244 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
              +  L++ RV +  + LP  S   +P   ++     F++V+   L    DL       
Sbjct: 7   YFPAFLLVLTRVTAFFVTLPLFSYRNVPSTFKVGLGFFFALVMSFSL----DLPIIGIDG 62

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  LV+ EL +G + GL+  +    +Q  G  I   +G  +   +     +    +   
Sbjct: 63  TYILLVIKELMVGLLIGLVAYMVLSAIQIAGGFIDFQMGFAIANVIDPQTGIQSPIMGQF 122

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLR 184
                LL L  ++ HH +   +  SY  I + Q         +F   +  + T F+I L+
Sbjct: 123 FYTFALLLLLAVNGHHLMMDGIFYSYEMIAVTQAWIPLGEAQVFEFVLKTINTMFVIALQ 182

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           L+ P +    + ++++G++ + VPQ+ ++ +  P  IG+  + +  S+ I+   F   F 
Sbjct: 183 LAIPIVGVLFLVDVALGIVARTVPQLNVFVVGLPLKIGVSFITIIFSLTILFTLFYKLFE 242

Query: 245 YGFF 248
              +
Sbjct: 243 LMLY 246


>gi|319649549|ref|ZP_08003705.1| flagellar biosynthetic protein fliR [Bacillus sp. 2_A_57_CT2]
 gi|317398711|gb|EFV79393.1| flagellar biosynthetic protein fliR [Bacillus sp. 2_A_57_CT2]
          Length = 258

 Score =  114 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 102/242 (42%), Gaps = 7/242 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +  LI  RV S  +++P  S   IP   ++      + ++   +    D+        
Sbjct: 8   FPAFLLIFVRVTSFFLMMPLFSYRSIPAAHKIGLGFFLAWIMFLGM----DVPMLEIDGT 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           YS L++ E  +G + G +  +    +Q  G  I   +G  +   +          +   +
Sbjct: 64  YSLLIIKEALVGLMVGFIAYLILSAIQIAGGFIDFQMGFAIANVIDPQTGAQSPLMGQYL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLRL 185
             I L  L  ++ HH +   +  SY  IP+ Q        ++    +  L T F+I  ++
Sbjct: 124 YTIALFFLLTVNGHHLMLDGVFYSYDFIPLDQAWISFGDEDMAEYVIKALNTMFVIAFQM 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +    + ++++G++ + VPQ+ ++ +  P  IG+  + L + + +++Y  S +F  
Sbjct: 184 SIPVVGSLFLVDVALGIVARTVPQLNVFVVGLPLKIGVSFIVLIIVMSVLMYAVSLAFET 243

Query: 246 GF 247
             
Sbjct: 244 ML 245


>gi|127512309|ref|YP_001093506.1| flagellar biosynthesis protein FliR [Shewanella loihica PV-4]
 gi|126637604|gb|ABO23247.1| flagellar biosynthetic protein FliR [Shewanella loihica PV-4]
          Length = 265

 Score =  114 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 95/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +    + RV S +M++     +  P +VRL  ++A +  + P L    +++ F   
Sbjct: 10  QTLSAYMWPLFRVSSMLMVMAVFGANTTPTRVRLLLSVAITFAIAPMLPVNTEVELFSLG 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A +  +   ++ +G   G +  +       TG +I     L   + +          + +
Sbjct: 70  AVFVTV--QQILIGVAMGFVTLLIMQTFVLTGQIIGMQTSLGFASMVDPGSGQQTPVIGN 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  +    +D H  +   LV S+ TIP+  +      +          F   L +S
Sbjct: 128 FFLLLTTMIFLAVDGHLVMIRMLVASFDTIPVSMQGISIASYRRLAEWGAYMFGAALTMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F   +   
Sbjct: 188 ISAIVALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLIILWLTLTPIMAHFDEVWRSA 247


>gi|5921666|gb|AAD01928.2| FliR [Pseudomonas putida]
          Length = 258

 Score =  114 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 109/241 (45%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M++P L    +P +VRL  A+A ++V++P L    +      +
Sbjct: 11  TWVATFMLPLFRVVAMMMVMPILGTRMLPSRVRLYAAVAITVVIVPGLPPLPEFDPLSVQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + GL +++        G +++  +G+   + +  ++ +    ++ 
Sbjct: 71  G--LLLCAEQIIVGTLFGLSLQLLFQVFVLAGQIVAIQMGMAFASMVDPANGVNVAVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   +++ H  +F  L +S+ T+P+G  L   N F      L   F   L L 
Sbjct: 129 FMSMLVSVLFLLMNGHLVMFEVLTESFTTLPVGNALMI-NHFWEIAGRLSWVFGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++ G++ +  PQ+ I+ I  P  + +G L   + +  I+  +       
Sbjct: 188 LPAIAALLVVNVAFGVMTRAAPQLNIFSIGFPLTLVMGMLIFWIGLADILSHYQALASEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|300693819|ref|YP_003749792.1| hrp conserved hrct protein, type III secretion system inner
           membrane protein [Ralstonia solanacearum PSI07]
 gi|299075856|emb|CBJ35165.1| Hrp conserved hrct protein, Type III secretion system inner
           membrane protein [Ralstonia solanacearum PSI07]
          Length = 282

 Score =  114 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 35/227 (15%), Positives = 81/227 (35%), Gaps = 4/227 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R     A +I++       + L   +  A    L   E
Sbjct: 30  VRIMTLFAILPATNDQMLTGVARNGVVYALAILVA--AGQPVGLAAHLGAAQLFMLTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  + +   
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTIIDNVSGFNNVQMTNPLRGDQNTPIGNTLVNLAVTLF 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   N+ +    +    + F + ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFQWWPLGAALPDMNVVAQSFLLQQTDSIFSMAVKLAAPVMMTVL 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  IGLL +   ++    +  P    +  L +   +  +  Q   
Sbjct: 208 LIDAGIGLLARAADKLEPTSLGQPIKGAVALLMVMALVTALSTQVKG 254


>gi|313200555|ref|YP_004039213.1| flagellar biosynthetic protein flir [Methylovorus sp. MP688]
 gi|312439871|gb|ADQ83977.1| flagellar biosynthetic protein FliR [Methylovorus sp. MP688]
          Length = 256

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 101/245 (41%), Gaps = 2/245 (0%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           T   +  ++ L   + R+ + I + P LS   I  +V++  A+  ++ LLP L     L 
Sbjct: 6   TDILQSWIVLLLWPMTRILAMIAVAPVLSHRSISARVKISMALMMTLALLPSLPQPPLLD 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
            F        ++  ++ +G   G  +R+    ++  G +I   +GL              
Sbjct: 66  IFS--WKGILVLAQQMVIGFAIGFSMRIVFAAVEMAGQMIGMTMGLGFAMFYDPQTQGQS 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             ++  + ++  L    +D H  +  A+++S+   P+  E   G  F    N     F  
Sbjct: 124 NAISQFMVLLTTLIFLSLDGHLLMISAVMESFANFPLSAEWQGGLDFMKMANWGGKIFSA 183

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L +S P +   ++ N+++G+L +  PQ+ ++ I  P  I +G + + L +  I+     
Sbjct: 184 GLLISLPAIAALLITNMALGILTRTAPQLNLFGIGFPVTIAIGYVVVALVLPGILQPILQ 243

Query: 242 SFLYG 246
                
Sbjct: 244 LIQES 248


>gi|331006681|ref|ZP_08329959.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC1989]
 gi|330419513|gb|EGG93901.1| Flagellar biosynthesis protein FliR [gamma proteobacterium
           IMCC1989]
          Length = 258

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 95/239 (39%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   FL + R+ S  M  P  S   +  ++RL   ++ +I+++P L     +       
Sbjct: 12  WVSQYFLPLVRLASFFMAAPIFSTRIVSTRIRLILTLSITILIVPILPPAPLVSGIDVSM 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +V  ++ +G   G   +V        G  I+  +GL   +    S+ ++ T ++  
Sbjct: 72  --FIIVAQQILIGVALGFTFQVVFQLFVLAGQYIAMKLGLGFASMNDPSNGVSVTIVSQF 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +   L     + H  +   LV S+  IPIG      +     V +    F   L +S 
Sbjct: 130 YLLTTTLLFLSFNGHLILIQILVDSFTAIPIGTVGISTSNIYRIVELGGWMFGSALVISM 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P L   +V N++ G++++  PQ+ I+ +  P  +  G + + +     +  F      G
Sbjct: 190 PVLTALLVVNVAFGVMSRSAPQMNIFAVGFPITLIFGLMIMWVGFSAFLSSFELFIDEG 248


>gi|292493585|ref|YP_003529024.1| flagellar biosynthetic protein FliR [Nitrosococcus halophilus Nc4]
 gi|291582180|gb|ADE16637.1| flagellar biosynthetic protein FliR [Nitrosococcus halophilus Nc4]
          Length = 258

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/246 (17%), Positives = 102/246 (41%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +     ++ +     CR+G+ +M +P    + +P++VRL  A+A ++V+ P +  T    
Sbjct: 5   SDEISALIGAYLWPFCRIGALLMAVPLFGSAVVPVRVRLVLALALTVVIAPVIPTTPVSP 64

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
             +       L++ +  +G     ++++        G  ++  +GL   + +     ++ 
Sbjct: 65  LSLQGG---LLIIQQFLIGIAMAFVLQMVFQAFVIGGQTVAMQMGLGFASMIDPQHGVSV 121

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
           + ++ L  I+  L    +D H  V   L +S+  +P+G      + F   V      F  
Sbjct: 122 SMISQLYQILITLVFLALDGHLVVIQVLAESFYRLPLGMSGLNSDNFWQLVGGGSWMFAG 181

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            + ++ P +   ++ N++ G++ +  PQ+  + I  P  + LG   L  ++        +
Sbjct: 182 SMLIALPAIGALLLVNLTFGVMTRAAPQLNPFSIGFPLTLILGFGILLFTLPSTSSHLVN 241

Query: 242 SFLYGF 247
                 
Sbjct: 242 LVDTAL 247


>gi|251789176|ref|YP_003003897.1| flagellar biosynthetic protein FliR [Dickeya zeae Ech1591]
 gi|247537797|gb|ACT06418.1| flagellar biosynthetic protein FliR [Dickeya zeae Ech1591]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/246 (21%), Positives = 103/246 (41%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +I         F  + R+ + I   P  S   I  +V+L   +  +I ++P +  T    
Sbjct: 6   SIDMIGWFNQFFWPLVRILALISTAPIFSERAITRRVKLGLGVLITIAIMPAIPHT---S 62

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
             +  A    ++  ++ +G + G  +++    ++  G +I   +GL+  T    S     
Sbjct: 63  IPIFSAAGIWMLFQQVVIGVMLGFTMQLAFTAIRLAGEIIGLQMGLSFATFFDPSGGPNM 122

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             +   + ++ LL    ++ H  +   L  S+ TIPIG     GN+F S        F  
Sbjct: 123 PVIARFMNLLALLLFLTMNGHLWLISLLADSFHTIPIGAGPVSGNVFMSLAEAGGRIFSN 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L L+ P +   +  N+++GLL++L PQ+ I+ I  P  +  G + +   I +I      
Sbjct: 183 GLMLALPLITLLLTINMALGLLSRLAPQLTIFAIGFPITLFTGIITVGFLIFLISPYAEK 242

Query: 242 SFLYGF 247
            F   +
Sbjct: 243 LFGETY 248


>gi|307824491|ref|ZP_07654716.1| flagellar biosynthetic protein FliR [Methylobacter tundripaludum
           SV96]
 gi|307734475|gb|EFO05327.1| flagellar biosynthetic protein FliR [Methylobacter tundripaludum
           SV96]
          Length = 238

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 100/231 (43%), Gaps = 2/231 (0%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +  + +P  S+  +P +VRL  ++  ++V++P L     ++ F    + + +   +
Sbjct: 1   MRISAMFVAVPLFSIKAVPARVRLILSVVITLVVMPLLPPLPSVEMFSYAGFMTAIA--Q 58

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G   G ++++      F G  ++ ++GL     +          +  L  +   L  
Sbjct: 59  VMIGLTTGFILQLVFAAAVFAGQSVALSMGLGFSMMVDPQSGQQVPVIAQLYTVTTTLIF 118

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
             +D H  +   L+ S+ T+PIG +        S +      F   L L+ P +   ++ 
Sbjct: 119 ISLDGHLLLIQMLLDSFKTLPIGIDGIDKAGIWSIIAWSSRMFAGGLLLTMPIIASLLLV 178

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           NI  G+  +  PQ+ I+ +  P  + LG L +  ++  ++ QFS      +
Sbjct: 179 NIIFGVAARAAPQLQIFSVGIPVTLMLGLLLIWKTLPDVLDQFSGMLTDAY 229


>gi|253998480|ref|YP_003050543.1| flagellar biosynthetic protein FliR [Methylovorus sp. SIP3-4]
 gi|253985159|gb|ACT50016.1| flagellar biosynthetic protein FliR [Methylovorus sp. SIP3-4]
          Length = 256

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 100/245 (40%), Gaps = 2/245 (0%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           T   +  ++ L   + R+ + I + P LS   I  +V++  A+  ++ LLP L     L 
Sbjct: 6   TDILQSWIVLLLWPMTRILAMIAVAPVLSHRSISARVKISMALMMTLALLPSLPQPPLLD 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
            F  R         ++ +G   G  +R+    ++  G +I   +GL              
Sbjct: 66  IFSWRGMLVL--AQQMVIGFAIGFSMRIVFAAVEMAGQMIGMTMGLGFAMFYDPQTQGQS 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             ++  + ++  L    +D H  +  A+++S+   P+  E   G  F    N     F  
Sbjct: 124 NAISQFMVLLTTLIFLSLDGHLLMISAVMESFANFPLSAEWQGGLDFMKMANWGGKIFSA 183

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L +S P +   ++ N+++G+L +  PQ+ ++ I  P  I +G + + L +  I+     
Sbjct: 184 GLLISLPAIAALLITNMALGILTRTAPQLNLFGIGFPVTIAIGYVVVALVLPGILQPILQ 243

Query: 242 SFLYG 246
                
Sbjct: 244 LIQES 248


>gi|149182521|ref|ZP_01860994.1| flagellar biosynthesis protein R [Bacillus sp. SG-1]
 gi|148849781|gb|EDL63958.1| flagellar biosynthesis protein R [Bacillus sp. SG-1]
          Length = 258

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/243 (21%), Positives = 99/243 (40%), Gaps = 7/243 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L+  RV +  + LP  S   IP Q R+ FA   + ++      TID       A 
Sbjct: 8   LSIFLLVFMRVSAFFVTLPLFSYRSIPAQHRVGFAGVIAWIMY----YTIDASPMPIDAA 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L+M E  +G + G    +    +Q  GS I   +G  +   +          +   +
Sbjct: 64  YILLIMKEAMIGLLIGFTAYMIISAIQVAGSFIDFQMGFAIANVIDPQTGAQSPLVGQYL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLRL 185
               LL L  +D HH +   +  SY  IP+ Q        N+    V    + F+I  ++
Sbjct: 124 YTFALLLLLALDGHHLLLDGVFYSYQFIPVDQPWIPFGNENLVEYIVKTFNSVFIIAFQM 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P +    + ++++G++ + VPQ+ ++ +  P  I +  L L + +  ++      F  
Sbjct: 184 SIPVVATLFLVDVALGIVARTVPQLNVFVVGFPIKIAVSFLVLFIVLGAMMTVMQQMFEL 243

Query: 246 GFF 248
             +
Sbjct: 244 MMY 246


>gi|89895722|ref|YP_519209.1| hypothetical protein DSY2976 [Desulfitobacterium hafniense Y51]
 gi|219670146|ref|YP_002460581.1| flagellar biosynthetic protein FliR [Desulfitobacterium hafniense
           DCB-2]
 gi|89335170|dbj|BAE84765.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219540406|gb|ACL22145.1| flagellar biosynthetic protein FliR [Desulfitobacterium hafniense
           DCB-2]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 109/238 (45%), Gaps = 2/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    LI+ R    IML P      +P  V+L  A++ SI+L P +      Q       
Sbjct: 11  LTLFLLILSRWAGMIMLAPVFGARGVPAMVKLGLAVSISIILYPLIMAAGP-QIPSETLP 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y+ L++ E+ +G V G +I   T  L+  G +I   +G N+  ++     +    + +  
Sbjct: 70  YAALLIKEIVVGLVIGFVIYAITAVLEGAGQLIDMQMGFNMSGAIDPIFGVQSAMMGNFQ 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+ ++ L   + HH +  A+VKSY  +PI        + + ++ +++  F + ++L+ P
Sbjct: 130 MILAIMLLLATNSHHYLIAAMVKSYTYVPINPGALPQGL-NYYIFLIREIFTLSVQLALP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +   ++ +I +GLL + VPQ+ I+ +  P  I  G   L L I       +  F   
Sbjct: 189 VIGALVLTDIGVGLLMRTVPQMNIFTVIFPVKIIFGFTILFLGIGFFGETVNMLFERA 246


>gi|254506950|ref|ZP_05119089.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus 16]
 gi|219550235|gb|EED27221.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus 16]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 95/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++P +VRL   +A +  ++P +         ++  
Sbjct: 11  WLANYFWPYTRISAMLMVMSVTGARFVPTRVRLYLGLALTFAVMPVIPAVPKEIELLSFE 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + ++ +G   G + +         G ++     L   + +  ++      L  L
Sbjct: 71  GFLTL-LEQIVIGVAMGTVTQFMIQTFVILGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ ++PIG        F    + L   F + L +S 
Sbjct: 130 FMFLATMFFLATDGHLKMIMLVVMSFQSLPIGAGSLTTVDFRELASWLGIMFKVSLSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +L G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILGGLYSHYELFWLQG 248


>gi|258621116|ref|ZP_05716150.1| flagellar biosynthesis protein [Vibrio mimicus VM573]
 gi|258626189|ref|ZP_05721037.1| flagellar biosynthesis protein [Vibrio mimicus VM603]
 gi|261209857|ref|ZP_05924158.1| flagellar biosynthesis protein FliR [Vibrio sp. RC341]
 gi|262166222|ref|ZP_06033959.1| flagellar biosynthesis protein FliR [Vibrio mimicus VM223]
 gi|262170892|ref|ZP_06038570.1| flagellar biosynthesis protein FliR [Vibrio mimicus MB-451]
 gi|262404467|ref|ZP_06081022.1| flagellar biosynthesis protein FliR [Vibrio sp. RC586]
 gi|258581544|gb|EEW06445.1| flagellar biosynthesis protein [Vibrio mimicus VM603]
 gi|258586504|gb|EEW11219.1| flagellar biosynthesis protein [Vibrio mimicus VM573]
 gi|260841043|gb|EEX67568.1| flagellar biosynthesis protein FliR [Vibrio sp. RC341]
 gi|261891968|gb|EEY37954.1| flagellar biosynthesis protein FliR [Vibrio mimicus MB-451]
 gi|262025938|gb|EEY44606.1| flagellar biosynthesis protein FliR [Vibrio mimicus VM223]
 gi|262349499|gb|EEY98637.1| flagellar biosynthesis protein FliR [Vibrio sp. RC586]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 92/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++P +VRL   +A +  ++P +         ++  
Sbjct: 11  FIANYFWPYTRIAAMLMVMTVTGARFVPARVRLYLGLALTFAVMPAIPAVPSDIALLSLQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   ++ +G   G++ +         G ++     L   + +  ++      L  +
Sbjct: 71  GF-MITFEQIVIGMAMGMVTQFLVQIFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQM 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L     D H ++   +V S+ ++PIG        +      L   F   L +S 
Sbjct: 130 FMLLATLFFLSSDGHLKMIQLVVFSFKSLPIGSGSLTTVDYRELALWLGIMFKASLAVSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +   
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYILSGLYTHYEIYWQET 248


>gi|152997435|ref|YP_001342270.1| flagellar biosynthetic protein FliR [Marinomonas sp. MWYL1]
 gi|150838359|gb|ABR72335.1| flagellar biosynthetic protein FliR [Marinomonas sp. MWYL1]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 92/237 (38%), Gaps = 4/237 (1%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +S  L   R+G+  M LP      +  +VR+ F+   +I++ P +              Y
Sbjct: 14  ISFLLPFFRIGAFFMALPLFGSRLVSPRVRIAFSFLVAIIITPVIDVPNYDPI---SPAY 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             L+  +L +G V G ++ +        G + +   GL    S   ++ ++   L     
Sbjct: 71  IVLIAEQLVIGFVLGFVVTILFQLFSLAGQLAAMKAGLGFAMSNDPANGISVATLGQYYL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            +  LA    + H  +   L +S+   PIG   +    +   V +    F   L +  P 
Sbjct: 131 SMVALAFLGTNGHLVMIEYLAESFNYWPIGSGFDSQR-YWQLVLLGGWMFEKALLIVLPL 189

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
               +V N+S G++ K  PQ+ ++ +  P ++     F  + ++  +  +   F   
Sbjct: 190 AVAVLVINLSFGVVAKASPQLNVFALGFPIIMLFSLFFFWIMLDDFLNIYLLFFGEM 246


>gi|85711030|ref|ZP_01042090.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
 gi|85694943|gb|EAQ32881.1| flagellar biosynthesis protein [Idiomarina baltica OS145]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 95/240 (39%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + RV S +M +   S + +  ++++  ++A +  + P L D          
Sbjct: 10  EWLQQHLWPLTRVSSMLMSMALFSGTLVNSRIKVLLSLAITFAISPALPDVNPGVEIFTV 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +   ++ +G   GLL  ++       G +I+  IGL   + +  ++      +  
Sbjct: 70  GGML-VTAQQIVIGVALGLLSLLFLQTFVLGGQIIAMQIGLGFASMVDPTNGQQVPVIAQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    +D H  +   +V S+ ++P+       + F    +   + F   L   
Sbjct: 129 FFLMLASLIFLALDGHLLMIQMVVASFDSVPVAMTGLNADAFRMIADWGSSMFSAALTAM 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++   ++ F + +   
Sbjct: 189 LSGIIALLLINLSFGVMTRAAPQLNIFAIGFPITMVSGLIVLWLTLGGFIFHFENQWQEA 248


>gi|212634379|ref|YP_002310904.1| flagellar biosynthesis protein FliR [Shewanella piezotolerans WP3]
 gi|212555863|gb|ACJ28317.1| Flagellar biosynthetic protein FliR [Shewanella piezotolerans WP3]
          Length = 266

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 91/237 (38%), Gaps = 2/237 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +      + R+ S  M++     +  P +VRL  ++  +  ++P L    D++ F   A 
Sbjct: 12  IAGYMWPLTRISSMFMVMAVFGANTTPSRVRLLLSLTVTAAVVPVLPPMPDIELFSLSAV 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +      ++ +G   G    +       TG +I     L   + +          + +  
Sbjct: 72  FVT--FQQIIIGVSMGFSTLLLMQTFVLTGQIIGMQTSLGFASMIDPGSGQQTPVVANFF 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  +    +D H  +   +V S+ +IP+  E      +  F   +   F   L +S  
Sbjct: 130 LLLTTMIFLAVDGHLILIKMVVASFDSIPVSMEGLSLASYRMFTEFVGYMFGAALTMSLS 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +   +  N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F   +  
Sbjct: 190 AIVALLTINLSFGVMTRASPQLNIFAIGFPVTMVSGLFILWLTLTPIMAHFDEVWRE 246


>gi|311068159|ref|YP_003973082.1| flagellar biosynthesis protein FliR [Bacillus atrophaeus 1942]
 gi|310868676|gb|ADP32151.1| flagellar biosynthesis protein FliR [Bacillus atrophaeus 1942]
          Length = 259

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 95/239 (39%), Gaps = 6/239 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+ +  + +P      +P   R+ FA   +++    L     ++      
Sbjct: 7   LFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTLDQAPSIEI---DE 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +Y  L + E  +G   GL+  +    +Q  GS I   +G  +   +          +   
Sbjct: 64  HYMLLAVKETVVGLSLGLIAFIMIAAVQIAGSFIDFQMGFAIANVIDPQTGAQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLR 184
           I  + LL +  ++ HH +   +  S+  I I Q                     F+I  +
Sbjct: 124 IYTMALLFMLSVNAHHLLLDGIYYSFQYISIDQAFPAFGNEEFAYFIAKSFNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + +I     + F
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFGVIQNIF 242


>gi|302384125|ref|YP_003819948.1| flagellar biosynthetic protein FliR [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194753|gb|ADL02325.1| flagellar biosynthetic protein FliR [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 257

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 116/235 (49%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + +  LI  R+G+ ++ LPG+  SY+P ++RL  A+  S+ L P +  ++          
Sbjct: 10  VWAGGLIFARIGAILLSLPGIGESYVPPRIRLSLALVVSLALWPIVSPSLPA-LPETIGG 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               ++ E+  G + G ++R +T  L   G ++S    L+   +     +     +++ +
Sbjct: 69  MVGWIIREVVTGLMIGAILRAFTGALATAGEIVSLQTTLSFAQTANPLQAQPGATISAFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I+G + ++  + HH     LV SY  I   + L   +     +  +  +FM+ ++L++P
Sbjct: 129 MILGTVLVFATNTHHLFIAGLVGSYELIAPARPLIMADFTELAIRTIADSFMLGVQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            + F ++FN++ GL+ +++PQ  ++F + P  + LG     LS+ ++   F   +
Sbjct: 189 VIVFALIFNLASGLVARVMPQFQVFFAAAPLSVILGLSIFALSLGVMGTVFIDRY 243


>gi|58582236|ref|YP_201252.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58426830|gb|AAW75867.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 263

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 90/242 (37%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  A--VLSIARELAIGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 134 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L+K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALSKAAPALNPVQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|238751769|ref|ZP_04613257.1| Flagellar biosynthetic protein fliR [Yersinia rohdei ATCC 43380]
 gi|238710040|gb|EEQ02270.1| Flagellar biosynthetic protein fliR [Yersinia rohdei ATCC 43380]
          Length = 260

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + R+ + I   P LS   I  +V++  A+  + ++ P L     +   +   
Sbjct: 12  WVSLYFWPLIRILALITTAPVLSEKQINRKVKVGLAVLITFLIAPSLP---PVNIPLFST 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L   
Sbjct: 69  AGLWVAAQQILIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I+ +L     D H  +   L  S+ T+PI  E   GN F +        F+  L L+ 
Sbjct: 129 LNILAMLLFLCFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTQAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + + L + ++     H F   F
Sbjct: 189 PLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISIGLIMPLLAPFTEHLFGEFF 248


>gi|54307251|ref|YP_128271.1| flagellar biosynthetic protein FliR [Photobacterium profundum SS9]
 gi|46911671|emb|CAG18469.1| Hypothetical flagellar biosynthetic protein FliR [Photobacterium
           profundum SS9]
          Length = 259

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  ++    R+G+ ++++P    S IP QVR+  A   S++  P +     +      
Sbjct: 11  AWLGQIWWPFFRLGAAMLMMPVFGGSTIPTQVRVGLAFCISLLAAPLMPPMPSVDPLSLD 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L + ++ +G + GL++ +        G ++S  +GL +  S    + ++   L  
Sbjct: 71  A--LILGVQQMIIGGIMGLMLELLFGVFTTMGQILSMQMGLGMAMSNDPINGVSIPTLGK 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +  LL    +D H      +V+S+   P+G+ +   +   S V  L         L+
Sbjct: 129 YYQLYILLLFLALDGHLVALDVVVQSFNVWPVGE-MPSQDALYSVVMRLGWLIAAAFLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N + G++N+  PQ+ ++ +  P  + LG + L ++   I   F+      
Sbjct: 188 LPAVCAMLLVNGAFGMMNRAAPQLNVFALGFPMTMLLGLMCLLITTSSIPENFTRLCSET 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|323698076|ref|ZP_08109988.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. ND132]
 gi|323458008|gb|EGB13873.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           ND132]
          Length = 262

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 96/235 (40%), Gaps = 2/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++S FL + R+   + LLP      IP  V+    +  S+ L P L  +           
Sbjct: 11  LLSYFLTLFRISVVLFLLPFFGGQSIPKVVKAALVLVLSMALWPQL--SFPGSLMPTGWN 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + + + EL LG + G+L+      +Q  G +I   +G  +   +      +       +
Sbjct: 69  IAIMFLGELVLGLILGMLVNFLFAAVQLGGQIIGFQMGFAMVNVVDPITGTSNAVSAHFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +  +L   V++ H  +  A+  S+  IP G  L    + +   +     F + +++++P
Sbjct: 129 YMCTMLTFLVLNGHLYLLKAVGMSFQYIPPGTLLLQPELANDIFHFSNLMFTLAIKIAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +    + ++S+ L+++  PQ+ +  +  P  I +G  FL     I+        
Sbjct: 189 VMAALFLVDLSLALISRAAPQMHVLILGFPIKITVGFFFLGFIFSIMAQYVGDYL 243


>gi|134300233|ref|YP_001113729.1| flagellar biosynthesis protein FliR [Desulfotomaculum reducens
           MI-1]
 gi|134052933|gb|ABO50904.1| flagellar biosynthetic protein FliR [Desulfotomaculum reducens
           MI-1]
          Length = 255

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 101/239 (42%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + + + FL+  R+ S I   P  ++  IP  V+   ++  + +  P +            
Sbjct: 5   VYVTTFFLVFVRMLSFIFSCPLYAIPGIPPLVKAGLSLVLAALTAPLVEPA-AASFPGGL 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                 V  E+ +G   GL+       ++  G ++   IG  +   M        T ++ 
Sbjct: 64  WGLGLAVFSEVGVGLAIGLVCTFVFNAIRIAGQLLDFQIGFAMAAVMDPLGGGMNTLVSR 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + L+    +D HH +  ALVKSY  +P+      G +    + +   TF + +++ 
Sbjct: 124 FLFFMTLVLYMNMDGHHALIRALVKSYELVPLTAAAMNGELTLLIIRIFTDTFALAVQIC 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           +P +   ++ ++++GL+ K  PQ+ I+ +  P  I +G   L + +  +   F + F  
Sbjct: 184 APVVAVLVITDLAMGLIGKTAPQLNIFQLGFPLKIAVGVSTLAILLPALTSVFKYLFDT 242


>gi|332531135|ref|ZP_08407049.1| flagellar biosynthetic protein FliR [Hylemonella gracilis ATCC
           19624]
 gi|332039420|gb|EGI75832.1| flagellar biosynthetic protein FliR [Hylemonella gracilis ATCC
           19624]
          Length = 255

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 91/240 (37%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L     RV +     P  S    P++ R+  A+  ++     L     +      
Sbjct: 11  AWLTPLLWPFLRVLAVFTSAPIFSTRAFPVRARILLALLVAVCAQATLPPMPVISLNSPE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    + + ++ +G   G ++R+     +  G VI   +GL   +    + S     +  
Sbjct: 71  A--LGVTVQQVAIGLAIGFVVRLVFASFELAGEVIGFQMGLGFASFFDPALSGQSNAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
             G I  L   V++ H  V  A+  S+   P+  +            +    F   L ++
Sbjct: 129 FFGYIAALLFVVLNGHLLVLMAVTHSFVAFPVSPDFLSNVRSMQIHLLGGELFASALWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+++++ PQ+ ++ I  P  I +G + L  ++ ++   F       
Sbjct: 189 LPMIGLMLFANLALGIISRVAPQMNVFAIGFPLTIFVGLIGLTATLPMLDGPFQSLLERM 248


>gi|74101642|gb|AAZ99732.1| FliRL [Aeromonas hydrophila]
          Length = 260

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/236 (19%), Positives = 99/236 (41%), Gaps = 3/236 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +    R+ +   ++P      IP QVRL  A   S+++ P L     +  F   
Sbjct: 14  AWLGQWWWPFIRIATAFWVMPVFGDGRIPPQVRLLLAFIVSLLIAPMLKKMPVVDPFSTG 73

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L + +L  G + GL +++  + +   G ++S  +G  +      S+      ++ 
Sbjct: 74  A--LVLTVEQLLFGLLFGLCVQMLFMIMTMAGQILSMQMGPAMAVMNDPSNGDFAPIVSQ 131

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ I   L    ++ H      LV+S  + P G  L+  +     + +        L L+
Sbjct: 132 LMLIFCSLLFLGLNGHLVTLDVLVQSLRSWPPGSSLDLLD-MKGIIGLFGWCIGAALILT 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P +   ++ N++ G++N+  P + I+ +  P  + LG + + +SI  +  ++   
Sbjct: 191 LPAVVAMLMVNLTFGVMNRTAPSLNIFSLGFPMTLLLGLVTMAISISGVPARYLDL 246


>gi|254462422|ref|ZP_05075838.1| flagellar biosynthetic protein FliR [Rhodobacterales bacterium
           HTCC2083]
 gi|206679011|gb|EDZ43498.1| flagellar biosynthetic protein FliR [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 273

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 100/234 (42%), Gaps = 2/234 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +  FL   R+ +  +  P    + IP+QVR+  ++  S+     +   +     +     
Sbjct: 27  LVFFLHTIRLSAFFLSAPFFGAASIPVQVRVMVSILISVSFFGKV--EVPDPQTLPFLLL 84

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
            +++MVE+ +G + GL++ V    +   G  ++++ GL     +  +       ++ L+ 
Sbjct: 85  VEVIMVEIAMGLLLGLILTVLFSSVALAGEKVASSAGLGFAAQVDPNLGGQTPVISQLLN 144

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           + G++    +D H      +  SY  +P+G+  NF  + +S +      F +   LS P 
Sbjct: 145 LFGIVLFLAMDGHLVCIALIKGSYDLMPLGRPFNFQALIASGLTSGGHMFSMASLLSFPI 204

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +   ++ NI++G++ +  PQ+ ++    P  I      L  +   + +      
Sbjct: 205 VAILLLANITVGVITRSAPQLNLFSFGFPLTILACFFALYFATTPMAFATRDLL 258


>gi|332161330|ref|YP_004297907.1| flagellar biosynthesis protein FliR [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665560|gb|ADZ42204.1| flagellar biosynthesis protein FliR [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861096|emb|CBX71363.1| flagellar biosynthetic protein fliR [Yersinia enterocolitica
           W22703]
          Length = 260

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + R+ + I   P LS   I  +V++  A+  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLIRILALISTAPVLSEKQINRKVKVGLAVLITFLIAPSLP---PVNIPLV 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L 
Sbjct: 67  SSGALWVAGQQVLIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L     D H  +   L  S+ T+PI  E   GN F +        FM  L L
Sbjct: 127 RLLNLLAMLLFLSFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTEAGSLIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|126653731|ref|ZP_01725649.1| flagellar biosynthesis protein R [Bacillus sp. B14905]
 gi|126589695|gb|EAZ83831.1| flagellar biosynthesis protein R [Bacillus sp. B14905]
          Length = 257

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/242 (21%), Positives = 103/242 (42%), Gaps = 6/242 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L++ RV +  + +P  S   IP QV++  A+  + ++      TID++ F     
Sbjct: 8   LTVFLLVLVRVSAFFVTVPFFSYRTIPPQVKITLALVLAWMMY----YTIDVEPFAFNDE 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LVM E  +G + GL+  +    +Q  GS I   +G  +   +          +    
Sbjct: 64  YILLVMKEALVGLLLGLVGYIIMSAIQIAGSFIDFQMGFAIANIIDPQTGAQSPLIGQFF 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN--IFSSFVNMLQTTFMIMLRLS 186
            ++  L L  I+ HH +   +  SY  +P+ Q  +F N       +      F I  +++
Sbjct: 124 NMLAFLLLLAINGHHMILDGIYYSYQFLPMDQFPSFTNEGFPQFIITTFTAVFAIAFQMA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           +P +    + ++++G+  K VPQ+ I+ +  P  I +  L L   + +++          
Sbjct: 184 APVVATLFLVDLALGITAKTVPQLNIFVVGFPIKIAVSFLVLFTMMAVMIQVIQKLITIM 243

Query: 247 FF 248
            +
Sbjct: 244 IY 245


>gi|169827138|ref|YP_001697296.1| flagellar biosynthesis protein FliR [Lysinibacillus sphaericus
           C3-41]
 gi|168991626|gb|ACA39166.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 257

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 104/242 (42%), Gaps = 6/242 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L++ RV +  + +P  S   IP QV++  A+  + ++      TID++ F     
Sbjct: 8   LTVFLLVLVRVSAFFVTVPFFSYRTIPPQVKITLALVLAWMMY----YTIDVEPFAFNDD 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LVM E  +G + GL+  +    +Q  GS I   +G  +   +          +    
Sbjct: 64  YILLVMKEALVGLLLGLVGYIIMSAIQIAGSFIDFQMGFAIANIIDPQTGAQSPLIGQFF 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN--IFSSFVNMLQTTFMIMLRLS 186
            ++  L L  I+ HH +   +  SY  +P+ Q  +F N       +      F I  +++
Sbjct: 124 NMLAFLLLLAINGHHMILDGIYYSYQFLPMDQFPSFTNDSFPQFIITTFTAVFAIAFQMA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           +P +    + ++++G+  K VPQ+ I+ +  P  IG+  L L   + +++          
Sbjct: 184 APVVATLFLVDLALGITAKTVPQLNIFVVGFPIKIGVSFLVLFTMMAVMIQVIQKLITIM 243

Query: 247 FF 248
            +
Sbjct: 244 IY 245


>gi|15642120|ref|NP_231752.1| flagellar biosynthesis protein FliR [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586827|ref|ZP_01676609.1| flagellar biosynthetic protein FliR [Vibrio cholerae 2740-80]
 gi|121727225|ref|ZP_01680392.1| flagellar biosynthetic protein FliR [Vibrio cholerae V52]
 gi|147673452|ref|YP_001217642.1| flagellar biosynthesis protein FliR [Vibrio cholerae O395]
 gi|153213230|ref|ZP_01948642.1| flagellar biosynthetic protein FliR [Vibrio cholerae 1587]
 gi|153803024|ref|ZP_01957610.1| flagellar biosynthetic protein FliR [Vibrio cholerae MZO-3]
 gi|153818966|ref|ZP_01971633.1| flagellar biosynthetic protein FliR [Vibrio cholerae NCTC 8457]
 gi|153822888|ref|ZP_01975555.1| flagellar biosynthetic protein FliR [Vibrio cholerae B33]
 gi|153825611|ref|ZP_01978278.1| flagellar biosynthetic protein FliR [Vibrio cholerae MZO-2]
 gi|153828645|ref|ZP_01981312.1| flagellar biosynthetic protein FliR [Vibrio cholerae 623-39]
 gi|227082246|ref|YP_002810797.1| flagellar biosynthetic protein FliR [Vibrio cholerae M66-2]
 gi|229507794|ref|ZP_04397299.1| flagellar biosynthesis protein FliR [Vibrio cholerae BX 330286]
 gi|229511969|ref|ZP_04401448.1| flagellar biosynthesis protein FliR [Vibrio cholerae B33]
 gi|229513772|ref|ZP_04403234.1| flagellar biosynthesis protein FliR [Vibrio cholerae TMA 21]
 gi|229519105|ref|ZP_04408548.1| flagellar biosynthesis protein FliR [Vibrio cholerae RC9]
 gi|229522074|ref|ZP_04411491.1| flagellar biosynthesis protein FliR [Vibrio cholerae TM 11079-80]
 gi|229524123|ref|ZP_04413528.1| flagellar biosynthesis protein FliR [Vibrio cholerae bv. albensis
           VL426]
 gi|229607339|ref|YP_002877987.1| flagellar biosynthesis protein FliR [Vibrio cholerae MJ-1236]
 gi|254226358|ref|ZP_04919947.1| flagellar biosynthetic protein FliR [Vibrio cholerae V51]
 gi|254291357|ref|ZP_04962150.1| flagellar biosynthetic protein FliR [Vibrio cholerae AM-19226]
 gi|254849206|ref|ZP_05238556.1| flagellar biosynthesis protein FliR [Vibrio cholerae MO10]
 gi|255745140|ref|ZP_05419089.1| flagellar biosynthesis protein FliR [Vibrio cholera CIRS 101]
 gi|262153470|ref|ZP_06028600.1| flagellar biosynthesis protein FliR [Vibrio cholerae INDRE 91/1]
 gi|262167480|ref|ZP_06035186.1| flagellar biosynthesis protein FliR [Vibrio cholerae RC27]
 gi|262191370|ref|ZP_06049560.1| flagellar biosynthesis protein FliR [Vibrio cholerae CT 5369-93]
 gi|298497857|ref|ZP_07007664.1| flagellar biosynthetic protein FliR [Vibrio cholerae MAK 757]
 gi|9656671|gb|AAF95266.1| flagellar biosynthetic protein FliR [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121548994|gb|EAX59033.1| flagellar biosynthetic protein FliR [Vibrio cholerae 2740-80]
 gi|121630470|gb|EAX62863.1| flagellar biosynthetic protein FliR [Vibrio cholerae V52]
 gi|124116030|gb|EAY34850.1| flagellar biosynthetic protein FliR [Vibrio cholerae 1587]
 gi|124121422|gb|EAY40165.1| flagellar biosynthetic protein FliR [Vibrio cholerae MZO-3]
 gi|125621108|gb|EAZ49453.1| flagellar biosynthetic protein FliR [Vibrio cholerae V51]
 gi|126510461|gb|EAZ73055.1| flagellar biosynthetic protein FliR [Vibrio cholerae NCTC 8457]
 gi|126519584|gb|EAZ76807.1| flagellar biosynthetic protein FliR [Vibrio cholerae B33]
 gi|146315335|gb|ABQ19874.1| flagellar biosynthetic protein FliR [Vibrio cholerae O395]
 gi|148875916|gb|EDL74051.1| flagellar biosynthetic protein FliR [Vibrio cholerae 623-39]
 gi|149740762|gb|EDM54861.1| flagellar biosynthetic protein FliR [Vibrio cholerae MZO-2]
 gi|150422687|gb|EDN14641.1| flagellar biosynthetic protein FliR [Vibrio cholerae AM-19226]
 gi|227010134|gb|ACP06346.1| flagellar biosynthetic protein FliR [Vibrio cholerae M66-2]
 gi|227014017|gb|ACP10227.1| flagellar biosynthetic protein FliR [Vibrio cholerae O395]
 gi|229337704|gb|EEO02721.1| flagellar biosynthesis protein FliR [Vibrio cholerae bv. albensis
           VL426]
 gi|229340999|gb|EEO06004.1| flagellar biosynthesis protein FliR [Vibrio cholerae TM 11079-80]
 gi|229343794|gb|EEO08769.1| flagellar biosynthesis protein FliR [Vibrio cholerae RC9]
 gi|229348953|gb|EEO13910.1| flagellar biosynthesis protein FliR [Vibrio cholerae TMA 21]
 gi|229351934|gb|EEO16875.1| flagellar biosynthesis protein FliR [Vibrio cholerae B33]
 gi|229355299|gb|EEO20220.1| flagellar biosynthesis protein FliR [Vibrio cholerae BX 330286]
 gi|229369994|gb|ACQ60417.1| flagellar biosynthesis protein FliR [Vibrio cholerae MJ-1236]
 gi|254844911|gb|EET23325.1| flagellar biosynthesis protein FliR [Vibrio cholerae MO10]
 gi|255736970|gb|EET92366.1| flagellar biosynthesis protein FliR [Vibrio cholera CIRS 101]
 gi|262024052|gb|EEY42747.1| flagellar biosynthesis protein FliR [Vibrio cholerae RC27]
 gi|262030707|gb|EEY49341.1| flagellar biosynthesis protein FliR [Vibrio cholerae INDRE 91/1]
 gi|262032745|gb|EEY51293.1| flagellar biosynthesis protein FliR [Vibrio cholerae CT 5369-93]
 gi|297542190|gb|EFH78240.1| flagellar biosynthetic protein FliR [Vibrio cholerae MAK 757]
 gi|327484649|gb|AEA79056.1| Flagellar biosynthesis protein FliR [Vibrio cholerae LMA3894-4]
          Length = 260

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 93/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++P +VRL   +A +  ++P +         ++  
Sbjct: 11  FIANYFWPYTRIAAMLMVMTVTGARFVPARVRLYLGLALTFAVMPAIPAVPSDIALLSLQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MITFEQIVIGVAMGMVTQFLVQIFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L   V D H ++   +V S+ ++PIG        F      L   F   L +S 
Sbjct: 130 FMLLATLFFLVSDGHLKMIQLVVFSFKSLPIGSGSLTTVDFRELALWLGIMFKASLAVSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +   
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYIVHGLYTHYDIYWQEA 248


>gi|297584053|ref|YP_003699833.1| flagellar biosynthetic protein FliR [Bacillus selenitireducens
           MLS10]
 gi|297142510|gb|ADH99267.1| flagellar biosynthetic protein FliR [Bacillus selenitireducens
           MLS10]
          Length = 259

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/250 (19%), Positives = 103/250 (41%), Gaps = 7/250 (2%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M I     + +  L++ RV + ++ LP  S   IP + ++ FA   S +++     + D 
Sbjct: 1   MEIEIIEWIPAFLLVLVRVSAFMVTLPFFSYQTIPNRFKIGFAAFLSWIMI----FSGDW 56

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   +  L + E  +G   GL+  +    +Q  G +I   +G  +   +       
Sbjct: 57  PIIELNYEFVLLAIKEALVGLTVGLIALLLLYAIQVAGGLIDLKLGFLIANVVDPQTGTQ 116

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQT 177
              + S +    LL L   + HH +   +  SY  IP+ Q        +        + T
Sbjct: 117 APLIGSYLYTFALLFLLATNAHHLLLDGVYYSYEFIPLDQTFLPLGSEDYVEFIGVTMNT 176

Query: 178 TFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVY 237
            F+I  ++S P +    + ++++G + + VPQ+ ++ I  P  I LG +F+ +++ +   
Sbjct: 177 MFIIAFQMSMPIMGSIFLVDVALGFIARTVPQVNVFVIGFPVKIFLGFVFMIVTMPVFFV 236

Query: 238 QFSHSFLYGF 247
             ++      
Sbjct: 237 LVNNLIETVL 246


>gi|149928150|ref|ZP_01916396.1| Bacterial export protein, family 1 [Limnobacter sp. MED105]
 gi|149823135|gb|EDM82373.1| Bacterial export protein, family 1 [Limnobacter sp. MED105]
          Length = 254

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 102/238 (42%), Gaps = 5/238 (2%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           EI + S      R+ + +   P      +  + R+  A   +I+++P L         ++
Sbjct: 10  EIWIASFLWPFIRILAILATAPVFDNRTVQRRTRVGLAALIAILMMPLL----PAPPVLS 65

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    +++ ++ +G   G  +R+     +  G ++   +GL     +  +       + 
Sbjct: 66  SAQAIPVLIQQILIGVAMGFSMRLVFAAFEMAGDLLGLQMGLAFAQFIDPARGTQTPLIG 125

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           S +G++ +L   VID H  V  A+V+S+  IPI   L   N   S        FM+ L++
Sbjct: 126 SFLGVLAMLTFLVIDGHLLVIAAVVQSFELIPISANLAVVNS-QSIAMAGSIMFMLALQI 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           S P +   ++ NI +G+L +  PQ+ +  I     IG+G   L +S+   +     + 
Sbjct: 185 SLPVMAAVLISNIVLGILARAAPQLNVMSIGFSITIGVGLWILWVSLPYFIAGIDGAI 242


>gi|154686054|ref|YP_001421215.1| flagellar biosynthesis protein FliR [Bacillus amyloliquefaciens
           FZB42]
 gi|154351905|gb|ABS73984.1| FliR [Bacillus amyloliquefaciens FZB42]
          Length = 259

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 99/239 (41%), Gaps = 6/239 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+ +  + +P      +P   R+ FA   S++    L    +++      
Sbjct: 7   LFPAFLLVFIRISAFFVTVPVFGHRNLPAVHRIGFAFFLSVICFSTLKHAPEIEI---GE 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  LV+ E  +G   GL+  +    +Q  GS I   +G ++   +          +   
Sbjct: 64  QYMLLVIKEAVVGLSLGLIAFMMMTAIQIAGSFIDFQMGFSIANVIDPQSGTQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLR 184
           +  + LL +  I+ H+ +   +  S+  IP+ Q        +            F+I  +
Sbjct: 124 VYTLALLFMLSINAHYLLLDGIYYSFQYIPLDQAFPSFGNDHFGLFIAKSFNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + ++     + F
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMAVMFVVVRNIF 242


>gi|307131601|ref|YP_003883617.1| flagellar biosynthesis protein fliR [Dickeya dadantii 3937]
 gi|306529130|gb|ADM99060.1| Flagellar biosynthesis protein fliR [Dickeya dadantii 3937]
          Length = 260

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/246 (21%), Positives = 105/246 (42%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +I         F  + R+ + I   P  S   I  +V++   +  +IV+ P +  T    
Sbjct: 6   SIDMIGWFNQFFWPLVRILALISTAPIFSERSITRRVKIGLGVLITIVITPSIPHT---S 62

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
             V  A    ++  ++ +G + G  +++    ++  G +I   +GL+  T    S     
Sbjct: 63  IPVFSAAGIWMLFQQVLIGVMLGFAMQLAFAAIRLAGEIIGLQMGLSFATFFDPSGGPNM 122

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             +  L+ ++ LL    ++ H  +   LV S+ TIPI  E   GN+F +        F  
Sbjct: 123 PVIARLMNLLALLLFLSMNGHLWLISLLVDSFHTIPISAEPISGNVFMTLAEAGGRIFSN 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L L+ P +   +  N+++GLL++L PQ+ I+ I  P  +  G + +   I ++      
Sbjct: 183 GLMLALPLITLLLTINMALGLLSRLAPQLTIFAIGFPITLFAGIITVGFLIFLLSPYAEK 242

Query: 242 SFLYGF 247
            F   +
Sbjct: 243 LFGETY 248


>gi|323490156|ref|ZP_08095376.1| flagellar biosynthesis protein FliR [Planococcus donghaensis
           MPA1U2]
 gi|323396204|gb|EGA89030.1| flagellar biosynthesis protein FliR [Planococcus donghaensis
           MPA1U2]
          Length = 259

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 103/239 (43%), Gaps = 6/239 (2%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             L++ R+ S  +L P  SM  +P Q ++  A   + V +  L      +  +  + Y  
Sbjct: 11  FLLMLVRLTSFFLLAPVFSMRGVPTQFKVGIAAFLAFVAVSTLPIG---ETILLDSSYIL 67

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ EL  G   G    +    +Q  G+ I   +G ++   +          +     ++
Sbjct: 68  LIIKELATGLALGFTAALVLYTVQIAGAFIDFQMGFSMANVLDPQTGAQVPIIGHFKYMM 127

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLRLSSP 188
            LL L  ++ HH +   +++S    P+ +       G+I     ++    FMI L+++ P
Sbjct: 128 ALLFLLTVNGHHLMLDGVMQSLRVFPVERLAISVEAGDIAQFMTSLFVEMFMIALQIALP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +    + +I++G+L K VPQ+ I+ +  P  I +G + L L++ +  Y     F    
Sbjct: 188 IVGALFLVDIALGILAKTVPQLNIFAVGLPLKIFVGFIMLFLTMPVFFYILQILFEKLL 246


>gi|299534769|ref|ZP_07048099.1| flagellar biosynthesis protein FliR [Lysinibacillus fusiformis ZC1]
 gi|298729857|gb|EFI70402.1| flagellar biosynthesis protein FliR [Lysinibacillus fusiformis ZC1]
          Length = 257

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 101/242 (41%), Gaps = 6/242 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L++ RV +    +P  S   IP QV++  A+  + ++      TID++ F     
Sbjct: 8   LTVFLLVLVRVSAFFATVPFFSYRTIPPQVKITLALVLAWMMY----YTIDVEPFAFNDD 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LVM E  +G + GL+  +    +Q  GS I   +G  +   +          +    
Sbjct: 64  YILLVMKEALVGLLLGLMGYIIMSAIQIAGSFIDFQMGFAIANIIDPQTGAQSPLIGQFF 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE--LNFGNIFSSFVNMLQTTFMIMLRLS 186
            ++ LL L  ID HH +   +  SY   P+ Q       N     +      F I  +++
Sbjct: 124 NMLALLLLLAIDGHHMILNGIYYSYQFFPMDQFPSFMNENFPQFIITTFTAVFAIAFQMA 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           +P +    + ++++G+  K VPQ+ I+ +  P  IG+  L L   + +++          
Sbjct: 184 APVVATLFLVDLALGITAKTVPQLNIFVVGFPIKIGVSFLVLFTMMAVMIQVIQKLITIM 243

Query: 247 FF 248
            +
Sbjct: 244 IY 245


>gi|68164508|gb|AAY87237.1| predicted flagellar biosynthetic protein [uncultured bacterium
           BAC17H8]
          Length = 270

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 100/241 (41%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +++  FL   R+G+ ++  P     ++P++VR+  A   +  ++  + D     + +  
Sbjct: 19  GVLLQYFLASLRIGAFLLSAPIFGARWLPLKVRIIMAFTLAAAIVGDVPDV--GTDLLTS 76

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    ++ +E+ +G   GL + ++   +   G  I+++ GL     +  +       ++ 
Sbjct: 77  SVGVSMMFIEIAIGLTAGLTLTIWFAAVLLAGEKIASSAGLGYAAQVDPATGGQTPVVSQ 136

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ +  L+    ID H      +++SY  +P+G  +    + +S +    + F+    + 
Sbjct: 137 ILYLFLLVIFLSIDGHLLAIGTMLESYRILPVGASVAPEVLIASGITAAGSMFLAATIIM 196

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P     ++ N++IG++ +  PQ+ ++    P  +    L L  S               
Sbjct: 197 LPITTVLLMINVAIGIITRSAPQLNLFSFGFPISLLAVFLLLFFSAGAFGTSSQSLIDSA 256

Query: 247 F 247
            
Sbjct: 257 L 257


>gi|325920562|ref|ZP_08182484.1| flagellar biosynthetic protein FliR [Xanthomonas gardneri ATCC
           19865]
 gi|325548955|gb|EGD19887.1| flagellar biosynthetic protein FliR [Xanthomonas gardneri ATCC
           19865]
          Length = 263

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   S+VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLSMVLAPLLPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     V  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  A--VLSVARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPLRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  +     F+     +        L L
Sbjct: 134 WFYIGFGLLFFAANGHLAVISLLVDSYKALPIGTAVPDAAAFAEVAPTLFLQILRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPVQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|308173600|ref|YP_003920305.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606464|emb|CBI42835.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553468|gb|AEB23960.1| flagellar biosynthesis protein FliR [Bacillus amyloliquefaciens
           TA208]
 gi|328911741|gb|AEB63337.1| component of the flagellar export machinery [Bacillus
           amyloliquefaciens LL3]
          Length = 259

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 96/239 (40%), Gaps = 6/239 (2%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +  +  L+  R+ +  + +P      +P   R+ FA   S++    L     +       
Sbjct: 7   LFPAFLLVFIRISAFFVTVPVFGHRNLPAVHRIGFAFFLSVICFSTLKHAPAIDI---GE 63

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y  LV+ E  +G   GL+  +    +Q  GS I   +G ++   +          +   
Sbjct: 64  QYMLLVIKEAVVGLSLGLIAFMMMAAIQIAGSFIDFQMGFSIANVIDPQSGTQSPLIGQF 123

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGN---IFSSFVNMLQTTFMIMLR 184
           +  + LL +  ++ H+ +   +  S+  IP+ Q                     F+I  +
Sbjct: 124 VYTLALLFMLSVNAHYLLLDGIYYSFQYIPLDQAFPSFGNDRFGLFIAKSFNAMFIIAFQ 183

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + ++     + F
Sbjct: 184 MSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMAVMFVIVRNIF 242


>gi|307945651|ref|ZP_07660987.1| flagellar biosynthetic protein FliR [Roseibium sp. TrichSKD4]
 gi|307771524|gb|EFO30749.1| flagellar biosynthetic protein FliR [Roseibium sp. TrichSKD4]
          Length = 257

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 67/239 (28%), Positives = 121/239 (50%), Gaps = 1/239 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
               L+  R+G+ IML+P L  + IP ++RL  A+  ++VL P +  +       N A  
Sbjct: 13  AIFLLMFARIGTLIMLMPALGETSIPTRIRLTIALGITLVLYPVISGSYPAGLTDNPARL 72

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE-TPLNSLI 128
              +  E+ +G   GL IR++T  LQ  G +++   GL       +++   + T   + +
Sbjct: 73  LVFMGGEMIIGFAVGLCIRLFTTTLQTAGVIMANQSGLAFAFGADLANGGQQGTLFGNYL 132

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  ++  D H+ V  AL  S+   P G+ +  G+  ++  N +   F I LR+S+P
Sbjct: 133 SMVGIAMVFATDSHYLVIAALHDSFTLFPPGELVPVGDFVTNATNTVAEVFSIALRMSAP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           F+   +VF   +GLLNKL+PQ+ I+FI+ P  I +G   L + +  ++  +   F    
Sbjct: 193 FIVMGLVFYFGLGLLNKLMPQMQIFFIAMPVNIAIGFFLLMVLLSTLMAFYLDHFEGAL 251


>gi|317129191|ref|YP_004095473.1| flagellar biosynthetic protein FliR [Bacillus cellulosilyticus DSM
           2522]
 gi|315474139|gb|ADU30742.1| flagellar biosynthetic protein FliR [Bacillus cellulosilyticus DSM
           2522]
          Length = 259

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 99/243 (40%), Gaps = 7/243 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L++ RV + ++ LP  S   IP  +++  A+  S ++        D       
Sbjct: 6   QWLPAFMLVLVRVSAFLITLPFFSYQNIPAPLKIGLALFISWIMFFA----GDWPALEIN 61

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            ++  L++ E  +G   GL+  +    +Q  G +I   +GL +   +            S
Sbjct: 62  YHFYLLIIKEALVGLTVGLIAMILLYAIQVAGGIIDYKMGLMIANVIDPQTGAQSPLTGS 121

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIML 183
            +    +L L   D HH +   +  SY  IP+ Q         I    V    T F+I  
Sbjct: 122 YLYTFSILFLLATDAHHLLLDGVFYSYQFIPMDQLFIPFGNEAILDHVVVTFSTMFLIAF 181

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +++ P +    + ++++G++++ VPQI ++ +  P  + +G + L L +       +   
Sbjct: 182 QMAMPIVGSIFLVDLALGMVSRAVPQINVFVVGMPLKVLVGFILLLLVMAPFFMVVNQLI 241

Query: 244 LYG 246
              
Sbjct: 242 ETM 244


>gi|157376186|ref|YP_001474786.1| flagellar biosynthesis protein FliR [Shewanella sediminis HAW-EB3]
 gi|157318560|gb|ABV37658.1| flagellar biosynthetic protein FliR [Shewanella sediminis HAW-EB3]
          Length = 265

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 96/239 (40%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + S    + RV S +M++     +  P++VRL  +MA +  + P L    +++ F   +
Sbjct: 11  TIASYMWPLFRVSSMLMVMAVFGANTTPVRVRLLLSMAITFAIAPVLPPVENIELFALSS 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +      ++ +G   G +  +       TG +I     L   + +  S       + + 
Sbjct: 71  VFVT--AQQILIGVAMGFVTLLVMQTFVLTGQIIGMQTSLGFASMVDPSSGQQTPVIGNF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  +    +D H  +   LV S+ TIPI  +      +          F   L +S 
Sbjct: 129 FLLLTTMIFLSVDGHLVLIRMLVVSFETIPISDQGLSITSYKLLAEWGAYMFGAALTMSI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   ++ N+S G++ +  PQ+ I+ I  P  +  G + L L++  I+  F   +   
Sbjct: 189 TAIVALLLINLSFGVMTRASPQLNIFAIGFPVTMVSGLIILWLTLTPIMEHFGEVWRAA 247


>gi|289666113|ref|ZP_06487694.1| flagellar biosynthetic protein FliR [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 263

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  S--VLSIARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 134 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPVQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|167552786|ref|ZP_02346537.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205322619|gb|EDZ10458.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 264

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 101/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  +  V + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLHLYFWPLLCVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|157959921|ref|YP_001499955.1| flagellar biosynthetic protein FliR [Shewanella pealeana ATCC
           700345]
 gi|157844921|gb|ABV85420.1| flagellar biosynthetic protein FliR [Shewanella pealeana ATCC
           700345]
          Length = 259

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/246 (20%), Positives = 105/246 (42%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +      + + +   CR+    M++P LS +YIP+ VR+  A+  S ++ P L    ++ 
Sbjct: 6   STELSTFIGTFWWPFCRIMGAFMVMPFLSSTYIPVTVRILLALTLSALIAPMLPPLPEVD 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
               +A    L + +L +G +  L + +    +   G ++S  +GL +      S   + 
Sbjct: 66  AISIQA--LLLAIEQLLVGFMMALFLTIMLYVMTQLGEMLSMQMGLAMAVMNDPSSGGSH 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             L     + G L   V+D H      LV S+   P+G  +    +    +  +   F +
Sbjct: 124 PILGQWFLLYGTLVFLVLDGHLVAIGVLVDSFRLWPVGMGVFDLPLM-GLIGRISWLFAV 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              L+ P +   ++ NI+ G+L++  P + ++ +  P  + +G L +  S   +  ++S 
Sbjct: 183 SFMLAIPSILAMLMVNITFGVLSRSAPSLNVFALGFPMSMLMGLLCVFFSFSGLPSRYSD 242

Query: 242 SFLYGF 247
             L   
Sbjct: 243 LCLDAL 248


>gi|52842014|ref|YP_095813.1| flagellar biosynthetic protein FliR [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148359331|ref|YP_001250538.1| flagellar biosynthetic protein FliR [Legionella pneumophila str.
           Corby]
 gi|296107378|ref|YP_003619078.1| flagellar biosynthetic protein FliR [Legionella pneumophila 2300/99
           Alcoy]
 gi|52629125|gb|AAU27866.1| flagellar biosynthetic protein FliR [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148281104|gb|ABQ55192.1| flagellar biosynthetic protein FliR [Legionella pneumophila str.
           Corby]
 gi|295649279|gb|ADG25126.1| flagellar biosynthetic protein FliR [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610487|emb|CBX00059.1| flagellar biosynthetic protein fliR [Legionella pneumophila 130b]
          Length = 256

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 110/239 (46%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +M      + R+G  ++ +P LS + +P ++++ F    S V   ++   +  +NF    
Sbjct: 11  LMSQFIWPMVRIGGLMLTVPVLSSALLPARIKILFVFTLSCVCFTYVPHNLSFENF--NG 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y   ++ EL LG + G ++++        G +IS   GL     +  + + +   ++ L
Sbjct: 69  LYLVYLVQELLLGLLMGFVLQIVFQVFILGGQIISMQAGLGFAVMVDPTSNASVPLISQL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L    ++ H  +   L++S+  +PIG+     ++  S +      F   + +S 
Sbjct: 129 YLMVTTLIFLALNGHLAILETLIESFRIMPIGKSSLDPSVVWSTIMFSGWMFKEAVLISI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +   ++ ++S G++ ++ PQ+ ++ +  P  + +G + + + +  +  +   S  +G
Sbjct: 189 PAILSLLIVSLSFGVMARVAPQLNLFSLGFPITLLMGFVIIKIGLPTVGTEMVESIKHG 247


>gi|309779457|ref|ZP_07674218.1| flagellar biosynthetic protein FliR [Ralstonia sp. 5_7_47FAA]
 gi|308921698|gb|EFP67334.1| flagellar biosynthetic protein FliR [Ralstonia sp. 5_7_47FAA]
          Length = 264

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 96/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  + + IP  +++ F +  ++ L P L     +      
Sbjct: 11  GWIAMYWWPLVRVLAFIAIAPPFANTEIPTSIKVAFGVVITVALAPMLPVPAGVSVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  LV  ++ +G V G  +++    +   G V+S  +GL   + +  + + +   L  
Sbjct: 71  GLWITLV--QVLIGLVLGFCVQLVFSAISGAGEVMSVQMGLGFASLLDPTQTESSMLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + +  + A    D H  + +AL  S+  +P+         + +        F + LR++
Sbjct: 129 FLSLTAVTAFIAGDGHLVLLHALFDSFTALPVSAAPLGNPGWQTLAGGGTIVFALALRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+   +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMIVNLGFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMDA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|161502897|ref|YP_001570009.1| flagellar biosynthesis protein FliR [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864244|gb|ABX20867.1| hypothetical protein SARI_00956 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 264

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   IP +V+L   +  ++V+ P L         +   
Sbjct: 12  WLNLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSI 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  +
Sbjct: 69  AALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   LV ++ T+PIG      N F +        F+  L L+ 
Sbjct: 129 MDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALAKAGGLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 189 PIITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 248


>gi|224370772|ref|YP_002604936.1| FliR [Desulfobacterium autotrophicum HRM2]
 gi|223693489|gb|ACN16772.1| FliR [Desulfobacterium autotrophicum HRM2]
          Length = 262

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 99/234 (42%), Gaps = 1/234 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             L++ RV   + +LP    +  P  V+   AM  S++L   +    DL           
Sbjct: 15  FLLVLARVSIVLFMLPIFGTTMFPTMVKAGLAMVISMLLYSVVQLDPDLLPETAMGMGIF 74

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV  E  +G   GL +R++    Q  G VI   +G ++   +        + +  L   +
Sbjct: 75  LV-SEAMIGLTLGLCVRLFFGSFQLAGEVIGFQMGFSMINVVDPQSGANVSLMEQLAYWV 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            LL    ++ HH +  +LV S+  +  G  +    +    + +    F++ +++ +P + 
Sbjct: 134 ALLVFLAMNGHHIMLLSLVDSFELVQPGSFVFQQIMVDKVIFLGSQMFILAIKIGAPVIA 193

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             +  +++ GL  K  PQ+ +  ++ P  I +G +   LS+EII+       + 
Sbjct: 194 ALLFTSVAFGLTAKFSPQMNVMIVAFPLKIIVGLVLFGLSLEIIIIVARTYIIE 247


>gi|254502657|ref|ZP_05114808.1| flagellar biosynthetic protein FliR [Labrenzia alexandrii DFL-11]
 gi|222438728|gb|EEE45407.1| flagellar biosynthetic protein FliR [Labrenzia alexandrii DFL-11]
          Length = 257

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 70/239 (29%), Positives = 116/239 (48%), Gaps = 1/239 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  R+G+ IMLLP L  S IP + RL  A+A ++VL P            N A  
Sbjct: 13  AAFMLMFARLGTMIMLLPALGESSIPTRFRLTIALAMTLVLYPVGSQLYPADLVSNPAQL 72

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL-NSLI 128
             L++ E+ +G   GL  ++ T  +Q  G +++   GL       IS+   +  L  + +
Sbjct: 73  GVLLISEIVIGVAIGLCAKLVTSAVQIAGVIMANQSGLAFALGTDISNEGQQGALYGNFL 132

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  ++  D H+ V  AL  S+   P G     G+   +F   +   F I +R+S+P
Sbjct: 133 ALVGITLIFTTDTHYLVIAALHDSFTLFPPGSMPPVGDFSENFAETVAMVFSIAVRMSAP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           FL   +VF   +GLLNKL+PQ+ I+FI+ P  I +G   L + I  ++  +        
Sbjct: 193 FLVVGLVFYFGLGLLNKLMPQMQIFFIAMPVNIAIGFFLLMVLISTLMMFYLEHVQQAL 251


>gi|309388836|gb|ADO76716.1| flagellar biosynthetic protein FliR [Halanaerobium praevalens DSM
           2228]
          Length = 261

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 90/237 (37%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +   FLI+ R    ++L P  S   I  + ++  A+  +    P +          N   
Sbjct: 11  LYFFFLILSRYLGMMLLTPFFSSQVIFYRAKILIALTLAAFSYPLVLSIYQPLAPANNLS 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               ++ E  +G   GL + +    +Q  G +I   +G  +   +          +  L 
Sbjct: 71  LIIEIISEFSIGLFMGLAVFLVFSAIQLGGQIIDMRMGFRIANVVDPFSGANSPVIGQLK 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I   L    ++ H  +   L  S+  IP G+      ++  F       F++ ++++ P
Sbjct: 131 NIFVTLIFLALNGHLYLIKHLYNSFKIIPPGRVKFSNQLWQYFFRRSADMFVLAIKIALP 190

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
                   +I +  L + VPQ+ ++ I  P  I  G + L + + ++ + ++   + 
Sbjct: 191 IAGAIFFIDIILAFLARSVPQMNLFVIGLPIKIMAGLILLYILMPVLNHYYAEIIMN 247


>gi|89899373|ref|YP_521844.1| flagellar biosynthetic protein FliR [Rhodoferax ferrireducens T118]
 gi|89344110|gb|ABD68313.1| flagellar biosynthetic protein FliR [Rhodoferax ferrireducens T118]
          Length = 240

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 90/234 (38%), Gaps = 2/234 (0%)

Query: 13  FLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKL 72
                RV +     P  S    P++ R+  A   +    P L     +   ++       
Sbjct: 2   IWPFLRVLAVFTAAPLFSSKAFPLRARIGLAFFIAFAAQPSLQGQPIIS--ISGPEAMGA 59

Query: 73  VMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIG 132
           V  ++ +G   G  +R+    ++  G V+   +GL   +    + +   + +    G + 
Sbjct: 60  VAQQVGIGLAIGFTVRLVFAAVELAGEVVGFQMGLGFASFFNPALNTQSSAVARFFGQMA 119

Query: 133 LLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFF 192
                V++ H  V  A++KS+   P+ Q            +     F   L ++ P +  
Sbjct: 120 TFLFVVMNGHLMVLMAVIKSFDKFPVNQNFLEAIGQMKIYDFGTDLFASGLWIALPMVGM 179

Query: 193 YIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +  N+++G+++++ PQ+ I+ I  P  + +G + +  ++ ++   F       
Sbjct: 180 LLFANLALGIVSRVAPQMNIFAIGFPVTLTVGMVGIAATLPMLDQPFMTLMERA 233


>gi|271500074|ref|YP_003333099.1| flagellar biosynthetic protein FliR [Dickeya dadantii Ech586]
 gi|270343629|gb|ACZ76394.1| flagellar biosynthetic protein FliR [Dickeya dadantii Ech586]
          Length = 260

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 103/246 (41%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +I         F  + R+ + I   P  S   I  +V++   +  +IV+ P +       
Sbjct: 6   SIDMIGWFNQFFWPLVRILALISTAPIFSERAITRRVKIGIGVLITIVIAPNIP---HAS 62

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
             +  A    ++  ++ +G + G  +++    ++  G +I   +GL+  T    S     
Sbjct: 63  IPIFSATGVWMLFQQVVIGVMLGFTMQLAFAAIRLAGEIIGLQMGLSFATFFDPSGGPNM 122

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             +   + ++ LL    ++ H  +   LV S+ TIPIG     GN+F +        F  
Sbjct: 123 PVIARFMNLLALLLFLSMNGHLWLISLLVDSFHTIPIGASPVSGNVFMTLAGAGGRIFSN 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L L+ P +   +  N+++GLL++L PQ+ I+ I  P  +  G + +   I +I      
Sbjct: 183 GLMLALPLITLLLTINMALGLLSRLAPQLTIFAIGFPITLFTGIITVGFLIFLISPYAEK 242

Query: 242 SFLYGF 247
            F   +
Sbjct: 243 LFGETY 248


>gi|297582019|ref|ZP_06943938.1| flagellar biosynthetic protein FliR [Vibrio cholerae RC385]
 gi|297533714|gb|EFH72556.1| flagellar biosynthetic protein FliR [Vibrio cholerae RC385]
          Length = 260

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 95/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++P +VRL   +A ++ ++P +         ++  
Sbjct: 11  FIANYFWPYTRIAAMLMVMTVTGARFVPARVRLYLGLALTLAVMPAIPAVPSGIALLSLQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  + + ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MITLEQIVIGVAMGMVTQFLVQIFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L   V D H ++   +V S+ ++PIG        F      L   F   L +S 
Sbjct: 130 FMLLATLFFLVSDGHLKMIQLVVFSFKSLPIGSGSLTTVDFRELALWLGIMFKASLAVSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +   
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYIVHGLYTHYDIYWQEA 248


>gi|92114090|ref|YP_574018.1| flagellar biosynthetic protein FliR [Chromohalobacter salexigens
           DSM 3043]
 gi|91797180|gb|ABE59319.1| flagellar biosynthetic protein FliR [Chromohalobacter salexigens
           DSM 3043]
          Length = 261

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 91/241 (37%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F    R+ + +   P  +   +P Q  +      +  + P L    D       
Sbjct: 11  EWLTLFFWPFVRILAFLAASPIWNQHGVPRQASVLLGALMAFAIGPALPPMPDTPIVSIG 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ E+ +G   G+++RV    +Q  G  I   +GL   T            L+ 
Sbjct: 71  G--LGILIQEMLIGIALGMVLRVTIAVVQAAGEFIGLQMGLAFATFFTPGVG-NSMVLSR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  +I LL    ++ H      L  S+ T+P+G     G+            F   + ++
Sbjct: 128 IFQMITLLMFLALNGHLIALEILANSFQTLPVGGPRVDGSAGEVIARWGGEIFTSGVLMA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQ+ I+ I  P  +  G + L   +  ++      F   
Sbjct: 188 LPLIVSLLIINLTLGVLNRASPQLSIFSIGFPMTLTTGVVLLMTLMPDLLRFLEILFSNS 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|78047542|ref|YP_363717.1| flagellar biosynthesis pathway component FliR [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325925987|ref|ZP_08187353.1| flagellar biosynthetic protein FliR [Xanthomonas perforans 91-118]
 gi|78035972|emb|CAJ23663.1| flagellar biosynthesis pathway component FliR [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325543583|gb|EGD15000.1| flagellar biosynthetic protein FliR [Xanthomonas perforans 91-118]
          Length = 263

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  A--VLSIARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              +   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 134 WFYLGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPMQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|150390467|ref|YP_001320516.1| flagellar biosynthesis protein FliR [Alkaliphilus metalliredigens
           QYMF]
 gi|149950329|gb|ABR48857.1| flagellar biosynthetic protein FliR [Alkaliphilus metalliredigens
           QYMF]
          Length = 263

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 104/237 (43%), Gaps = 2/237 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             L++ R+    ++ P  S + IPM  ++ F++  ++++LP +  + D       A    
Sbjct: 15  FILLIVRISGIFIIAPIFSRNNIPMMSKIIFSVFLALIILPLVTISEDFAANTFFALMVY 74

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            +  E  LG   G +  +Y       G ++ T IG  +        +     + ++  ++
Sbjct: 75  AI-QEFALGITIGFIGSIYFSTFYLAGMIVDTQIGFGMVNVFDPQMNTQLPIMGNVYNLL 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIG-QELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
             L    ++ HH +  A+  SY  +PIG Q      +      +    FM+  +LS+P L
Sbjct: 134 ISLVFLAVNGHHLLIKAMFDSYDVLPIGFQFQVSEALIMHLTIIFMEIFMMAFKLSAPIL 193

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
               + N+ +G+L + +PQ+ ++ +  P  I +G + + +++  +V   +  F   F
Sbjct: 194 ATIFLANVLLGILARTMPQMNVFIVGMPLKIIVGLVTIMIALPFLVPFGNALFEKMF 250


>gi|123442776|ref|YP_001006753.1| flagellar biosynthesis protein FliR [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089737|emb|CAL12590.1| flagellar biosynthetic protein FliR [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 260

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + R+ + I   P LS   I  +V++  A+  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLIRILALISTAPVLSEKQINRKVKVGLAVLITFLIAPSLP---PVNIPLV 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L 
Sbjct: 67  SSGALWVAGQQVLIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L     D H  +   L  S+ T+PI  E   GN F +        FM  L L
Sbjct: 127 RLLNLLAMLLFLSFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTQAGSLIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFTEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|238764400|ref|ZP_04625350.1| Flagellar biosynthetic protein fliR [Yersinia kristensenii ATCC
           33638]
 gi|238697426|gb|EEP90193.1| Flagellar biosynthetic protein fliR [Yersinia kristensenii ATCC
           33638]
          Length = 260

 Score =  113 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 107/242 (44%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + R+ + I   P LS   I  +V++  A+  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLIRILALISTAPVLSEKQINRKVKVGLAILITFLIAPSLP---PVNIPLV 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            +    +   ++ +G   GL ++     ++ +G VI   +GL+  T    S       L 
Sbjct: 67  SSGAVWVAGQQILIGAAIGLTMQFAFAAIRLSGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L     D H  +   L  S+ T+PI  E   GN F +        FM  L L
Sbjct: 127 RLLNLLAMLLFLSFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALAQAGSLIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L++ ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLAMPLLAPFTEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|322432983|ref|YP_004210232.1| flagellar biosynthetic protein FliR [Acidobacterium sp. MP5ACTX9]
 gi|321165210|gb|ADW70914.1| flagellar biosynthetic protein FliR [Acidobacterium sp. MP5ACTX9]
          Length = 258

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/246 (20%), Positives = 101/246 (41%), Gaps = 3/246 (1%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M I    I+ +   I  R+   ++  P L  + IP +++    +A + V+ P +  ++  
Sbjct: 1   MQIPFADIIQAFLAIGVRLSGLMLFAPFLGSAVIPARIKAVLVVALTFVIYPLVSRSLTP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q   +      LV  EL +G   G+   V    +Q  G ++S  +G +L   +  +  + 
Sbjct: 61  QPLNDWP---LLVFRELLVGVSIGIATSVVFEAVQMAGQILSIQMGYSLINILDPNTQVD 117

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
            T +      I +L    +D H  +  A+  S+  +P G          + +        
Sbjct: 118 TTVIAMFHQSIAMLIFLRLDVHLWLIRAIGNSFTYLPPGGAQLSRPFMFTLIGAGSAILS 177

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I +++++P L   ++ +I +GLL K  PQ+P+  +       LG   L  S++     F 
Sbjct: 178 IGVQIAAPVLSATLLTDIVLGLLGKASPQLPLMLLGPAVKSLLGLAILFTSLKYWPDMFR 237

Query: 241 HSFLYG 246
             F+  
Sbjct: 238 VLFIDS 243


>gi|126176174|ref|YP_001052323.1| flagellar biosynthetic protein FliR [Shewanella baltica OS155]
 gi|125999379|gb|ABN63454.1| flagellar biosynthetic protein FliR [Shewanella baltica OS155]
          Length = 259

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 109/240 (45%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ SL+   CR+    M++P L  SY+P  VR+  A++ + ++ P L     +      +
Sbjct: 12  LIGSLWWPFCRIMGAFMIMPLLGNSYVPATVRIFLALSIAALIAPMLPPVPPVDALSLGS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + +L +G +  L + +    +   G+++S  +GL +      ++      L+  
Sbjct: 72  LF--LAVEQLLIGFMLALFLTILIHVMTMLGTIMSMQMGLAMAVMNDPANGDTNPILSEW 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I G L    +D H      +V S+   PIG  +    +    ++ +   F   L L+ 
Sbjct: 130 LQIFGTLIFLALDGHLVGLNIIVDSFRLWPIGNGIFDLPLM-GLISRMGWLFAASLMLAI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ NI+ G+L++  P + I+ +  P  + +G + + LS+  I  ++S   L   
Sbjct: 189 PAVLAMLMVNITFGVLSRAAPSLNIFSLGFPMTLLMGLICVFLSLSGIPTRYSDLCLDAL 248


>gi|54297700|ref|YP_124069.1| flagellar biosynthetic protein fliR [Legionella pneumophila str.
           Paris]
 gi|53751485|emb|CAH12903.1| Flagellar biosynthetic protein fliR [Legionella pneumophila str.
           Paris]
          Length = 256

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 110/239 (46%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +M      + R+G  ++ +P LS + +P ++++ F    S V   ++   +  +NF    
Sbjct: 11  LMSQFIWPMVRIGGLMLTVPVLSSALLPARIKILFVFTLSCVCFTYVPHNLSFENF--NG 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y   ++ EL LG + G ++++        G +IS   GL     +  + + +   ++ L
Sbjct: 69  LYLVYLVQELLLGLLMGFVLQIVFQVFILGGQIISMQAGLGFAVMVDPTSNASVPLISQL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L    ++ H  +   L++S+  +PIG+     +I  S +      F   + +S 
Sbjct: 129 YLMVTTLIFLALNGHLAILETLIESFRIMPIGKSSLDPSIVWSTIMFSGWMFKEAVLISI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +   ++ ++S G++ ++ PQ+ ++ +  P  + +G + + + +  +  +   S  +G
Sbjct: 189 PAILSLLIVSLSFGVMARVAPQLNLFSLGFPITLLMGFVIIKIGLPTVGTEMVESIKHG 247


>gi|220903477|ref|YP_002478789.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867776|gb|ACL48111.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 263

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 102/239 (42%), Gaps = 1/239 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  ++SL L + RV   + +LP  S + IP+QV+    + F++ + P L          +
Sbjct: 8   QAEVLSLILTMMRVSIVMFMLPVFSTNNIPIQVKAAVTLVFTLGVWPHL-ALPGSSMPAH 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +V+ E  LG V G+ +    +G+Q  G ++   +G  +                
Sbjct: 67  PFDLVLMVLGEAVLGLVLGMAVNFLFMGIQAGGELLGFQMGFTMINFADPLTGNQTGITA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++ LL    +D H  +      S+  +P G      NI    +++    F++ L++
Sbjct: 127 FFLWMVSLLTFLSLDGHLYMIKGFAASFKIVPPGALFIGSNILWQILHLAAQMFVLALQI 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++P +    +  +++GL+ +  PQI I     P  IG+G  F+ L + I+        L
Sbjct: 187 AAPVMVALFMVEVALGLVARTSPQIHIMEFGFPAKIGVGFFFVGLLLVIMADHVETFIL 245


>gi|77457778|ref|YP_347283.1| flagellar biosynthesis protein FliR [Pseudomonas fluorescens Pf0-1]
 gi|77381781|gb|ABA73294.1| flagellar biosynthetic protein FliR [Pseudomonas fluorescens Pf0-1]
          Length = 261

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 106/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              + +  L + RV S +M++P    + +P ++RL FA A ++V+ P L     +     
Sbjct: 13  STWVATFMLPLFRVASMLMVMPVFGTTLVPRRIRLYFAFAITVVITPNLPPMPAVSPLDL 72

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 L+  ++ +G V G  ++++       G +++  +G+   + +  ++ ++   + 
Sbjct: 73  SG--LLLIAEQILVGAVLGFSLQLFFQAFVVAGQIVAIQMGMGFASMIDPTNGVSVAVIG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               ++  L    ++ H  VF  L +S+ T+P+G  L   + +      L       L L
Sbjct: 131 QFFTMLVTLLFLSMNGHLVVFEVLTESFTTLPVGGGLMTTHYWE-LAGKLGWVLGAALLL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             P +   +V NI+ G++ +  PQ+ I+ I  P  + LG   + + +  I+ Q+      
Sbjct: 190 VLPAVTALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGLFIVWVGLADILNQYQPLATE 249

Query: 246 GF 247
             
Sbjct: 250 AL 251


>gi|78224287|ref|YP_386034.1| flagellar biosynthesis protein FliR [Geobacter metallireducens
           GS-15]
 gi|78195542|gb|ABB33309.1| Flagellar biosynthesis protein FliR [Geobacter metallireducens
           GS-15]
          Length = 264

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/235 (21%), Positives = 111/235 (47%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L++ R+      +P      +PM +++    A ++V  P +   I  Q   +   
Sbjct: 14  VAFFALVLGRMAGIFAAIPLFGGRRVPMNIKVLAIFALTVVCFPLIKAKIP-QLPADMLS 72

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E  +G   GLL  +    ++F G +    +GL++ + +  S     + ++   
Sbjct: 73  LGMLMIREALVGTCLGLLSLIIFAAVEFCGQICGIQMGLSIVSEIDPSRGSQLSIISIFQ 132

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +   L    ++ HH    ALV+SY  +P+G       + +  V  +   F++ ++LS+P
Sbjct: 133 EMFATLLFLSLNVHHVFINALVESYAVLPVGAWTMSEGLLNFLVVTIGQVFILAIKLSAP 192

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +   ++ ++ +G++ +  PQ+ ++F+S P  IG+G + L LS+ + ++    SF
Sbjct: 193 IMVTLLLTSVMLGIMARAFPQMNVFFVSMPLNIGIGFIILGLSLTVFLHTLRGSF 247


>gi|226941265|ref|YP_002796339.1| FliR1 [Laribacter hongkongensis HLHK9]
 gi|226716192|gb|ACO75330.1| FliR1 [Laribacter hongkongensis HLHK9]
          Length = 264

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ +    + RV   ++  P      +P +V++  A+A +++L+P L     +       
Sbjct: 12  LLSTYLWPLFRVMGFLLADPLFGTKAVPRRVKVVLAIALTLLLVPLLPPMPAVPVVSGEG 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   ++ +L +G   G  +R+    ++  G++I   +GL                L+ L
Sbjct: 72  VFI--IVQQLLIGVAMGFAMRLVITAVELAGAMIGMQMGLGFAMQFDPMMGAQVPSLSRL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +   L L   + H  +   + +S+   PI  +                   + L LS 
Sbjct: 130 LTLSTYLVLLSFNGHLIMLGTVAESFTLFPISLDPLPAAGLQLVAAWGGKMLALALWLSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ N++IG++ +  PQ  I+    P  + +G + L  ++  +       +L GF
Sbjct: 190 PVVVALLITNLAIGVMTRAAPQFNIFSFGFPLTLLIGFVVLYYALPFMGQALQQLYLQGF 249


>gi|294339802|emb|CAZ88165.1| Flagellar biosynthetic protein FliR [Thiomonas sp. 3As]
          Length = 264

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/248 (22%), Positives = 105/248 (42%), Gaps = 4/248 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +I  E  + + F    RV + + L P  SM  +P  VR+  A+  ++ + P L     +Q
Sbjct: 6   SIQIETWIGAFFWPFVRVLAMLSLAPVFSMGSLPTMVRVGLAVLIAVAIAPALPAMPPVQ 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                A+   L    L +G   GL + +    + F GSVI   +G+   T       +  
Sbjct: 66  FGTATAWMLLLQQ--LLVGGAIGLSMTLILSAVMFAGSVIGLQMGMGFATLFDPVQGVQV 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM--LQTTF 179
           T L S + ++ +L    ++ H  +   + +S+  +P+   L         +        F
Sbjct: 124 TSLASFLNMVTMLLFLAVNGHLILLAVIARSFTLLPVAPNLGLAAQTWFTLAQQGGSAIF 183

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            + L L++P +   ++ N+ +G+L KL PQ+ ++ +  P    +G L L L + ++    
Sbjct: 184 SLGLALAAPVIGVLLIANLGLGVLTKLAPQLNLFAVGFPMFFIMGFLALYLVMPVMQNVV 243

Query: 240 SHSFLYGF 247
            H    G 
Sbjct: 244 QHLVDVGL 251


>gi|118133499|gb|ABK60543.1| flagellar biosynthetic protein FlhB [Clostridium novyi NT]
          Length = 575

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 92/207 (44%), Gaps = 1/207 (0%)

Query: 39  RLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTG 98
           ++ F +    +++  +  +  + +  +        ++E+  G + G +  +    +++ G
Sbjct: 2   KVMFGVILGFMIITGIDYSY-VNDINSNLMIIMYAIIEISTGVILGFITNICFSCIRYAG 60

Query: 99  SVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPI 158
           + +   +G  + +    + +   T +  ++    L+   ++D  + +   LV+S+  + I
Sbjct: 61  AFMDLQVGFAMMSMFDPNANSNTTLIERMLYWFSLIVFIIVDGPNMLIKILVESFKVVHI 120

Query: 159 GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTP 218
           GQ +         +N+    F + +R++ P +   I+ ++++GL+ K VPQ+ +  +  P
Sbjct: 121 GQFILNQQSAMHVINVFIKYFQLGIRIAIPIVLIIILTDLTMGLVAKSVPQLNVMILGMP 180

Query: 219 YLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             I LG   L L + +I      +F  
Sbjct: 181 VKIVLGLGVLSLCLPVIFNIIGSAFDN 207


>gi|299531249|ref|ZP_07044659.1| flagellar biosynthetic protein FliR [Comamonas testosteroni S44]
 gi|298720656|gb|EFI61603.1| flagellar biosynthetic protein FliR [Comamonas testosteroni S44]
          Length = 254

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L     RV +     P  S   IPM++++  A   ++   P L +   +     +
Sbjct: 11  AWLSPLIWPFVRVLALFTTAPVFSQKAIPMRLKVGLAFLVALCAQPVLGEQTVVSIASAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     ++ ++ +G   G  +R+    ++  G VI   +GLN  +    + +   + +  
Sbjct: 71  A--LGTLVQQVVIGLSVGFAVRLVMAAIEVAGEVIGLQMGLNFASFFDPTSNAQLSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I  L   VI+ H  V  A++KS+   P+               M    F     ++
Sbjct: 129 FMVQIATLLFIVINGHLLVLMAVLKSFEAFPVDGNFLQAISQMRIHEMGSAVFASAFWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +G+++++ PQ+ IY +  P  + +G L L  ++ ++          G
Sbjct: 189 LPMIAMLLFVNLVLGIISRVAPQMNIYAVGFPVTLTVGLLGLTATLPLLEQPLVALLQKG 248


>gi|238758101|ref|ZP_04619281.1| Flagellar biosynthetic protein fliR [Yersinia aldovae ATCC 35236]
 gi|238703639|gb|EEP96176.1| Flagellar biosynthetic protein fliR [Yersinia aldovae ATCC 35236]
          Length = 260

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 104/242 (42%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             ++   F  + RV + I   P L+   I  +V++   +  + ++ P L     +   + 
Sbjct: 10  SALVSQYFWPLIRVLALISTAPILNEKQINRKVKIGLGVLITFLIAPSLP---PVNIPIA 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L 
Sbjct: 67  SIGAIWVAGQQVLIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L     D H  +   L  S+ TIPI  E   GN F +   +    FM  L L
Sbjct: 127 RLLNLLAMLLFLSFDGHLWLISLLADSFHTIPIQLEPLNGNGFLALTQVGSLIFMSGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + + L + ++     H F  
Sbjct: 187 ALPMITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTIGIISMGLMMPLLAPFAEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 IF 248


>gi|194365645|ref|YP_002028255.1| flagellar biosynthetic protein FliR [Stenotrophomonas maltophilia
           R551-3]
 gi|194348449|gb|ACF51572.1| flagellar biosynthetic protein FliR [Stenotrophomonas maltophilia
           R551-3]
          Length = 263

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 90/242 (37%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R+G+  M +P +    +P +VR+  A   +I L P L    D   F   
Sbjct: 16  GMIGTVLWTMLRIGAVAMAMPMVGTRAVPARVRVVLAGTLAIALAPLLPPVPDWTGFD-- 73

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G L+R+        G +I+   GL                +  
Sbjct: 74  AATVLTIARELAIGVSIGFLLRLVFEAGAMAGELIAQGTGLAFAQMSDPLRGGTSGVIGQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              ++  L  +  + H  +   +V SY  +PIG  L   + F S     L T     L L
Sbjct: 134 WFYLLFGLLFFTANGHLALISLVVDSYRALPIGAPLPDPHAFFSIAPTFLLTVLRGALTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P     +  N++ G+L +  P +    +  P  + LG   L L    +       F  
Sbjct: 194 AIPLTVAMLAVNLAFGVLARAAPALNPIQLGLPVSLLLGLFLLALLAGEMGPPVQRLFDA 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|54294674|ref|YP_127089.1| flagellar biosynthetic protein fliR [Legionella pneumophila str.
           Lens]
 gi|53754506|emb|CAH15990.1| Flagellar biosynthetic protein fliR [Legionella pneumophila str.
           Lens]
          Length = 256

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 110/239 (46%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +M      + R+G  ++ +P LS + +P ++++ F    S V   ++   +  +NF    
Sbjct: 11  LMSQFIWPMVRIGGLMLTVPVLSSALLPARIKILFVFTLSCVCFTYVPHNLSFENF--NG 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y   ++ EL LG + G ++++        G +IS   GL     +  + + +   ++ L
Sbjct: 69  LYLVYLIQELLLGLLMGFVLQIVFQVFILGGQIISMQAGLGFAVMVDPTSNASVPLISQL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L    ++ H  +   L++S+  +PIG+     +I  S +      F   + +S 
Sbjct: 129 YLMVTTLIFLALNGHLAILETLIESFRIMPIGKSSLDPSIIWSTIMFSGWMFKEAVLISI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +   ++ ++S G++ ++ PQ+ ++ +  P  + +G + + + +  +  +   S  +G
Sbjct: 189 PAILSLLIVSLSFGVMARVAPQLNLFSLGFPITLLMGFVIIKIGLPTVGTEMVESIKHG 247


>gi|294500922|ref|YP_003564622.1| flagellar biosynthetic protein FliR [Bacillus megaterium QM B1551]
 gi|294350859|gb|ADE71188.1| flagellar biosynthetic protein FliR [Bacillus megaterium QM B1551]
          Length = 258

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 103/239 (43%), Gaps = 7/239 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ RV S  + +P  S   IP   ++  + + S+++      TIDL      A + 
Sbjct: 10  AFLLVLVRVTSFFITVPLFSYKTIPAVHKVGLSASLSVIIA----TTIDLPVVSLDAQFV 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            LV+ E  +G   GL   V+ + +Q  G +I   IG  +   +          L   + +
Sbjct: 66  LLVVKECAVGLFIGLTAYVFIMAIQIAGGLIDFQIGFAIANVIDPQTGAQSPILGQYLYV 125

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSS 187
             LL L   + HH +   +  SY  IP+ +           +  + +  + F++ +++S 
Sbjct: 126 FALLFLLSTNGHHLLIDGIYNSYLIIPLDKTAFPVGSQAFATHIITVFSSMFLVAVQMSL 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +    + +I++G++ + VPQ+ I+ +  P  I +  + L + +  + Y     F   
Sbjct: 186 PLVGSLFLVDIALGIVARTVPQLNIFVVGFPVKIIVAFILLIVVMGSMFYMMQIIFEQM 244


>gi|294668047|ref|ZP_06733172.1| flagellar biosynthesis pathway component FliR [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292601886|gb|EFF45708.1| flagellar biosynthesis pathway component FliR [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 263

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRTVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  A--VLSIARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              +   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 134 WFYLGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLAL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPMQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|84624129|ref|YP_451501.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576797|ref|YP_001913726.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576989|ref|YP_001913918.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84368069|dbj|BAE69227.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188521249|gb|ACD59194.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521441|gb|ACD59386.1| flagellar biosynthetic protein FliR [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 257

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 90/242 (37%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 10  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 70  A--VLSIARELAIGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 128 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLTL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L+K  P +    +  P  + LG   L              F  
Sbjct: 188 ALPMMVAMLAVNLAFGALSKAAPALNPVQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 247

Query: 246 GF 247
            F
Sbjct: 248 AF 249


>gi|325273554|ref|ZP_08139784.1| flagellar biosynthesis protein FliR [Pseudomonas sp. TJI-51]
 gi|324101314|gb|EGB98930.1| flagellar biosynthesis protein FliR [Pseudomonas sp. TJI-51]
          Length = 258

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 106/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P +VRL  A+A ++V++P L    +      R
Sbjct: 11  TWVATFILPLFRVTAVLMTMPIFGTRMLPARVRLYVAVAITVVIVPALPPLPEFDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + GL +++        G +++  +G+   + +   + +  T ++ 
Sbjct: 71  G--LLLCAEQIIVGTLFGLALQLLFQAFVIAGQIVAVQMGMAFASMVDPGNGVNVTVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L 
Sbjct: 129 FMTMLVSVLFLLMNGHLVVFEVLTESFSTLPVGNALVV-NHFWELAGRMGWVFGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V NI+ G++ +  PQ+ I+ I  P  + +G     + +  ++  +       
Sbjct: 188 LPVIAALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMGMFIFWVGLADVLSHYQALASET 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|78355425|ref|YP_386874.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217830|gb|ABB37179.1| flagellar biosynthetic protein FliR [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 261

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 107/239 (44%), Gaps = 1/239 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E   +S  L + R+   + LLP    +  P  V+    M  ++ L P L  +  L    +
Sbjct: 8   EASFLSFLLTLMRISLVVFLLPVFGGNSAPRLVKGALCMVLTLALWPHLSFSGSL-LPGH 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
               + ++  E+ +G + GLL+R +  G+Q  G ++   +G  + +        + +  +
Sbjct: 67  PFGIALMLAGEIIMGIMLGLLVRFFFAGIQTGGELLGFQMGFTMVSVADPLSGQSTSISS 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++ LL   V+D H  +   L  S+  +P GQ +       + + +    F++ + +
Sbjct: 127 HFMYMVSLLIFLVLDGHLVMLKGLTDSFALVPPGQLVFRHASLHNMLTLAGGMFVMAVHI 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++P +    +  +++ L+ +  PQ+ +  I  P  IG+G LF+ L   I+ +Q     L
Sbjct: 187 AAPVMAALFLVELALALMGRAAPQMNLLMIGFPLKIGVGFLFMGLLFTIMRHQVQDFIL 245


>gi|255263738|ref|ZP_05343080.1| flagellar biosynthetic protein FliR [Thalassiobium sp. R2A62]
 gi|255106073|gb|EET48747.1| flagellar biosynthetic protein FliR [Thalassiobium sp. R2A62]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 120/238 (50%), Gaps = 3/238 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +    +I  RVG+ + +LPGL    +P +VRL  A+A ++++ P +   +     V+  
Sbjct: 15  WLFGAAVIFLRVGAMMAVLPGLGERSVPARVRLGLAIALTVLVTPLIAPDLPEPEEVSN- 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L+++E  +G + G+ +R++   L   G++ + +  L+     G + + A+  +  +
Sbjct: 74  -LVGLLLIEASIGLLLGMSLRLFVFTLSTAGAIAAQSTSLSQIFG-GSAGAEAQPAIGHV 131

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +   GL    + + H +V   +V SYG+ P G  L+   +    V+ +  +F     L++
Sbjct: 132 LVTGGLTIAMITELHLRVVEFIVMSYGSFPTGVPLSATFVADFGVSRVAASFAFAFTLAA 191

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           PF    +++N+++G++N+ +PQ+ + F+  P +   G + L LS   ++  +  +F  
Sbjct: 192 PFFIASLIYNVTLGVINRAMPQLMVSFVGAPVITAGGLVLLALSAPTLLGLWIDAFHD 249


>gi|146296298|ref|YP_001180069.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409874|gb|ABP66878.1| flagellar biosynthetic protein FliR [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 99/233 (42%), Gaps = 2/233 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL++ R+    +  P      IP   ++  A   SI+++  L    +     N   +  
Sbjct: 15  FFLVLARMSGIFIASPIFGRRNIPAYFKIGLAFFLSIIVV--LLYHFEYTVPQNLLEFIF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V  E  +G + G +  +    +   G +I  AIG  +   +     +    L + + + 
Sbjct: 73  VVTKEFIVGIIIGFISYMIFSTILLAGQIIDNAIGFGIANVIDPMSEIQVPLLGNFLYLY 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+  +  D HH +  A+V SY  +P+G       +   F+      F+I + +S P L 
Sbjct: 133 MLVIFFATDAHHTLIRAVVYSYKVVPLGYSNILPKLSQKFITFFIELFVIGIEISLPILM 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
             ++ +I +G+L++ VPQ+ ++ +  P  I +G + L + + I+         
Sbjct: 193 SMLIVDIILGILSRAVPQMNVFMVGIPIKIAIGFVVLVIVLPIMNKMIFVLLD 245


>gi|315179474|gb|ADT86388.1| flagellar biosynthesis protein [Vibrio furnissii NCTC 11218]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 95/240 (39%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + F    R+ + +M++      ++  ++RL   +A +  ++P +         ++ 
Sbjct: 10  EFIANYFWPYARISAMLMVMTVTGARFVSTRIRLYLGLAITFAVMPAIPAVPPDLELLSF 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +    + ++ +G   G++ +         G ++     L   + +  ++      L  
Sbjct: 70  NGFLTT-LNQIIIGVAMGMVTQFMIQTFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L   +  L   V D H ++ + +V S+ ++PIG        F      L T F + L +S
Sbjct: 129 LFMFLATLFFLVSDGHLKMIHLVVLSFKSLPIGTHSLTAVDFRELALWLGTMFKVALSMS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 189 LSGIVALLTVNLSFGVMTRAAPQLNIFSLGFAFALLVGLLLCWYILSGLFSHYELFWAEG 248


>gi|295399826|ref|ZP_06809807.1| flagellar biosynthetic protein FliR [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111662|ref|YP_003989978.1| flagellar biosynthetic protein FliR [Geobacillus sp. Y4.1MC1]
 gi|294978229|gb|EFG53826.1| flagellar biosynthetic protein FliR [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216763|gb|ADP75367.1| flagellar biosynthetic protein FliR [Geobacillus sp. Y4.1MC1]
          Length = 257

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 95/241 (39%), Gaps = 6/241 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
                LI  RV S    LP  S   IPM  ++  +   S ++   +              
Sbjct: 8   FPVFLLIFARVASFFATLPLFSYRTIPMAHKIGLSFFLSWMMFFAISK----PTVALDEM 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LV+ E+ +G   GL   +    +Q  G +I   +G  +   +          +    
Sbjct: 64  YVLLVVKEVLVGLCIGLFAFMIISAIQIVGGLIDFQMGFAIANVIDPQTGAQNPLMGQYF 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL--NFGNIFSSFVNMLQTTFMIMLRLS 186
            +  LL L  ++ HH +   +  SY  IP+      + G++    V      F I  ++S
Sbjct: 124 YMFALLLLLSVNGHHLLLDGVFYSYRFIPLDHWPRLDHGHVAEYIVKSFSAMFAIAFQMS 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +    + ++++G++ + VPQ+ I+ +  P  I +G + L +++  I     H F   
Sbjct: 184 VPLVGCLFLVDVALGIVARTVPQLNIFVVGFPVKIAVGFILLIVTMAAIFLAVRHLFDTM 243

Query: 247 F 247
           F
Sbjct: 244 F 244


>gi|148546752|ref|YP_001266854.1| flagellar biosynthesis protein FliR [Pseudomonas putida F1]
 gi|148510810|gb|ABQ77670.1| flagellar biosynthetic protein FliR [Pseudomonas putida F1]
          Length = 258

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P +VRL  A+A ++V++P L    +      R
Sbjct: 11  TWVATFILPLFRVTAVLMTMPIFGTRMLPARVRLYVAVAITVVIVPALPPLPEFDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++ 
Sbjct: 71  G--LLLCAEQIIVGALFGLALQLLFQAFVIAGQIVAVQMGMAFASMVDPANGVNVTVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L 
Sbjct: 129 FMTMLVSVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V NI+ G++ +  PQ+ I+ I  P  + +G     + +  I+  +       
Sbjct: 188 LPVIAALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMGMAIFWIGLADILSHYQALASEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|300311363|ref|YP_003775455.1| flagellar biosynthesis protein FliR [Herbaspirillum seropedicae
           SmR1]
 gi|300074148|gb|ADJ63547.1| FliR component of the flagellar biosynthesis pathway
           [Herbaspirillum seropedicae SmR1]
          Length = 267

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 93/240 (38%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + +        R+   + + P    + +PM V++   +A   V+ P +     ++     
Sbjct: 11  VWVAMFIWPTTRILGLMAIAPPFGSASVPMLVKVLLGVAIGAVIAPDVPIPPAIEPTSMT 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L  + + L    G  +R+    ++  G   ST +GL+               ++ 
Sbjct: 71  GIMILLQQLLIGL--SMGFAMRIVFAAVEAAGEFTSTTMGLSFAAFFDPQTQGRTAVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  ++  +    ++ H  +   + +S+ T+PI  +      F   V      F + L+LS
Sbjct: 129 VFSLLATMVFLNLNGHLILLQVMAESFHTLPITGQPITTEGFHQLVLWGAKIFSMGLQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P L   ++ N ++G+L +  PQ+ ++ I     +  G + + +++  ++         G
Sbjct: 189 LPLLIALLITNFALGVLTRAAPQLNLFGIGFSITMLAGFILIGITLPYMLTPVQKLLSDG 248


>gi|295706268|ref|YP_003599343.1| flagellar biosynthetic protein FliR [Bacillus megaterium DSM 319]
 gi|294803927|gb|ADF40993.1| flagellar biosynthetic protein FliR [Bacillus megaterium DSM 319]
          Length = 258

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 103/239 (43%), Gaps = 7/239 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  L++ RV S  + +P  S   IP   ++  + + S+++      TIDL      A + 
Sbjct: 10  AFLLVLVRVTSFFITVPLFSYKTIPAVHKVGLSASLSVIIA----TTIDLPVVSLDAQFL 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            LV+ E  +G   GL   V+ + +Q  G +I   +G  +   +          L   + +
Sbjct: 66  LLVVKECAVGLFIGLTAYVFIMAIQIAGGLIDFQVGFAIANVIDPQTGAQSPILGQYLYV 125

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRLSS 187
             LL L   + HH +   +  SY  IP+ +           +  + +  + F++ +++S 
Sbjct: 126 FALLFLLSTNGHHLLIDGIYNSYLIIPLDKVAFPVGSQAFATHIITVFSSMFLVAVQMSL 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +    + +I++G++ + VPQ+ I+ +  P  I +  + L + +  + Y     F   
Sbjct: 186 PLVGSLFLVDIALGIVARTVPQLNIFVVGFPVKIIVAFILLIVVMGSMFYMMQIIFEQM 244


>gi|264676606|ref|YP_003276512.1| flagellar biosynthetic protein FliR [Comamonas testosteroni CNB-2]
 gi|262207118|gb|ACY31216.1| flagellar biosynthetic protein FliR [Comamonas testosteroni CNB-2]
          Length = 254

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L     RV +     P  S   IPM++++  A   ++   P L +   +     +
Sbjct: 11  AWLSPLIWPFVRVLALFTTAPVFSQKAIPMRLKVGLAFLVALCAQPVLGEQTVVSIASAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     ++ ++ +G   G  +R+    ++  G V+   +GLN  +    + +   + +  
Sbjct: 71  A--LGTLVQQVVIGLSVGFAVRLVMAAIEVAGEVVGLQMGLNFASFFDPTSNAQLSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I  L   VI+ H  V  A++KS+   P+               M    F     ++
Sbjct: 129 FMVQIATLLFIVINGHLLVLMAVLKSFEAFPVDGNFLQAISQMRIHEMGSAVFASAFWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +G+++++ PQ+ IY +  P  + +G L L  ++ ++          G
Sbjct: 189 LPMIAMLLFVNLVLGIISRVAPQMNIYAVGFPVTLTVGLLGLTATLPLLEQPLVALLQKG 248


>gi|21231362|ref|NP_637279.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768585|ref|YP_243347.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991604|ref|YP_001903614.1| hypothetical protein xccb100_2210 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21113024|gb|AAM41203.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573917|gb|AAY49327.1| flagellar biosynthetic protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733364|emb|CAP51565.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 263

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 87/242 (35%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+      ++ L P L    +   F   
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLTGTLAMALAPILPPVPEWDGFNAT 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++R+        G ++S A GL+          +    +  
Sbjct: 76  A--VLSIARELAVGASMGFMLRLIFEAGALAGELVSQATGLSFAQMSDPLRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  +     F+     +L       L L
Sbjct: 134 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTAVPDAAAFAEVAPTLLLQVLRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPMQLGLPLTVLLGLFLLSSFASEFAPPVQRLFDS 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|197285501|ref|YP_002151373.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|227355992|ref|ZP_03840384.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
 gi|194682988|emb|CAR43426.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|227163980|gb|EEI48882.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F    R+ +     P  S    P + R+  A   + ++ P L  +   Q  +  
Sbjct: 11  GYISDFFWPFVRILALFSTAPLFSEKQTPKKFRIGLAFLTTALIAPGLPQS---QVPLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ ++ +G + GL +++    ++  G VI   +GL+  T +  S       L  
Sbjct: 68  IMAFWVLIQQILIGTILGLSMQLAFASVRHAGEVIGLQMGLSFATFVDPSGGPNMPILAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  ++ +L   V D H  +   L  ++  +PIG +        + V    T F+  + L+
Sbjct: 128 IFNMLTMLLFMVFDGHLWLLSVLADTFYVVPIGNQTFNSLGILTLVQSGGTIFINGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N+S+G+LN++ PQ+ ++ +  P  + +G L L L +  +       F   
Sbjct: 188 MPLITLLLVLNLSLGILNRMTPQLSVFVVGFPLTLTIGMLALSLIMPALPVFTERVFSDT 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|296135633|ref|YP_003642875.1| flagellar biosynthetic protein FliR [Thiomonas intermedia K12]
 gi|295795755|gb|ADG30545.1| flagellar biosynthetic protein FliR [Thiomonas intermedia K12]
          Length = 266

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 54/248 (21%), Positives = 104/248 (41%), Gaps = 4/248 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +   E  + + F    RV + + L P  SM  +P  VR+  A+  ++ + P L     +Q
Sbjct: 6   STQIETWIGAFFWPFLRVLAMLSLAPVFSMGSLPTMVRVGLAVLIAVAIAPALPAMPPVQ 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                A+   L    L +G   GL + +    + F GSVI   +G+   T       +  
Sbjct: 66  FGTATAWMLLLQQ--LLVGGAIGLSMTLILSAVMFAGSVIGLQMGMGFATLFDPVQGVQV 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNM--LQTTF 179
           T L S + ++ +L    ++ H  +   + +S+  +P+   L         +        F
Sbjct: 124 TSLASFLNMVTMLLFLAVNGHLILLAVIARSFTLLPVAPNLGLAAQTWFTLAQQGGSAIF 183

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            + L L++P +   ++ N+ +G+L KL PQ+ ++ +  P    +G L L L + ++    
Sbjct: 184 SLGLALAAPVIGVLLIANLGLGVLTKLAPQLNLFAVGFPMFFIMGFLALYLVMPVMQNVV 243

Query: 240 SHSFLYGF 247
            H    G 
Sbjct: 244 QHLVDVGL 251


>gi|229528867|ref|ZP_04418257.1| flagellar biosynthesis protein FliR [Vibrio cholerae 12129(1)]
 gi|229332641|gb|EEN98127.1| flagellar biosynthesis protein FliR [Vibrio cholerae 12129(1)]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 93/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++P +VRL   +A +  ++P +         ++  
Sbjct: 11  FIANYFWPYMRIAAMLMVMTVTGARFVPARVRLYLGLALTFAVMPAIPAVPSDIALLSLQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  +   ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MITFEQIVIGVAMGMVTQFLVQIFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++  L   V D H ++   +V S+ ++PIG        F      L   F   L +S 
Sbjct: 130 FMLLATLFFLVSDGHLKMIQLVVFSFKSLPIGSGSLTTVDFRELALWLGIMFKASLAVSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +   
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYIVHGLYTHYDIYWQEA 248


>gi|238788322|ref|ZP_04632116.1| Flagellar biosynthetic protein fliR [Yersinia frederiksenii ATCC
           33641]
 gi|238723568|gb|EEQ15214.1| Flagellar biosynthetic protein fliR [Yersinia frederiksenii ATCC
           33641]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            I +   F  + RV + I   P LS   I  +V++  A+  + ++ P L     +   + 
Sbjct: 10  SIWVSQYFWPLVRVLALITTAPVLSEKQINRKVKVGLAVLITFLIAPSLP---PVNIPLV 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L 
Sbjct: 67  SAGAVWVAAQQVLIGVAIGLTMQFAFAAVRLAGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ +L     D H  +   L  S+ T+PI  E   GN F +        FM  L L
Sbjct: 127 RLLNLLAMLLFLAFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTQAGSLIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + L L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISLGLIMPLLAPFSEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 FF 248


>gi|167034910|ref|YP_001670141.1| flagellar biosynthesis protein FliR [Pseudomonas putida GB-1]
 gi|166861398|gb|ABY99805.1| flagellar biosynthetic protein FliR [Pseudomonas putida GB-1]
          Length = 258

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P +VRL  A+A ++V++P L    +      R
Sbjct: 11  TWVATFILPLFRVTAVLMTMPIFGTRMLPARVRLYVAVAITVVIVPALPPLPEFDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++ 
Sbjct: 71  G--LLLCAEQIIVGALFGLALQLLFQAFVIAGQIVAVQMGMAFASMVDPANGVNVTVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L 
Sbjct: 129 FMTMLVSVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFAAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V NI+ G++ +  PQ+ I+ I  P  + LG     + +  ++  +       
Sbjct: 188 LPVIAALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVLGMFIFWVGLADVLSHYQALASET 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|238794005|ref|ZP_04637623.1| Flagellar biosynthetic protein fliR [Yersinia intermedia ATCC
           29909]
 gi|238726637|gb|EEQ18173.1| Flagellar biosynthetic protein fliR [Yersinia intermedia ATCC
           29909]
          Length = 260

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 104/242 (42%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
            + +   F  + RV + I   P LS   I  +V++  A+  + ++ P L     +   + 
Sbjct: 10  SVWVSQYFWPLIRVLALITTAPVLSEKQINRKVKVGLALLITFLIAPSLP---PVNIPLV 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +   ++ +G   GL ++     ++  G VI   +GL+  T    S       L 
Sbjct: 67  STGAVWVAAQQVLIGVAIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNMPVLA 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ ++ LL     D H  +   L  S+ T+PI  E   GN F +        FM  L L
Sbjct: 127 RLLNLLALLLFLTFDGHLWLISLLADSFHTLPIQFEPLNGNGFLALTQAGSLIFMNGLML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N+++G+LN++ PQ+ ++ I  P  + +G + + L + ++     H F  
Sbjct: 187 ALPLITLLLTLNMALGMLNRMTPQLSVFVIGFPLTLTVGIISIGLIMPLLPPFAEHLFGE 246

Query: 246 GF 247
            F
Sbjct: 247 VF 248


>gi|152987229|ref|YP_001349233.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa PA7]
 gi|150962387|gb|ABR84412.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa PA7]
          Length = 258

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S  L + RV + +M +P +    +P++VRL  A+   +VL+P L     +     +
Sbjct: 11  GWIASFVLPLFRVAALLMTMPVIGTQLVPVRVRLYLALGICVVLVPNLPPMPQVDALSVK 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    L+  ++ +G + G  +++        G +IS  +GL   + +  ++ ++   L  
Sbjct: 71  SML--LIGEQILVGALLGFSLQLLFHAFVIAGQIISMQMGLGFASMVDPANGVSVPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    ++ H  VF  + +S+ T+P+G+ L  GN F      L       L L+
Sbjct: 129 FFTMLVTLLFLAMNGHLVVFEVIAESFVTLPVGEGL-SGNHFWVIAGKLGWVMGAALLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++ G + +  PQ+ I+ I  P  + LG   L +    ++ Q+       
Sbjct: 188 LPAITALLVVNLAFGAMTRAAPQLNIFSIGFPLTLVLGLGILWIGTADLLGQYQVLAGEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|221069286|ref|ZP_03545391.1| flagellar biosynthetic protein FliR [Comamonas testosteroni KF-1]
 gi|220714309|gb|EED69677.1| flagellar biosynthetic protein FliR [Comamonas testosteroni KF-1]
          Length = 254

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L     RV +     P  S   IPM++++  A   ++   P L +   +     +
Sbjct: 11  AWLSPLIWPFVRVLALFTAAPVFSQKAIPMRLKVGLAFLVALCAQPVLGEQTVVSIASAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     ++ ++ +G   G  +R+    ++  G V+   +GLN  +    + +   + +  
Sbjct: 71  A--LGTLVQQVVVGLSVGFAVRLVMAAIEVAGEVVGLQMGLNFASFFDPTSNAQLSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I  L   VI+ H  V  A++KS+   P+               M    F     ++
Sbjct: 129 FLVQIATLLFIVINGHLLVLMAVLKSFQAFPVDGNFLQAISQMRIHEMGSAIFSSAFWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +G+++++ PQ+ IY +  P  + +G L L  ++ ++          G
Sbjct: 189 LPMIAMLLFVNLVLGIISRVAPQMNIYAVGFPVTLTVGLLGLTATLPLLEQPLVALLQKG 248


>gi|187926925|ref|YP_001893270.1| flagellar biosynthetic protein FliR [Ralstonia pickettii 12J]
 gi|241665254|ref|YP_002983613.1| flagellar biosynthetic protein FliR [Ralstonia pickettii 12D]
 gi|187728679|gb|ACD29843.1| flagellar biosynthetic protein FliR [Ralstonia pickettii 12J]
 gi|240867281|gb|ACS64941.1| flagellar biosynthetic protein FliR [Ralstonia pickettii 12D]
          Length = 262

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/241 (13%), Positives = 93/241 (38%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  + + +P  +++   +  ++ L P L   + +      
Sbjct: 11  GWIAMYWWPLVRVLAFIAMAPPFANTEVPTSIKIALGVIITVALAPMLPVPVGVSVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  +  +G   G  +++    +   G V+S  +GL   + +    + +   L  
Sbjct: 71  GLWITLL--QAVIGLSLGFCVQLVFSAISGAGEVMSVQMGLGFASLLDPQQTESSMLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+         + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLLHALFDSFTALPVSAAPLANPGWQTLAGGGTMVFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N+   +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMLVVNLGFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMDA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|78777992|ref|YP_394307.1| flagellar biosynthesis protein FliR [Sulfurimonas denitrificans DSM
           1251]
 gi|78498532|gb|ABB45072.1| Flagellar biosynthesis protein FliR [Sulfurimonas denitrificans DSM
           1251]
          Length = 254

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 106/243 (43%), Gaps = 3/243 (1%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
            +  ++   L+  R  +  + +P  S + IP+ ++   A  F+IV    +     L   +
Sbjct: 8   SDTYIVGFILLFFRFAALFIAVPIFSHNNIPISIKTSLAFFFTIVFYSSMP---PLTMVI 64

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                   ++ EL  G   G+++++    + F G  IS  +G ++ +++     ++   +
Sbjct: 65  TVPSIVMAILSELLFGLAIGVILQIAFNAITFAGGQISFMMGFSMASAIDPQSGISMPII 124

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
           +  + ++ L+ L+ ID HH +   +  S   IP+G  +   N+F+  +  +   F++   
Sbjct: 125 SQFLSLMALMMLFAIDMHHWILLFIDSSLQNIPLGGFVMSENLFTYIIKAMSNMFLVGFM 184

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ P     ++ +I  G+L K +PQ  +  I  P  I +    L  +I  I+       +
Sbjct: 185 IAFPITALGLLADIIFGMLMKTMPQFNLLVIGFPIKIMVSFAVLIATISAIMLIIKGQMV 244

Query: 245 YGF 247
             F
Sbjct: 245 EAF 247


>gi|323496543|ref|ZP_08101597.1| flagellar biosynthesis protein FliR [Vibrio sinaloensis DSM 21326]
 gi|323318387|gb|EGA71344.1| flagellar biosynthesis protein FliR [Vibrio sinaloensis DSM 21326]
          Length = 260

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 94/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  +VRL   +A +  ++P +    +    ++  
Sbjct: 11  WLANYFWPYTRISAMLMVMSVTGARFVSTRVRLYLGLAITFAVMPAIPAVPEDIQLLSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + ++ +G   G + +         G ++     L   + +  ++      L  L
Sbjct: 71  GFMTL-LEQIVIGVAMGTVTQFMIQTFVILGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ ++PIG        F      L   F + L +S 
Sbjct: 130 FMFLATMFFLATDGHLKMIMLVVMSFKSLPIGAGSLTTVDFRELALWLGIMFKVALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +L G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALIVGLLLCWYILGGLYSHYELFWLQG 248


>gi|331671780|ref|ZP_08372576.1| flagellar biosynthetic protein FliR [Escherichia coli TA280]
 gi|331070769|gb|EGI42128.1| flagellar biosynthetic protein FliR [Escherichia coli TA280]
          Length = 277

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 100/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 29  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 88

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 89  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 146

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 147 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 205

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  + +G +     +  +   + H 
Sbjct: 206 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLVGLVCFATLLYNLPDHYLHL 260


>gi|153836975|ref|ZP_01989642.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           AQ3810]
 gi|149749748|gb|EDM60493.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           AQ3810]
          Length = 260

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL   +A +  ++P +         ++  
Sbjct: 11  WIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIQLLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQMIIGVAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGTLTAVDFRDVAGWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLICWYILAGLYSHYELYWALG 248


>gi|304412526|ref|ZP_07394132.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|307307185|ref|ZP_07586923.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
 gi|304349168|gb|EFM13580.1| flagellar biosynthetic protein FliR [Shewanella baltica OS183]
 gi|306910424|gb|EFN40855.1| flagellar biosynthetic protein FliR [Shewanella baltica BA175]
          Length = 259

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 109/240 (45%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ SL+   CR+    M++P L  SY+P  VR+  A++ + ++ P L     +      +
Sbjct: 12  LIGSLWWPFCRIMGAFMIIPLLGNSYVPATVRIFLALSIAALIAPMLPPVPPVDALSLGS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + +L +G +  L + +    +   G+++S  +GL +      ++      L+  
Sbjct: 72  LF--LAVEQLLIGFMLALFLTILIHVMTMLGTIMSMQMGLAMAVMNDPANGDTNPILSEW 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + I G L    +D H      +V S+   PIG  +    +    ++ +   F   L L+ 
Sbjct: 130 LQIFGTLIFLALDGHLVGLNIIVDSFRLWPIGNGIFDLPLM-GLISRMGWLFAASLMLAI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ NI+ G+L++  P + I+ +  P  + +G + + LS+  I  ++S   L   
Sbjct: 189 PAVLAMLMVNITFGVLSRAAPSLNIFSLGFPMTLLMGLICVFLSLSGIPTRYSDLCLDAL 248


>gi|323527704|ref|YP_004229857.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1001]
 gi|323384706|gb|ADX56797.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1001]
          Length = 260

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 109/240 (45%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P L    +P++V++  +   +I++ P L     +  F   
Sbjct: 11  AWLTAFLWPFVRILALVATAPVLGNRSLPLRVKIGLSAFVTIIVAPTLGALPQVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G+ +++    +  TG  +   +GL   T      S +   L+S
Sbjct: 71  GVWI--IVNQFLIGIALGVTMQIVFQAISATGDFVGLGMGLGFATFFDAQASSSSQVLSS 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +L   VID H Q+  AL+ S+ ++P+   +     + +  N   T F   L LS
Sbjct: 129 YMYTIAMLVFLVIDGHLQMISALLASFNSLPVSANILGSPGWRTLANFGSTIFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L L L I  ++  F+  F  G
Sbjct: 189 LPVVAALLITNLALGILNRAAPQIGVFQIGFPLTMLIGLLLLQLMIPNMIPFFARLFAVG 248


>gi|149188097|ref|ZP_01866392.1| flagellar biosynthesis protein R [Vibrio shilonii AK1]
 gi|148838085|gb|EDL55027.1| flagellar biosynthesis protein R [Vibrio shilonii AK1]
          Length = 260

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 90/239 (37%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + F    R+ + +M++     +++  ++RL   +A ++ ++P +          + 
Sbjct: 10  EWISNYFWPYVRISAMLMVMSVTGANFVSPRIRLFLGLALTLAVMPSIPAVPQTIELFSF 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V  ++ +G   G+            G ++     L   + +  ++      L  
Sbjct: 70  QGFLT-VAEQILIGTAMGMTTVFMIQTFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L   +  +     D H ++   +V S+ T+PIG        F      L   F   L ++
Sbjct: 129 LFMFLATMFFLATDGHLKMIQLVVMSFKTLPIGSGHLSSADFREMAGWLSIMFQTALSMA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
              +   +  N+S G++ +  PQ+ I+ +   + + +G +     +  +   +   +L 
Sbjct: 189 LAGIIALLTVNLSFGVMTRAAPQLNIFSLGFAFALLIGLMICWYIMAGLYSHYQLYWLE 247


>gi|206603140|gb|EDZ39620.1| flagellar biosynthesis protein, FliR [Leptospirillum sp. Group II
           '5-way CG']
          Length = 262

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 102/239 (42%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            ++    ++ RV   ++ +P LS   +P++++   A+A + ++ P +   +      +  
Sbjct: 10  TLLLYVWVLARVSGLVVSMPVLSGKAVPVRIKALIAVALAFLIEPVVLGNVSPPRLFSA- 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   ++ E F+G   G    +    + F G +    +G  L   +          L + 
Sbjct: 69  -WLGSLVTEFFVGVALGFSSYLVFAAVSFAGELAGVQVGFGLVDVINPLGLAEVPLLGTF 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  L       H  + +AL +SY  +P G+       +  ++ +     ++ + L++
Sbjct: 128 QNSVAFLVFLASGTHEALIWALGRSYAVVPPGEGRFRTIFYEGYLGVFAHFMVLGITLAA 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           PFL   IV N+++G L++++PQ+ +  +  P L+  G   L LS+  +      SF   
Sbjct: 188 PFLVGGIVLNLAMGFLSRMMPQMNLISVGFPVLVLGGLGLLILSLPFLGSVLEDSFFRM 246


>gi|166712020|ref|ZP_02243227.1| flagellar biosynthetic protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 263

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 88/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 16  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 75

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 76  A--VLSIARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 134 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTVLPDAGAFAEVAPTLFLQILRGGLTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 194 ALPMMVAMLAVNLAFGALAKAAPALNPVQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 253

Query: 246 GF 247
             
Sbjct: 254 AL 255


>gi|331640692|ref|ZP_08341839.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
 gi|331040066|gb|EGI12274.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
          Length = 277

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 29  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 88

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 89  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 146

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 147 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 205

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 206 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 260


>gi|254497496|ref|ZP_05110289.1| flagellar biosynthetic protein FliR [Legionella drancourtii LLAP12]
 gi|254353311|gb|EET12053.1| flagellar biosynthetic protein FliR [Legionella drancourtii LLAP12]
          Length = 256

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 99/239 (41%), Gaps = 2/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++  +     R+G  ++ +P  S   +P +V++ F    S V  P + + +   NF    
Sbjct: 11  VISQVMWPFARIGGLLLSVPVFSSVLLPSRVKVIFLFVLSWVCSPLVPEELTFLNF--NG 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            Y   +  EL LG + G +++         G +IS   G+     +  +   +   +  L
Sbjct: 69  AYIVYIAQELLLGLLMGFVLQFTFQVFILGGQIISMQAGMGFAVMVDPASKASVPLVGQL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             I+  L    ++ H  +   L+ S+  +P+G      ++    + +    F   L +S 
Sbjct: 129 YLIMMTLIFLALNGHLMIIETLMDSFKKMPVGHSGVTSSMLWHVITISSWMFKKALLISI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P L   +V ++S G++ +  PQ+ I+ +  P  + +G + + + +  +  Q       G
Sbjct: 189 PALLSLLVVSLSFGVMARAAPQLNIFSLGFPITLLMGIVVIKIGLPSVAAQMVDIIDEG 247


>gi|289670561|ref|ZP_06491636.1| flagellar biosynthetic protein FliR [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 257

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 10  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 70  S--VLSIARELAVGASMGFMLKLIFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 128 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLTL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 188 ALPMMVAMLAVNLAFGALAKAAPALNPVQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 247

Query: 246 GF 247
            F
Sbjct: 248 AF 249


>gi|146341891|ref|YP_001206939.1| flagellar biosynthesis protein FliR [Bradyrhizobium sp. ORS278]
 gi|146194697|emb|CAL78722.1| Flagellar biosynthetic protein fliR [Bradyrhizobium sp. ORS278]
          Length = 255

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 119/238 (50%), Gaps = 1/238 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +     L   R+ + +MLLPGL    IP++++L  A+  ++++LP       +      
Sbjct: 10  TLAAVFMLAFARIAAMVMLLPGLGEVNIPVRIKLATALLLTMIVLPLNRQAYQVD-LQAL 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    +++ E+ +G V G   RV    LQ  GSVI+  +GL   T++  +       + +
Sbjct: 69  SPLVVMMVHEIVIGIVLGATARVTLSALQVAGSVIAQQMGLGFVTAVDPTQGQQGVLIGN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G+  L+  D HH V  AL  SY     G+ +  G++ S         F I L+LS
Sbjct: 129 FLTMLGVTLLFATDSHHLVIAALSDSYKIFAPGELVPSGDVASLATKAFAAAFKIGLQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           +PFL F +VFNI +G+L +L+PQ+ +YF+  P  I +G L   L +  ++  F   F 
Sbjct: 189 APFLVFGLVFNIGLGVLARLMPQMQVYFVGAPLSILIGFLIFALVLTAMMGTFLGYFE 246


>gi|300696943|ref|YP_003747604.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum CFBP2957]
 gi|299073667|emb|CBJ53187.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum CFBP2957]
          Length = 262

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  S + IP  +++ F +A ++ L P L     +      
Sbjct: 11  GWIALYWWPLVRVLAFIAMAPPFSNTEIPTSIKVAFGVALTVALAPMLPVPQGVSVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   G  +++    +   G ++S  IGL   T +    + +   L  
Sbjct: 71  GLWITLL--QVAIGMALGFCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+      G  + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGSAVFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N++  +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMIVNLAFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMDA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|317153079|ref|YP_004121127.1| flagellar biosynthetic protein FliR [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943330|gb|ADU62381.1| flagellar biosynthetic protein FliR [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 261

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 102/237 (43%), Gaps = 1/237 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M+S FL + R+   + L+P    + IP  V+    +  S+ + P L          N   
Sbjct: 11  MLSFFLTLFRISVVLFLMPFFGGNSIPTLVKGALVLVLSLAVWPQLSF-PGSMLPANGLD 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            + + + E+ LG + GL +      +QF G +I   +G  + + +              +
Sbjct: 70  ITIMFLGEVLLGLILGLTVNFLFGAIQFGGQIIGFQMGFAMVSVVDPISGTTNAVTAHFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +  +L   V++ H Q+  AL  S+  IP G  L   ++ + F+++    F + +R+++P
Sbjct: 130 YMCTMLTFLVLNGHLQLINALGMSFQYIPPGGLLITPSLATQFLSLSAIMFTLAIRIAAP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +    + ++++ L+++  PQ+ +  +  P  I +G  FL     I+          
Sbjct: 190 VMAALFLVDLALALISRAAPQMHVLILGFPIKITVGFFFLGFLFTIMSLYVQEFIQD 246


>gi|91223557|ref|ZP_01258822.1| flagellar biosynthesis protein R [Vibrio alginolyticus 12G01]
 gi|91191643|gb|EAS77907.1| flagellar biosynthesis protein R [Vibrio alginolyticus 12G01]
          Length = 260

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL   +A +  ++P +         ++  
Sbjct: 11  WIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIELLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQIIIGIAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMAGWLGIMFQTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYEMFWTVG 248


>gi|254292631|ref|YP_003058654.1| flagellar biosynthetic protein FliR [Hirschia baltica ATCC 49814]
 gi|254041162|gb|ACT57957.1| flagellar biosynthetic protein FliR [Hirschia baltica ATCC 49814]
          Length = 247

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 113/230 (49%), Gaps = 1/230 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+ CR+GS +ML PG   S +P Q RL  A+  ++ L+P L D +     +     + L+
Sbjct: 9   LLFCRIGSVLMLAPGWGESSVPAQFRLSAALLATMALVPNLIDQMPPVPELVSQS-ALLI 67

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G   R+    LQ  G +I  + GL + T    +   +   +   + +  +
Sbjct: 68  ISEILIGIMMGAGARILMSALQVGGQIIGISSGLAMATQFDPTIGSSSAIIGVFMSMTAI 127

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + + +   H  +  A V SY     G+ L  G+     +  + + F + L++++P L   
Sbjct: 128 VLIMIAGIHRDMLQAAVDSYQLFKPGEPLPIGDAAQWELGAMSSAFKLGLQIAAPILVVA 187

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +VFN+SIGL+ +L+PQ+ ++FI+ P  + LG   +   +   +  +  + 
Sbjct: 188 LVFNLSIGLVARLIPQVQVFFIAMPIQVMLGLSIMTFILGGGLLVWLDAL 237


>gi|320354334|ref|YP_004195673.1| flagellar biosynthetic protein FliR [Desulfobulbus propionicus DSM
           2032]
 gi|320122836|gb|ADW18382.1| flagellar biosynthetic protein FliR [Desulfobulbus propionicus DSM
           2032]
          Length = 259

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 55/244 (22%), Positives = 110/244 (45%), Gaps = 1/244 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           + P        L + RV + +  +P  + S I  ++++  A+A S++L P +   I    
Sbjct: 5   LFPLQQFQEFLLCLARVLALVAAIPAFAGSAISGRIKIGLAVATSLLLFPAMAPHIPKVA 64

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
           F     +  L++ E+ LG + GL+ ++    + F G+VI   +G           +   +
Sbjct: 65  FTLT-EFGLLIVNEVLLGVMIGLVTQMVFAAVSFGGTVIGYQMGFAAANIFDPQTTQQLS 123

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            ++    I+ LL    +D HH  F ALV+SY  +P G            + +    F++ 
Sbjct: 124 LMSQFANILALLVFLALDMHHFFFRALVESYHLLPPGPLDFSHGAVEELMRLASRMFVLG 183

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++ S+P L   ++ N+ +G+L ++ PQ+ ++ +S P  IG+  L + L++          
Sbjct: 184 VKFSAPVLTLLLLTNLVLGILARVFPQLNVFMLSFPLNIGIAFLVIGLTLGATFSVLRRE 243

Query: 243 FLYG 246
           F   
Sbjct: 244 FDTM 247


>gi|28899011|ref|NP_798616.1| flagellar biosynthesis protein FliR [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260365243|ref|ZP_05777800.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus K5030]
 gi|260878793|ref|ZP_05891148.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           AN-5034]
 gi|260897388|ref|ZP_05905884.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           Peru-466]
 gi|260899947|ref|ZP_05908342.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           AQ4037]
 gi|4322009|gb|AAD15912.1| polar flagellar assembly protein FliR [Vibrio parahaemolyticus]
 gi|28807230|dbj|BAC60500.1| polar flagellar assembly protein FliR [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088233|gb|EFO37928.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           Peru-466]
 gi|308094303|gb|EFO43998.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           AN-5034]
 gi|308107282|gb|EFO44822.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus
           AQ4037]
 gi|308115400|gb|EFO52940.1| flagellar biosynthetic protein FliR [Vibrio parahaemolyticus K5030]
          Length = 260

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL   +A +  ++P +         ++  
Sbjct: 11  WIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIQLLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQMIIGVAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGTLTAVDFRDMAGWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLICWYILAGLYSHYELYWALG 248


>gi|260767694|ref|ZP_05876629.1| flagellar biosynthesis protein FliR [Vibrio furnissii CIP 102972]
 gi|260617203|gb|EEX42387.1| flagellar biosynthesis protein FliR [Vibrio furnissii CIP 102972]
          Length = 260

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 95/240 (39%), Gaps = 1/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + F    R+ + +M++      ++  ++RL   +A +  ++P +         ++ 
Sbjct: 10  EFIANYFWPYARISAMLMVMTVTGARFVSTRIRLYLGLAITFAVMPAIPAVPSDLELLSF 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +    + ++ +G   G++ +         G ++     L   + +  ++      L  
Sbjct: 70  NGFLTT-LNQIIIGVAMGMVTQFMIQTFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L   +  L   V D H ++ + +V S+ ++PIG        F      L T F + L +S
Sbjct: 129 LFMFLATLFFLVSDGHLKMIHLVVLSFKSLPIGTHSLTAVDFRELALWLGTMFKVALSMS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 189 LSGIVALLTVNLSFGVMTRAAPQLNIFSLGFAFALLVGLLLCWYILSGLFSHYELFWAEG 248


>gi|224826620|ref|ZP_03699721.1| flagellar biosynthetic protein FliR [Lutiella nitroferrum 2002]
 gi|224601221|gb|EEG07403.1| flagellar biosynthetic protein FliR [Lutiella nitroferrum 2002]
          Length = 258

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++        R+   ++  P  S    P + +  FA+  +++L+P L     +      
Sbjct: 11  ALVSLFVWPFARIMGVLLADPLFSSRSAPARFKAGFALLLTLLLVPLLPPQPAIPVVSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ +L +G   GL++RV    ++  G V+ T +GL   +     ++     +  
Sbjct: 71  G--VAVLVQQLLIGLALGLVMRVVITAVEMAGFVMGTQMGLGFASFYDPINAAQVPTIAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ +   L   ++  H  V   L++S+ T+PIG  L   +   +        F   L L+
Sbjct: 129 ILTLFTFLLFLLMGGHQVVIEILLESFRTLPIGMTLPP-DRLKALAEWGGHIFNWGLWLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++IG++ +  PQ  I+    P  + +G   L LS+ ++V      +   
Sbjct: 188 LPVVAALLVTNLAIGVMTRASPQFNIFTFGFPLTLLVGFAALYLSVPLMVPAIESIYREA 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|330505668|ref|YP_004382537.1| flagellar biosynthetic protein FliR [Pseudomonas mendocina NK-01]
 gi|328919954|gb|AEB60785.1| flagellar biosynthetic protein FliR [Pseudomonas mendocina NK-01]
          Length = 264

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 104/237 (43%), Gaps = 4/237 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + +   CR+ + + + P  +   + ++VR+  A+A ++ L   L D   +     +
Sbjct: 13  TSLQAYWWPFCRIAALLSMAPLFNHKAVSVRVRVLLALALTVALGAALPDMPQIDPLSLK 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDS-LAETPLN 125
              + L   ++  G + GL +++        G V+ST +G+++       +   + + + 
Sbjct: 73  GLMTAL--EQIAFGVLLGLTLQLVFTIFMLVGEVVSTQMGMSMARYNDPVNGVSSSSIIY 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L  I+ +L  + ID H      L +S+   P+G  L+F     SF+          + +
Sbjct: 131 QLYFILLVLLFFAIDGHLVTVSVLYQSFLFWPVGSGLHFQG-AQSFIQAFPWVLAAAVLV 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P +F   +     GLLN++ P + ++ +  P  I +G L + L++  +   + H 
Sbjct: 190 TLPVVFCLTLVQFCFGLLNRISPAMNLFSLGFPISILMGLLCIYLTLPNLPDSYLHL 246


>gi|167585024|ref|ZP_02377412.1| flagellar biosynthetic protein FliR [Burkholderia ubonensis Bu]
          Length = 260

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 104/241 (43%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + + + P    + +P +V++  A   ++V+ P L     +  F  +
Sbjct: 11  AWLTAFLWPFVRMLALVAVAPVTGHASVPGRVKIGVAAFMALVVAPTLGAMPAVTVFSAQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   V+ +  +G   G  +++     Q  G  I  ++GL   T      S A   +  
Sbjct: 71  GIWI--VVTQFLIGVAMGFTMQIVFAAAQAAGDAIGLSMGLGFATFFDPHASGATPVMGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  + +LA    D H QV  AL  S+  +P+  EL     + +      T F + L L+
Sbjct: 129 FLNAVAILAFLAFDGHLQVLAALAASFQALPVSAELLHAPGWRTLAAFGATVFQMGLLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQ+ I+ +  P  + +G L + L +  +V  F   F  G
Sbjct: 189 LPVVAALLIANLALGILNRAAPQVGIFQVGFPVTMLVGLLLVQLMVPNMVPFFGRLFDMG 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|83309717|ref|YP_419981.1| flagellar biosynthesis protein FliR [Magnetospirillum magneticum
           AMB-1]
 gi|82944558|dbj|BAE49422.1| Flagellar biosynthesis pathway [Magnetospirillum magneticum AMB-1]
          Length = 254

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 119/247 (48%), Gaps = 1/247 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +T   ++ +   FL+  R+G+ +ML PGL  S +  ++RL  A++ + V+LP +  +   
Sbjct: 2   LTDLLQLDIFRFFLVFTRIGAALMLFPGLGGSLVSTRIRLLLALSVAFVMLPVVGASFPA 61

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               +       V  E  +G   G +I      L   GS+I    GL    S        
Sbjct: 62  -VPRSVGGMLLAVFGEAVVGVYLGTVIMFIMSTLNMAGSMIGYQTGLTNAFSFDPIAQQQ 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              L   +  IGL+A++  D HH +F A+ +SY   P GQ L FG+   +  ++   TF 
Sbjct: 121 SQLLTGFLANIGLVAVFATDMHHLMFQAVFESYYLFPPGQPLQFGDYAETLGHLATDTFK 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +  + ++P + F +VF   +GLL++LVPQ+ ++F+  P  + +G     +++ +++  F 
Sbjct: 181 VGTQFAAPLVVFGLVFYTGLGLLSRLVPQLQVFFVGMPVQVMVGMWLFMVTMPLVISLFL 240

Query: 241 HSFLYGF 247
             F  G 
Sbjct: 241 RFFESGL 247


>gi|312879605|ref|ZP_07739405.1| flagellar biosynthetic protein FliR [Aminomonas paucivorans DSM
           12260]
 gi|310782896|gb|EFQ23294.1| flagellar biosynthetic protein FliR [Aminomonas paucivorans DSM
           12260]
          Length = 259

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 91/229 (39%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVEL 77
           R    +   P       P+ VR   AM  ++V+ P +  +     F +  +       E 
Sbjct: 19  RFLGLLFSNPVFLAPAWPLPVRFWTAMLLAVVVTPGVGLSYPGPLFAHWGFLFVAAGREF 78

Query: 78  FLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALW 137
            +G   GL   +    LQ +G    T +GL + T            +  +  ++G+   +
Sbjct: 79  LIGVTLGLFAGLPLYALQMSGFFEGTQMGLGIATFFDPMSETQVALIGQMKYLLGVWFFF 138

Query: 138 VIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFN 197
             + H  +  AL +S   IP+ +    G     +   LQ  F++ L+++ P     ++ +
Sbjct: 139 HWNGHLLLIEALTESLRLIPLAKGTWGGGAAIPWGIWLQKLFVLSLQMALPLFGALLLAD 198

Query: 198 ISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           + +G + + VPQ+ ++ +  P  IGLG   L   + + V  F  +    
Sbjct: 199 VGMGFVARTVPQMNLFVLGIPLKIGLGLFILLAVLPLTVDLFHSTVERA 247


>gi|239817149|ref|YP_002946059.1| flagellar biosynthetic protein FliR [Variovorax paradoxus S110]
 gi|239803726|gb|ACS20793.1| flagellar biosynthetic protein FliR [Variovorax paradoxus S110]
          Length = 264

 Score =  111 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 91/241 (37%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P      +  Q+++  A   ++ + P L     +      
Sbjct: 14  AWLTAFLWPFVRMLALVSTAPVFGEPGVARQIKVAIAALLAVAIAPTLGPMPAVPVVSAG 73

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ ++ +G   G  +R+    +   G  I   +GL+  +        A   +  
Sbjct: 74  GVWI--IVQQVLIGGAIGFTMRMVFAAVLAAGEYIGLQMGLSFASFFDPMAGGATMVVAR 131

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ ++ +L    +D H  +  AL +S+ T+PI         +   V+     F   L L+
Sbjct: 132 LMHMLAILLFLAVDGHLLMLAALAESFHTLPIADAPLAAQGWMLLVSGGGRIFANGLMLA 191

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN+  PQ  I+ +  P  +  G   L L +  +       F   
Sbjct: 192 LPLVTALLTLNLAMGILNRASPQFSIFAVGFPLTLLAGIGMLQLLMPQLGAFLEPRFAAA 251

Query: 247 F 247
            
Sbjct: 252 L 252


>gi|170743255|ref|YP_001771910.1| flagellar biosynthetic protein FliR [Methylobacterium sp. 4-46]
 gi|168197529|gb|ACA19476.1| flagellar biosynthetic protein FliR [Methylobacterium sp. 4-46]
          Length = 252

 Score =  111 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 62/241 (25%), Positives = 128/241 (53%), Gaps = 1/241 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M +    +  +  L   RVG+ +ML+PG+  + +  ++RL FA+  ++VL PF+   +  
Sbjct: 1   MNLLLPGLAAAYLLTFARVGTLVMLMPGIGETVVAPRLRLAFALLVALVLFPFVRPLLPQ 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           Q     A    +++ E+ +G V GL +R     LQ TG++++  +GL    ++  + S  
Sbjct: 61  QAGTGPA-LIGVLIGEIAVGLVLGLSVRAVLAALQTTGTIVAQQLGLAYAMTVDPTTSGQ 119

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L S + ++G+  +   D HH     +  SY  +P       G+  +  +  +   F 
Sbjct: 120 QATLGSFLTMLGITLVLAADLHHLAIAGIRDSYALMPPIGVPATGDAAAFAIRAVARGFA 179

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + +++++PF+ F I+FN+ +G+L++L+PQ+ ++F++TP  I +G   L  S+ +++  F 
Sbjct: 180 LAVQIAAPFIAFGILFNLGLGVLSRLMPQMQVFFVATPASILIGMAVLLASLGVVMGVFV 239

Query: 241 H 241
            
Sbjct: 240 E 240


>gi|308273531|emb|CBX30133.1| hypothetical protein N47_D29420 [uncultured Desulfobacterium sp.]
          Length = 260

 Score =  111 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 106/229 (46%), Gaps = 1/229 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
              I+ RVG  + L+P  +   IP+ V+    +  +++L P       +           
Sbjct: 14  FLFILIRVGVILFLMPFFNSRIIPVPVKAGLTIILAMILFPVSGPYTGV-YPDTTWGMFG 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ EL  G + GL+ + +  G++  G +    IG ++   +        + L+++  ++
Sbjct: 73  LIIGELITGMILGLMTQFFFEGIRMMGQIAGMEIGFSIANVLDPQSGFQTSILSNIAYLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            ++   +++ H+ +  A+ +S+  I  G       +F   ++     F+I +++ +P + 
Sbjct: 133 AIVLFLILNGHYIILNAIRESFAIIQPGSVHLTQQVFKEMLHRSGEMFVIAIQIGAPVIS 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             +   ++ GL+ +L+PQ+ +  ++ P  I  G +F  +S+ ++++   
Sbjct: 193 AILFIQLAFGLITRLLPQMNVMVVAFPLQIVTGLIFFGISLWVMLHFIE 241


>gi|85716546|ref|ZP_01047516.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696547|gb|EAQ34435.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 256

 Score =  111 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 65/234 (27%), Positives = 120/234 (51%), Gaps = 1/234 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  R+G+ +MLLPG    +IP++V+L  A+  ++++LP       +    + A  
Sbjct: 13  AAFMLVFARIGAMVMLLPGFGEGFIPVRVKLAIALLLTLIILPLHRTAYHVDT-QSIAPL 71

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           + L++ E+ +G V G   RV    L   GS+I+  +GL   TS+  +       + + + 
Sbjct: 72  TVLLVHEIIIGVVLGATARVTLAALHVAGSIIAQQLGLGFVTSVDPTQGQQGALMGNFLT 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++G+  L+  D H+ V  AL  SY     G+ +  G++ +         F I L+LS+PF
Sbjct: 132 LLGIALLFATDTHYLVIAALNDSYKIFSPGELMPSGDVAALATRAFAGAFKIGLQLSAPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           L F +VFNI +G+L +L+PQ+ +YF+  P  I +G +     +  ++  +    
Sbjct: 192 LVFGLVFNIGLGVLARLMPQMQVYFVGVPLSILIGFMIFAAVLASMMGTYMDYL 245


>gi|251797426|ref|YP_003012157.1| flagellar biosynthetic protein FliR [Paenibacillus sp. JDR-2]
 gi|247545052|gb|ACT02071.1| flagellar biosynthetic protein FliR [Paenibacillus sp. JDR-2]
          Length = 264

 Score =  111 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 47/245 (19%), Positives = 104/245 (42%), Gaps = 6/245 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
                  LI CR+ S  ++ P  +M  +P   ++      S+++   +   +  Q     
Sbjct: 6   EYFPIFLLIFCRMTSFFVVAPLFNMRGVPSTFKIGLGFFLSLIVF--MTYGLKEQTVPMD 63

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A Y   +  E+ +G + G ++ ++   +Q  G+++   IG  +   +     ++   L +
Sbjct: 64  AEYILYIFREVLIGLLMGYIVYLFMTVVQTAGALMDMQIGFAMSNVIDPMTGVSAPLLGN 123

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF----GNIFSSFVNMLQTTFMIM 182
              ++ ++    ++ HH +   L+ SY  +P+  EL      G+I       +   F++ 
Sbjct: 124 FKYMLLIMVFLAVNGHHYLLTGLMDSYKWMPLSNELFSRIYDGSITDFLSRAVGNAFLLA 183

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++++P +    + ++ +G L K  PQ  ++ I  P  + LG   L L +  I   F   
Sbjct: 184 MQVAAPLVIAMFLTDVGLGFLAKTAPQYNVFVIGIPLKLLLGLGLLILVLPGISAIFERL 243

Query: 243 FLYGF 247
           F   F
Sbjct: 244 FAIMF 248


>gi|83858791|ref|ZP_00952313.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853614|gb|EAP91466.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
          Length = 252

 Score =  111 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 59/238 (24%), Positives = 119/238 (50%), Gaps = 1/238 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + +  ++  R+G  +ML+PG+  + IP+++RL FA+AFS V+ P +  ++        A
Sbjct: 10  TIFAAAMVFARMGGILMLMPGIGETSIPVRLRLAFALAFSFVIGPIVAPSLPAP-PDTLA 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             +  V +E  +G + G   R+        G +I    GL +  S   +   A       
Sbjct: 69  GVAITVGLETLIGVMIGAASRILLTAGAIAGQIIGYQTGLAMAQSFDPAQGQAGVLPAQF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +I ++ + V   H ++  A   SY  +P GQ   +G+     + +    F+I ++++S
Sbjct: 129 LNLIFIVIVLVTPLHQEMLLAAAGSYELMPAGQPPMWGDAAYWALELFIDAFVIGVQIAS 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           P + F +VF + +G+L++L+PQ  I+FI+ P  I +G   + +S+  +V  ++  +  
Sbjct: 189 PLIVFGLVFYLGLGVLSRLMPQAQIFFIAMPLNILIGFSIMAMSLGAMVMLWTDRYER 246


>gi|146282914|ref|YP_001173067.1| flagellar biosynthesis protein FliR [Pseudomonas stutzeri A1501]
 gi|145571119|gb|ABP80225.1| flagellar biosynthetic protein FliR [Pseudomonas stutzeri A1501]
 gi|327481254|gb|AEA84564.1| flagellar biosynthesis protein FliR [Pseudomonas stutzeri DSM 4166]
          Length = 258

 Score =  111 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 110/241 (45%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +    L + R+ + +M +P +    +P++VRL  A+A ++VL+P L     +++    
Sbjct: 11  GWVGQFLLPLFRIAALLMSMPLIGTQLVPVRVRLYLALAIALVLVPTLPPMPVVESLS-- 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L+  +L +G + G +++++      +G +++  +GL   + +  ++ ++   L  
Sbjct: 69  LASLLLIAEQLLIGVMFGFVLQLFFHVFIVSGQLLAMQMGLGFASMVDPANGISVPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++ +L    ++ H  V   L +S+ T+P+G  L   N F      L       L L 
Sbjct: 129 FFNMLVILLFLSVNGHLVVLEILAESFVTLPVGGGL-STNHFWEVAGKLGWVLGAGLLLV 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++ GL+ +  PQ+ I+ I  P  + LG + + + +  I  Q+       
Sbjct: 188 LPAITALLVVNLAFGLMTRAAPQLNIFSIGFPLTLVLGLIIVWIGMADIFAQYQIFVSEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|83747645|ref|ZP_00944681.1| FliR [Ralstonia solanacearum UW551]
 gi|207739726|ref|YP_002258119.1| flagellar biosynthetic protein flir [Ralstonia solanacearum
           IPO1609]
 gi|83725697|gb|EAP72839.1| FliR [Ralstonia solanacearum UW551]
 gi|206593108|emb|CAQ60014.1| flagellar biosynthetic protein flir [Ralstonia solanacearum
           IPO1609]
          Length = 262

 Score =  111 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 96/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  S + IP  +++ F +  ++ L P L     +      
Sbjct: 11  GWIALYWWPLVRVLAFIAMAPPFSNTEIPTSIKVAFGVVLTVALAPMLPVPQGVSVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   G  +++    +   G ++S  IGL   T +    + +   L  
Sbjct: 71  GLWITLL--QVAIGMALGFCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+      G  + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGSAVFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++  +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMVVNLAFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMDA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|148553142|ref|YP_001260724.1| flagellar biosynthetic protein FliR [Sphingomonas wittichii RW1]
 gi|148498332|gb|ABQ66586.1| flagellar biosynthetic protein FliR [Sphingomonas wittichii RW1]
          Length = 260

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 90/242 (37%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  +    + + R G+  +  P      +PMQ+R   A+A  I  L      + +   V 
Sbjct: 10  ETQLWLWMIAMIRPGAAFIAAPVFGAPQVPMQLRAVVALAIGIPALANTPFVMPVGGIVT 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
              +  LV  E+  G   G  +++        G VI  A+GL     M  +       ++
Sbjct: 70  IEGF-LLVAGEILAGLALGFAVQIGFSAALVAGEVIGNAMGLGFAGMMDPATGSPSPAVS 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++          H Q+   +V+SY  +P G+                  F   L +
Sbjct: 129 QYLSLLATFLFLATGGHLQLAAIIVESYRALPPGEAWLGARSIQGLALFGGDLFAAGLAI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  I+  + + +L +  PQ+ I+ +  P  +  G + L ++  ++    + +   
Sbjct: 189 ALPVGFALILVQLVMAMLARSAPQMNIFSVGLPATLMAGLVLLAIAAPVMADGITAAIQR 248

Query: 246 GF 247
           G 
Sbjct: 249 GL 250


>gi|239826630|ref|YP_002949254.1| flagellar biosynthesis protein FliR [Geobacillus sp. WCH70]
 gi|239806923|gb|ACS23988.1| flagellar biosynthetic protein FliR [Geobacillus sp. WCH70]
          Length = 257

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 96/241 (39%), Gaps = 6/241 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +  L+  RV S    LP  S   IP   ++  +   S ++   +              
Sbjct: 8   FPAFLLVFARVASFFATLPLFSYRTIPAVHKIGLSFFLSWMMFFSISK----PAIPLDGM 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LV+ E+ +G   GL   +    +Q  G +I   +G  +   +          +   +
Sbjct: 64  YVLLVVKEVLVGLFIGLFAYMIVSAIQIVGGLIDFQMGFAIANVIDPQTGAQSPLVGQYL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNF--GNIFSSFVNMLQTTFMIMLRLS 186
               LL L  +D HH +   +  SY  IP+    +F  G++    V    T F+I  ++S
Sbjct: 124 YTFALLLLLSVDGHHLLLDGVFYSYRFIPLDHWPHFDHGHVAKYIVKSFSTMFIIAFQMS 183

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +    + ++++G++ + VPQ+ I+ +  P  I    + L +++  +     H F   
Sbjct: 184 VPLVGSLFLVDVALGIVARTVPQLNIFVVGFPVKIAAAFILLIVTMATLFIAVRHLFDMM 243

Query: 247 F 247
           F
Sbjct: 244 F 244


>gi|163758040|ref|ZP_02165128.1| flagellar biosynthesis protein R [Hoeflea phototrophica DFL-43]
 gi|162284329|gb|EDQ34612.1| flagellar biosynthesis protein R [Hoeflea phototrophica DFL-43]
          Length = 251

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 142/247 (57%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M   PE  +++LF   CR+G CIM+LPG S   +P+Q+RL  A+A S+ LLP LW+T+  
Sbjct: 1   MMSDPEGTILALFAAFCRIGGCIMVLPGFSSFRVPVQIRLFIAVAISMALLPMLWETLYP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                   Y  L+  EL +G   GL+ R   L LQF G+ +S AIG N     G+ ++  
Sbjct: 61  NVQTGGGIYIGLIGTELLIGVTFGLIARYIVLALQFAGTGLSMAIGFNAAPGGGLLETEQ 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           E  + SLI    +L L++ DFHH V  AL++SY  +P+G   +      +  + L   FM
Sbjct: 121 EGNITSLITFTAVLLLFLSDFHHMVIEALLRSYDFMPLGSGFDPQMALMTLTDTLAGAFM 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           ++LRL+SPFL + + FN+SIGL+NKL P IP+YFI+ P+++  G L L    +    QF 
Sbjct: 181 LVLRLASPFLVYSMAFNLSIGLINKLAPAIPVYFITIPFILAGGLLLLFFGSQEFFKQFL 240

Query: 241 HSFLYGF 247
             F+  F
Sbjct: 241 DGFVPLF 247


>gi|207728356|ref|YP_002256750.1| flagellar biosynthetic protein flir [Ralstonia solanacearum MolK2]
 gi|206591602|emb|CAQ57214.1| flagellar biosynthetic protein flir [Ralstonia solanacearum MolK2]
          Length = 262

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 96/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  S + IP  +++ F +  ++ L P L     +      
Sbjct: 11  GWIALYWWPLVRVLAFIAMAPPFSNTEIPTSIKVAFGVVLTVALAPMLPVPQGVSVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   G  +++    +   G ++S  IGL   T +    + +   L  
Sbjct: 71  GLWITLL--QVAIGMALGFCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+      G  + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGSAIFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++  +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMVVNLAFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMDA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|327394277|dbj|BAK11699.1| flagellar biosynthetic protein FliR [Pantoea ananatis AJ13355]
          Length = 261

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 104/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ + +   P LS   +  +V++  A   + +L+P L     +   +  
Sbjct: 11  HWVSQFFWPLVRILALLATAPVLSEKAVSKRVKIGLAAMITWILIPNLP---PVNVTLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ ++ +G   G  ++     ++  G +I   +GL+  T    +  L    L  
Sbjct: 68  PAGFMLLIQQMLIGIAIGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPASRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L     + H  +   L  S+ T+PIG E    N F + V      F+  + L+
Sbjct: 128 FLDMLAMLLFLTFNGHLWLISLLSDSFHTLPIGGEPLQANAFMALVKSGSMIFLNGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +GLLN+L PQ+ I+ I  P  + +G L + L + ++     H F   
Sbjct: 188 LPLIVLLLTINMVLGLLNRLSPQLSIFAIGFPITLSVGILTISLLMPLLAPFCEHLFGEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|118588697|ref|ZP_01546105.1| flagellar biosynthesis protein R [Stappia aggregata IAM 12614]
 gi|118438683|gb|EAV45316.1| flagellar biosynthesis protein R [Stappia aggregata IAM 12614]
          Length = 257

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 68/237 (28%), Positives = 113/237 (47%), Gaps = 1/237 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             L+  R+G+ +MLLP L  S IP + RL  A+A ++VL P       ++   N      
Sbjct: 15  FMLMFARLGTMVMLLPALGESTIPTRFRLTIALALTMVLYPVGSQYYPVEVTSNTYRMIA 74

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISD-SLAETPLNSLIGI 130
           L+  E+ +G   GL  ++ T  LQ  G +++   GL        ++         + + I
Sbjct: 75  LLFGEVAIGLGIGLCAKMITSVLQIAGMIMANQSGLAFALGTDFANQGQQGALFGNFLSI 134

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +G+  ++V D H+ V  AL  S+   P G     G+   +    +   F I +R+S+PFL
Sbjct: 135 LGITLVFVSDSHYLVIAALHDSFMIFPPGLAPPVGDFSQNATETVAHVFSIAVRMSAPFL 194

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
              +VF   +GLLNKL+PQ+ I+FI+ P  I +G   L + I  ++  +   F    
Sbjct: 195 VVGLVFYFGLGLLNKLMPQMQIFFIAMPVNIAIGLFMLMVLITTLMMFYLDHFQEAL 251


>gi|52080240|ref|YP_079031.1| flagellar biosynthesis protein FliR [Bacillus licheniformis ATCC
           14580]
 gi|52785617|ref|YP_091446.1| flagellar biosynthesis protein FliR [Bacillus licheniformis ATCC
           14580]
 gi|52003451|gb|AAU23393.1| flagellar protein [Bacillus licheniformis ATCC 14580]
 gi|52348119|gb|AAU40753.1| FliR [Bacillus licheniformis ATCC 14580]
          Length = 258

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 96/241 (39%), Gaps = 6/241 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +  L+  R+ +  + +P  S   IP   ++ FA   ++V    +     L        
Sbjct: 7   FPAFLLVFVRITAFYVTVPLFSYRTIPAVHKIGFAFFLALVSFQAIEKPPHLDV---DGI 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L M E  +G + GL+  +    +Q  GS I   +G  +   +          +   +
Sbjct: 64  YMMLAMKEALIGLLLGLIAYMMISAVQIAGSFIDFQMGFAVANVIDPQTGAQSPLVGQFL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE---LNFGNIFSSFVNMLQTTFMIMLRL 185
             + LL +  ++ HH +   +  SY  IP+ +                   T F+   +L
Sbjct: 124 YTMALLLMLSLNAHHLLLDGIYYSYQYIPVDKMALSFGSEEFAEFIAKSFNTMFITAFQL 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + ++     H F +
Sbjct: 184 SAPVVACLFLVDLALGIVARTVPQLNVFVVGLPLKIAITFIMLIICMAVMFSMMQHVFEF 243

Query: 246 G 246
            
Sbjct: 244 A 244


>gi|6066713|emb|CAB58259.1| HrpC protein [Ralstonia solanacearum]
 gi|1097292|prf||2113360U hrpC gene
          Length = 282

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 80/227 (35%), Gaps = 4/227 (1%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            R+ +   +LP  +   +    R     A +I++       + L   ++      L   E
Sbjct: 30  VRIMTLFSILPATNDQMLTGIARNGVVYALAILVA--AGQPVGLAALLSAGQLFMLTCKE 87

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           +FLG   G          +  G++I    G N             TP+ + +  +G+  L
Sbjct: 88  IFLGACLGFAASTVFWVAETAGTLIDNVSGFNNVQMTNPLRGDQNTPIGNTLVNLGVTLL 147

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFS--SFVNMLQTTFMIMLRLSSPFLFFYI 194
           +       +   + +S+   P+G  L   N  +    +    + F   ++L++P +   +
Sbjct: 148 YAAGGMLFLLGVVFESFKWWPLGAALPDMNAVAQSFLLQQTDSIFSTAVKLAAPVMMTML 207

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           + +  IG + +   ++    +  P    +  L +   +  +  Q   
Sbjct: 208 LIDAGIGFVARAADKLEPTSLGQPIKGAVALLMVMALVTALSTQVKG 254


>gi|107100882|ref|ZP_01364800.1| hypothetical protein PaerPA_01001912 [Pseudomonas aeruginosa PACS2]
 gi|116049393|ref|YP_791804.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892679|ref|YP_002441548.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa LESB58]
 gi|254234547|ref|ZP_04927870.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa C3719]
 gi|254239798|ref|ZP_04933120.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 2192]
 gi|296390185|ref|ZP_06879660.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa PAb1]
 gi|313106447|ref|ZP_07792678.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 39016]
 gi|115584614|gb|ABJ10629.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166478|gb|EAZ51989.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa C3719]
 gi|126193176|gb|EAZ57239.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 2192]
 gi|218772907|emb|CAW28719.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa LESB58]
 gi|310879180|gb|EFQ37774.1| flagellar biosynthetic protein FliR [Pseudomonas aeruginosa 39016]
          Length = 258

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 108/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S  L + RV + +M +P +    +P++VRL  A+   +VL+P L     +     +
Sbjct: 11  GWIASFVLPLFRVAALLMTMPVIGTQLVPVRVRLYLALGVCVVLVPNLPPMPQVDALSMK 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L+  ++ +G + G  +++        G +IS  +GL   + +  ++ ++   L  
Sbjct: 71  AML--LIGEQILVGALLGFSLQLLFHAFVIAGQIISMQMGLGFASMVDPANGVSVPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    ++ H  VF  + +S+ T+P+G+ L  GN F      L       L L+
Sbjct: 129 FFTMLVTLLFLAMNGHLVVFEVIAESFVTLPVGEGL-SGNHFWIIAGKLGWVMGAALLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++ G + +  PQ+ I+ I  P  + LG + L +    ++ Q+       
Sbjct: 188 LPAITALLVVNLAFGAMTRAAPQLNIFSIGFPLTLVLGLVILWIGTADLLSQYQVLAGEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|225375341|ref|ZP_03752562.1| hypothetical protein ROSEINA2194_00966 [Roseburia inulinivorans DSM
           16841]
 gi|225212830|gb|EEG95184.1| hypothetical protein ROSEINA2194_00966 [Roseburia inulinivorans DSM
           16841]
          Length = 259

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 54/236 (22%), Positives = 108/236 (45%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI+ RV   + + P   MS +P QV++  +   ++++  F    +    +     Y+ 
Sbjct: 14  FILILVRVSCFVYIAPFYGMSNVPNQVKIGLSAMIALLVSGF--ADVSQVEYTGLIGYAV 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E   G + GL   V    + F G++I   IGL++ T     ++   T   +L    
Sbjct: 72  IVLKEGITGLLIGLAANVCNSIILFAGNIIDMDIGLSMATEFDPINNAQVTLTGNLYNYF 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            L+ L V D HH +  A V ++  IP+ GQ  ++ ++  S    +   F+I  R+  P  
Sbjct: 132 ILMLLVVTDMHHYILRAFVDAFTVIPVNGQVFDWEHLMRSMTTYMGDMFVIAFRIILPVF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              ++ N  +G++ K+ PQ+ ++ +     I +G + L L++ ++    +  F   
Sbjct: 192 ACIMILNCILGIMAKVSPQMNMFAVGMQMKIMVGFVVLFLTVSLLPSVANFIFTEM 247


>gi|21242685|ref|NP_642267.1| flagellar biosynthetic protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21108158|gb|AAM36803.1| flagellar biosynthetic protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 257

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 89/242 (36%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R G+ +  +P +    +P +VR+  A   ++VL P L    +   F  +
Sbjct: 10  AMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLAGTLAMVLAPILPPVPEWDGFTAQ 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G ++++        G ++S + GL+          +    +  
Sbjct: 70  A--VLSIARELAVGASMGFMLKLMFEAGALAGELVSQSTGLSFAQMSDPMRGVTSGVIAQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              I   L  +  + H  V   LV SY  +PIG  L     F+     +        L L
Sbjct: 128 WFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTALPDAGAFAEVAPTLFLQILRGGLTL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    +  P  + LG   L              F  
Sbjct: 188 ALPMMVAMLAVNLAFGALAKAAPALNPMQLGLPLTVLLGLFLLSSFASEFAPPVQRMFDT 247

Query: 246 GF 247
            F
Sbjct: 248 AF 249


>gi|146277692|ref|YP_001167851.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555933|gb|ABP70546.1| flagellar biosynthetic protein FliR [Rhodobacter sphaeroides ATCC
           17025]
          Length = 266

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + SLF    R+G+ ++  P     ++P+ VR+   +  ++ +L      +     +  
Sbjct: 14  GSLTSLFFATLRIGAFLLASPAFGGRFVPLPVRIMATVVLTLPVLG--RADLPGPEALAS 71

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                ++M E+ +G   GL++ V        G  I+   GL     +  S       +  
Sbjct: 72  LSAVPMMMQEIAIGLSAGLVLTVLFSAAALAGDRIAATAGLGFAAQIDPSAGGQTPVVAQ 131

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           + G+        +D H   F  L++SY ++P G     G    + +      F++ L++ 
Sbjct: 132 IFGLALTTVFLALDGHLSAFEILLRSYESLPPGAPFAPGPFLEAGIGAGGRMFLVGLQIM 191

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ NI+IG++ +  PQ+ ++    P  +    + L L++   +  FS      
Sbjct: 192 MPVVAALVLINITIGVITRSAPQLNVFSFGFPVTMSATLILLFLTVPGTMGAFSSLVADS 251

Query: 247 F 247
            
Sbjct: 252 L 252


>gi|299131772|ref|ZP_07024967.1| flagellar biosynthetic protein FliR [Afipia sp. 1NLS2]
 gi|298591909|gb|EFI52109.1| flagellar biosynthetic protein FliR [Afipia sp. 1NLS2]
          Length = 259

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 119/237 (50%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +  +  L+  R+G+ +MLLPG   + +P+++RL  A+  ++++LP       +      
Sbjct: 10  ALAATFMLVFARIGAMMMLLPGFGEANVPVRLRLGIALMLTLIMLPLHRAAYHVDLSSMT 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    +V  E+ +G V G   R     L   GS+I+  +GL   T++  +       + +
Sbjct: 70  SVMVLMV-HEIIVGVVLGATARFTLAALSVAGSIIAQQVGLGFVTAVDPTQDQQSVIVAN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+G+  ++  D H+ V  AL  SY     G+ +  G++ +         F I ++LS
Sbjct: 129 FLTILGIALIFATDTHYLVLAALSDSYTLFSPGELMPSGDVAALATKAFTVAFKIGVQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +PF+ F +VFN+ +G+L +++PQ+ +YF+  P  I  G L L + +  ++  F   F
Sbjct: 189 APFIIFGLVFNLGLGMLARMMPQMQVYFVGVPLSILAGFLLLGVVLVAVMGTFLTYF 245


>gi|169831896|ref|YP_001717878.1| flagellar biosynthetic protein FliR [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638740|gb|ACA60246.1| flagellar biosynthetic protein FliR [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 253

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/238 (21%), Positives = 99/238 (41%), Gaps = 2/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L+  R+ + I   P  +M  IP  V+   A   S+ LLP            +   
Sbjct: 4   LVTFLLVFTRLAAFIAACPVFAMREIPPTVKAGLAFVLSLALLP--SAGTAAPPLDSFLG 61

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +S  +  E  +G   G+   +   GL   G  I   IG  +   M          ++ L+
Sbjct: 62  FSLALAKEAAVGLGLGIFTSLVFHGLLLAGQYIGFQIGFAIAEMMSPGTEGERAIVSRLM 121

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +  L+    ID HH +   L KS+  +P+G  +                F+I L +++P
Sbjct: 122 WLFALVFFVSIDGHHLLIAGLAKSFELVPLGAAVAQMKTTLFMAKAYGGLFVIALTIAAP 181

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +   +V +  +GL+ ++VPQI ++ +  P+ +  G   L ++I +I +  +  F   
Sbjct: 182 VMAVLLVTDAILGLMVRMVPQINVFMLGFPFKVFAGLFALMVTIPVIGWALTRVFGRM 239


>gi|90418351|ref|ZP_01226263.1| putative flagellar biosynthesis protein FliR [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90338023|gb|EAS51674.1| putative flagellar biosynthesis protein FliR [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 251

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 137/246 (55%), Gaps = 1/246 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-D 59
           M++    ++ SLFLI CR GSC++L+PG S S +P+QVRL  ++A S+ L P L  T+  
Sbjct: 1   MSVELSELVFSLFLIFCRFGSCLLLMPGFSSSRVPLQVRLFLSLAVSVALSPALLPTLQP 60

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           L    +      L++ E+  G   GLL R + + LQF G V++ +IG+ +Q  + I +S 
Sbjct: 61  LVAAADDNGKLALMISEILNGLFIGLLGRSFMIALQFAGHVVANSIGMGMQMGVPIDESD 120

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
               + SLI +     ++V++ H ++  ALV SY  +P     +      +  + L   F
Sbjct: 121 PMPAVASLITLTATTLIFVLNLHAEIARALVASYTAMPAAAGFSIRGSLVNITDNLDEAF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           ++ LR+SSPF+ + +V N +IGL NKL P IPIYFIS P+++  G + L  +I   +  F
Sbjct: 181 LLCLRISSPFVLYGVVVNFAIGLANKLTPTIPIYFISLPFVLAGGLVLLGYTISDFLILF 240

Query: 240 SHSFLY 245
              F  
Sbjct: 241 MQDFER 246


>gi|90415340|ref|ZP_01223274.1| Bacterial export protein, family 1 [marine gamma proteobacterium
           HTCC2207]
 gi|90332663|gb|EAS47833.1| Bacterial export protein, family 1 [marine gamma proteobacterium
           HTCC2207]
          Length = 256

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 107/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +L   + RV + ++  P  S+  + ++VR+  A   ++++ P +   I        A 
Sbjct: 12  FYTLLWPMIRVSAFLLASPFFSLRAVNVRVRVLLAALLTLMIYPLVDWPIIDPY---SAA 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
             + +  ++ +G V G+L+++    L   G  +S+A+GL +   +  +       ++   
Sbjct: 69  GLREIFNQILIGTVMGMLLQIVNASLVIGGQAVSSAMGLGMANMIDPNMG-NVPVISQFF 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            I   L    I  H  V   +++S+ T+P+GQ L    + +  +      F+  L L+ P
Sbjct: 128 IICSTLIFMGIGGHVLVISLILESFKTLPVGQMLAPDMLMAVLLQWSSMIFLGGLLLALP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +   +  NI +G++ +  P + I+ +  P +I +G + L  S+  I Y+    +   F
Sbjct: 188 IMVSLLFVNIGVGVITRAAPALNIFAVGFPAMIMVGMVLLATSMTSIGYRIQWLWRESF 246


>gi|51246525|ref|YP_066409.1| flagellar biosynthetic protein (FliR) [Desulfotalea psychrophila
           LSv54]
 gi|50877562|emb|CAG37402.1| related to flagellar biosynthetic protein (FliR) [Desulfotalea
           psychrophila LSv54]
          Length = 260

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 104/243 (42%), Gaps = 1/243 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           + P        +++ RV   +  +P +S    P Q+++  A + ++VL P +   I ++ 
Sbjct: 5   LIPIEQFQLFLVVLSRVAGFVGAIPVISSVQSPKQIKIALACSVALVLFPIMSPVIHIKE 64

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
               + ++ L++ E+ +G   G   ++    ++F  +VI   +G                
Sbjct: 65  LTMPS-FALLIVAEVLVGTTIGFAAKLIFTSIEFGATVIGYQMGFAAANVFDPQTKGQVA 123

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            ++       +L    ID HH   +    SY  +P GQ    G      + +    F + 
Sbjct: 124 LISQFQNSFAILIFLAIDGHHIFIHTASISYQFLPPGQFNYSGGAVPYLIELTAHMFQMG 183

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++ S+P L   ++  + +G+L+++ PQ+ ++ +S P  IGL    + L++ ++    S  
Sbjct: 184 IQFSAPVLAVLLLSGLILGILSRVFPQLNVFMLSFPINIGLAFTVISLTLGLLAMLLSRE 243

Query: 243 FLY 245
           F  
Sbjct: 244 FDQ 246


>gi|254228443|ref|ZP_04921869.1| flagellar biosynthetic protein FliR [Vibrio sp. Ex25]
 gi|262393600|ref|YP_003285454.1| flagellar biosynthesis protein FliR [Vibrio sp. Ex25]
 gi|269965691|ref|ZP_06179804.1| flagellar biosynthesis protein [Vibrio alginolyticus 40B]
 gi|151939031|gb|EDN57863.1| flagellar biosynthetic protein FliR [Vibrio sp. Ex25]
 gi|262337194|gb|ACY50989.1| flagellar biosynthesis protein FliR [Vibrio sp. Ex25]
 gi|269829759|gb|EEZ83995.1| flagellar biosynthesis protein [Vibrio alginolyticus 40B]
          Length = 260

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL   +A +  ++P +         ++  
Sbjct: 11  WIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAVPQDIELLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQMIIGIAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGSLNAVDFREMAGWLGIMFQTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLLCWYILAGLYSHYEMFWTVG 248


>gi|95929866|ref|ZP_01312607.1| flagellar biosynthetic protein FliR [Desulfuromonas acetoxidans DSM
           684]
 gi|95134162|gb|EAT15820.1| flagellar biosynthetic protein FliR [Desulfuromonas acetoxidans DSM
           684]
          Length = 260

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/243 (17%), Positives = 106/243 (43%), Gaps = 1/243 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           + + P   +    + + RV + +  +P      +P + ++  A+  + ++ P +   +  
Sbjct: 3   LLLFPVDKLQLALICLARVAAILGSMPVFGSGQVPARAKVILALFMTFLIFPGVEPLLPS 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
            +F        L+  E  LG + G + R+    ++F G+++   +G          +   
Sbjct: 63  YSF-EPLPLMLLIANEALLGIMMGFIARLIFTAVEFGGTIVGYQMGFAAANVYDPQNQRQ 121

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
            + ++    +  +L    +D HH    A+V SY  +P G            + +    F+
Sbjct: 122 VSLISQFQNVFAILVFLALDVHHLFIEAMVDSYRQLPPGLLDFSSEAVPFIMELTGHMFV 181

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + +R S+P L   ++  + +G+L ++ PQ+ ++ +S P  IG+  + + L++ ++V   +
Sbjct: 182 LAIRFSAPILAVLLLSGLVLGILARVFPQLNVFLLSFPINIGMAFIIIGLTMNMVVAMLN 241

Query: 241 HSF 243
             F
Sbjct: 242 REF 244


>gi|298528401|ref|ZP_07015805.1| flagellar biosynthetic protein FliR [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298512053|gb|EFI35955.1| flagellar biosynthetic protein FliR [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 262

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 99/239 (41%), Gaps = 1/239 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S +L   RV   + LLP      +P+ ++    +  S+ L P L          + 
Sbjct: 9   ETVFSFWLTFFRVSLVVFLLPFFGGEAMPVPIKAALCIVLSLALWPHLSFDAQY-FPEHP 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A  + ++M EL LG + GL++      +Q  G +I+  +G  +   +     L E+    
Sbjct: 68  AQIAVMIMGELVLGLILGLIVHFLFAAIQTGGDLIAFQMGFKMMNVVDPLTGLQESITTQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + +  +L    I+ H  +   L +S+  IP G       + +  +      F++  +++
Sbjct: 128 FLYMCSMLVFLSINGHLYMLMGLTQSFDLIPPGGLFITPELINQIIYYSSQIFVLAFKIA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           SP +    + N+ +  + +  PQ+ +  +  P  I +G LFL L  ++I    S     
Sbjct: 188 SPIIATVFLVNLGLAFMARTAPQMNVLLLGFPIKIAVGLLFLSLVFQLISLYVSGFISD 246


>gi|300722652|ref|YP_003711942.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629159|emb|CBJ89755.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           nematophila ATCC 19061]
          Length = 260

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 106/246 (43%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           + +   ++   F  + R+ +   + P  S   +P++VR+  A+  + +L+P +       
Sbjct: 6   SETLSRLVSDFFWPLVRLLALFSIAPIFSEKQMPIKVRIGLALVITALLVPSIP---SPH 62

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
             +       +++ ++ +G   GL I++    ++  G ++   +GL+  T    +     
Sbjct: 63  IPIFSIAGIWVLIQQILIGVALGLTIQIAFAVVRHAGEILGLQMGLSFATFFDPTGGPNM 122

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             L+ ++ ++ +L     D H  +   LV ++ TIPI         F          F+ 
Sbjct: 123 PILSRILNMLMMLLFLAFDGHLWLLSILVDTFHTIPIQVTQLNPKGFLLLAQSASMIFVN 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            + L+ P +   ++ N ++G+LN++ PQ+ ++ +  P  + +G   L L I ++      
Sbjct: 183 GMMLAMPMITLLLILNFALGMLNRMTPQLSVFVVGFPLTLTVGIFTLSLLIPMLGPFTER 242

Query: 242 SFLYGF 247
            F   F
Sbjct: 243 LFGEMF 248


>gi|319645981|ref|ZP_08000211.1| flagellar biosynthetic protein fliR [Bacillus sp. BT1B_CT2]
 gi|317391731|gb|EFV72528.1| flagellar biosynthetic protein fliR [Bacillus sp. BT1B_CT2]
          Length = 258

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 96/241 (39%), Gaps = 6/241 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
             +  L+  R+ +  + +P  S   IP   ++ FA   ++V    +     L        
Sbjct: 7   FPAFLLVFVRITAFYVTVPLFSYRTIPAVHKIGFAFFLALVSFQAIEKPPHLDV---DGI 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L M E  +G + GL+  +    +Q  GS I   +G  +   +          +   +
Sbjct: 64  YMMLAMKEALIGLLLGLIAYMMISAVQIAGSFIDFQMGFAVANVIDPQTGAQSPLVGQFL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE---LNFGNIFSSFVNMLQTTFMIMLRL 185
             + LL +  ++ HH +   +  SY  IP+ +                   T F+   +L
Sbjct: 124 YTMALLLMLSLNAHHLLLDGIYYSYQYIPVDKMALSFGSEEFAEFIAKSFNTMFITAFQL 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S+P +    + ++++G++ + VPQ+ ++ +  P  I +  + L + + ++     H F +
Sbjct: 184 STPVVACLFLVDLALGIVARTVPQLNVFVVGLPLKIAITFIMLIICMAVMFSMMQHVFEF 243

Query: 246 G 246
            
Sbjct: 244 A 244


>gi|110632632|ref|YP_672840.1| flagellar biosynthesis protein FliR [Mesorhizobium sp. BNC1]
 gi|110283616|gb|ABG61675.1| flagellar biosynthetic protein FliR [Chelativorans sp. BNC1]
          Length = 248

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 90/240 (37%), Positives = 133/240 (55%), Gaps = 1/240 (0%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
           PE  +++ FL  CRVG+C ML+PGL  + +PMQVRL  A+  S+ LL  LWD I      
Sbjct: 2   PETAILAAFLAFCRVGACFMLMPGLGSARVPMQVRLFVAVGASLALLAHLWDVIAPHASD 61

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNL-QTSMGISDSLAETP 123
                  L+  E+ +G + GL+ R+Y L LQF GS I+   G  +    + I ++  +  
Sbjct: 62  RPDILLLLIGSEILIGSLIGLVARLYVLALQFIGSAIALMTGFGMAAGGVAIEENEPQPA 121

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           + +LI    L+ L+V++FHH +  ALV SY   PI    +     +   + L   F +M+
Sbjct: 122 VAALISFSALMLLFVLNFHHAIIEALVASYRLAPIEALFDPRAALTDIADTLSEAFFVMI 181

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           RL SPF+ + I+ N++ G +NKL PQIPIYFIS P++I  G L L   I   +  F+  F
Sbjct: 182 RLGSPFVAYAILINLAFGFINKLTPQIPIYFISLPFVIAGGLLLLYFGIGTFLSLFADGF 241


>gi|260768791|ref|ZP_05877725.1| flagellar biosynthesis protein FliR [Vibrio furnissii CIP 102972]
 gi|260616821|gb|EEX42006.1| flagellar biosynthesis protein FliR [Vibrio furnissii CIP 102972]
 gi|315180494|gb|ADT87408.1| hypothetical flagellar biosynthetic protein FliR [Vibrio furnissii
           NCTC 11218]
          Length = 258

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 96/239 (40%), Gaps = 3/239 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L+    R     ++ P    S +P+  ++  A+ FS++    + +      F  +
Sbjct: 11  EWLGILWWPFVRFSGFFLVAPVFGDSKVPLMTKVLLALCFSLLCAGMVTNVPSFNPFSLQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L   +   G + GL ++++       G  +S  +GL++      +   +      
Sbjct: 71  AVLFGL--YQFSFGLIFGLAVQMFITIFTLAGQALSMQMGLSMAMMNDPNSGSSVAITGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  +  +L    +D H  V    V S+   P+ Q   F +I    +++    F   L +S
Sbjct: 129 IFSLTAMLLFLSMDGHLIVLDVFVDSFTLWPMNQPYPFESI-KHLISLFSWMFSSALIIS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            P +   ++ N++ G ++++ P + ++ +  P  + LG   L +SI  I   F +    
Sbjct: 188 IPAIITMLLSNVTFGFMSRIAPSLNVFVLGFPMTMFLGLFALLISIYGIGDIFFNLLTE 246


>gi|260222418|emb|CBA31962.1| Flagellar biosynthetic protein fliR [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 255

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 97/237 (40%), Gaps = 2/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +     P LS    PM+ ++  ++  ++ +   L D   +      
Sbjct: 11  QWLSPIIWPFLRVLAVFTSAPVLSSRAFPMRAKIGLSLLVALAIQASLPDAPVISFNDPA 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    +V+ ++ +G   G  +R+    ++  G V+   +GLN       S +   + +  
Sbjct: 71  A--LAVVIQQVVIGLSIGFAVRLVFSSVELAGEVVGFQMGLNFAAFFDPSMNTQSSAVAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
               I  L   V++ H  V  A+ +S+   P+               +    F   L ++
Sbjct: 129 FFAQIASLLFVVMNGHLMVMMAVTQSFVAFPVSPHFLDALAAMQLQKLGAEVFASALWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            P +   +  N+++G+++++ PQ+ I+ I  P  + +G + + +++ ++   F+   
Sbjct: 189 LPMVGILLFTNMALGIISRVSPQMNIFAIGFPITLVVGIVGIAVTLPMLDQPFTALM 245


>gi|305431791|ref|ZP_07400958.1| flagellar biosynthetic protein FliR [Campylobacter coli JV20]
 gi|304444875|gb|EFM37521.1| flagellar biosynthetic protein FliR [Campylobacter coli JV20]
          Length = 255

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 102/239 (42%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + +  L+  R+   I+  P  S + IPM ++  FA+  ++ L P       L+     ++
Sbjct: 12  VATFMLLFARMSGLIVFFPFFSHNSIPMIIKTTFALFLTMYLFPLA----KLEILHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S        + ++
Sbjct: 68  FIIQLLSEIVFGMIAGLMLQIVFAIVMMAGEQIAFTMGFTMASVLDPSSGTNMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +I LL     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 HLIALLFFLAFDGHHLMLLFLSHSLGYINLGGFYPHENLMHYLNMGMLNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ +   GLL K +PQ  +  I  P  I LG + L   + +++  F    L  F
Sbjct: 188 ILGISLLADTIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKDLILEVF 246


>gi|300693347|ref|YP_003749320.1| flir: flagellar biosynthesis inner membrane protein. flir/mope/spar
           family [Ralstonia solanacearum PSI07]
 gi|299075384|emb|CBJ34679.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum PSI07]
          Length = 262

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  + + IP  +++ F +  ++ L P L     +      
Sbjct: 11  GWIALYWWPLVRVLAFIAVAPPFANTEIPSSIKVAFGVVLTVALAPMLPVPPGVSVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   G+ +++    +   G ++S  IGL   T +    + +   L  
Sbjct: 71  GLWITLL--QVAIGMALGVCVQLVFAAISGAGELMSIQIGLGFATLLDPQQTESSMLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+      G  + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGTAVFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++  +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMVVNLAFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMDA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|254418936|ref|ZP_05032660.1| flagellar biosynthetic protein FliR [Brevundimonas sp. BAL3]
 gi|196185113|gb|EDX80089.1| flagellar biosynthetic protein FliR [Brevundimonas sp. BAL3]
          Length = 261

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 58/235 (24%), Positives = 118/235 (50%), Gaps = 1/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + +  LI  R+G+ +ML+PG   +Y+P ++RL  A+  S+ L P + D++          
Sbjct: 10  VWAGGLIFARIGAILMLIPGFGETYVPPRIRLSLALLISLALWPVVRDSLPG-LPETLGG 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            +  V+ E+ +G + G+L+R++   L   G ++S    L+   +     +   + + S +
Sbjct: 69  MAGWVIREVVVGLMIGMLLRMFLTSLMTAGEIVSLQTTLSFAQTANPLQAQPGSTVGSFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            + G+  ++  D HH     +V SY  I   + L  G+     V  L  +F++ ++L++P
Sbjct: 129 LLFGVTLIFATDTHHLFIAGMVGSYSLIAPAKPLIMGDFTEMAVRTLGDSFLLGVQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            L F ++FN++ GL+ +++P   +YF + P  + LG     LS+  +   F   +
Sbjct: 189 VLVFALIFNLASGLIARVMPSFQVYFAAAPLSVILGLSIFALSLGALGTVFIDRY 243


>gi|157371199|ref|YP_001479188.1| flagellar biosynthesis protein FliR [Serratia proteamaculans 568]
 gi|157322963|gb|ABV42060.1| flagellar biosynthetic protein FliR [Serratia proteamaculans 568]
          Length = 260

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 103/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + +   F  + R+ + I   P  S   I  +V++       I++ P L  +      +  
Sbjct: 11  VWLSQYFWPLLRILALISTAPVFSEKQISKKVKIGLGGLIVILIAPGLPVST---VPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L   ++ +G   GL ++     ++  G VI   +GL+  T    S       L  
Sbjct: 68  AAGLWLAAQQILIGVALGLTMQFAFAAIRLAGEVIGMQMGLSFATFFDPSGGPNTPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ ++ +L     + H  +   LV S+ T+PI  E   GN F +        F+  + L+
Sbjct: 128 LLNLLAMLLFLSFNGHLWLISLLVDSFHTLPIQAEPLNGNGFLALTQAGSLIFINGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G + + + + ++     H F   
Sbjct: 188 LPLICLLLTLNMALGLLNRMTPQLSVFVIGFPVTMTIGIMTIGMMMPMLAPFCEHLFGEF 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|331645395|ref|ZP_08346499.1| flagellar biosynthetic protein FliR [Escherichia coli M605]
 gi|331045557|gb|EGI17683.1| flagellar biosynthetic protein FliR [Escherichia coli M605]
          Length = 277

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 100/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S +  +VR+  ++A +I++ P +     + + +   
Sbjct: 29  LALGLWFPFVRIMAFLRYMPVLDNSALTARVRIILSLALAIIITPLIPH--PIPHNLLSL 86

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 87  NSLILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 146

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 147 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 205

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  + +G +     +  +   + H 
Sbjct: 206 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLVGLVCFATLLYNLPDHYLHL 260


>gi|261252334|ref|ZP_05944907.1| flagellar biosynthesis protein FliR [Vibrio orientalis CIP 102891]
 gi|260935725|gb|EEX91714.1| flagellar biosynthesis protein FliR [Vibrio orientalis CIP 102891]
          Length = 260

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 95/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  +VRL   +A +  ++P +    D    ++ A
Sbjct: 11  WIANYFWPYTRIAAMLMVMSVTGARFVSTRVRLYLGLAITFAVMPAIPAVPDTIELLSFA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + ++ +G   G + +         G ++     L   + +  ++      L  L
Sbjct: 71  GFMTL-LEQIIIGVAMGTVTQFMIQTFVILGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  L     D H ++   +V S+ ++PIG        F      L   F + L +S 
Sbjct: 130 FMFLSTLFFLTTDGHLKMIMLVVMSFKSLPIGTGSLTTVDFRELALWLGIMFKVALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   ++ G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLICWYLVAGLYNHYELFWIQG 248


>gi|157692317|ref|YP_001486779.1| flagellar biosynthesis protein FliR [Bacillus pumilus SAFR-032]
 gi|157681075|gb|ABV62219.1| flagellar biosynthesis protein FliR [Bacillus pumilus SAFR-032]
          Length = 259

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/242 (16%), Positives = 99/242 (40%), Gaps = 6/242 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +  +  L+  R+ +  + +P L+   IP   R+ F++  +++    + +   L      
Sbjct: 5   ELFPAFLLVFIRITAFFVTVPLLAHRTIPAVHRVGFSLFLAVISFSTIKEPPALDI---D 61

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             Y  L + E  +G + GL+  +    +Q  GS I   +G  +   +          +  
Sbjct: 62  GLYMMLAVKEAMVGLLLGLIAYIMVSAVQIAGSFIDFQMGFAIANVIDPQTGAQTPLMGQ 121

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIML 183
               + LL +   + HH +   +  S+  I + Q        +            F+I  
Sbjct: 122 FFYTVTLLLMLATNAHHLLLDGIYYSFQYIAVDQYALNFGSESFAYFIAKSFNQMFIIAF 181

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           ++S+P +    + ++++G++ + VPQ+ ++ +  P  +G+  + + + + +I     ++F
Sbjct: 182 QISAPVVASLFLVDLALGIVARTVPQMNVFVVGLPIKMGVSFIMIIICMGVIFGVVQNTF 241

Query: 244 LY 245
             
Sbjct: 242 DT 243


>gi|284041539|ref|YP_003391879.1| flagellar biosynthetic protein FliR [Conexibacter woesei DSM 14684]
 gi|283945760|gb|ADB48504.1| flagellar biosynthetic protein FliR [Conexibacter woesei DSM 14684]
          Length = 266

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/236 (17%), Positives = 101/236 (42%), Gaps = 2/236 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++  FL++ RV    ++ P  +   +P + R   A+AF++ L P       L        
Sbjct: 20  VVGFFLVLARVSPLFLVAPMFNSRQVPARARTIVALAFALGLYPLAVAGQTLP--TEAFA 77

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L++ E+ +G    L + V    +   G+++   +G     S+          L  + 
Sbjct: 78  IVGLIVKEMLVGLAFALCVSVMFAAVDAAGTLLDFMVGFAFGGSLDPITGNQSAVLARVY 137

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ +     I+    +   + +++  +P+    +F +I    V +  T F   L +++P
Sbjct: 138 SLVAVAIFIAINGDAWLIQGMSRTFDIVPLSASPDFASISQGVVAVFTTIFASALAVAAP 197

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
            L   ++ +++ GL++++VPQ+ ++ +  P  + +G + +  S+  +    S    
Sbjct: 198 VLIACVLTDVAFGLVSRVVPQMNVFAVGFPVKVIVGLVVVAASLPFVGGWISDQLQ 253


>gi|260772334|ref|ZP_05881250.1| flagellar biosynthesis protein FliR [Vibrio metschnikovii CIP
           69.14]
 gi|260611473|gb|EEX36676.1| flagellar biosynthesis protein FliR [Vibrio metschnikovii CIP
           69.14]
          Length = 260

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 92/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + +M++      ++  ++RL   +A ++ ++P +    D    ++  
Sbjct: 11  FIAHYFWPFTRISAMLMVMTVTGARFVSPRIRLYLGLAITLAVMPAVPAIADDLQLLSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +    + ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GFLTT-LEQIIIGVAMGMVTQFLIQTFVILGQILGMQASLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H  +   +V S+ ++PIG        +      L   F + L +S 
Sbjct: 130 FMFLATMFFLATDGHLTMIQLVVLSFTSLPIGAGSLTNVDYYELSQWLGIMFKVALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFAFALLVGLLICGYIVSGLFAHYDLFWAEG 248


>gi|269792926|ref|YP_003317830.1| flagellar biosynthetic protein FliR [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100561|gb|ACZ19548.1| flagellar biosynthetic protein FliR [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 259

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/232 (21%), Positives = 104/232 (44%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++    L   RV   +M  P   +   P+ VR+  A+  S++++P +   + +       
Sbjct: 9   VLAVHLLCSIRVLGLLMSSPVFMLPSWPIPVRMWLALMLSLLMVPSVDPQVPMVLLATWT 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             +   + E  +G + GLL  +    LQ +G +  + +GL + T    +       L  +
Sbjct: 69  GMAIFAVREFLVGAMVGLLSGLPLYALQLSGYLEGSQMGLAMATLFDPTQEGNVALLGQV 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             ++G+  L   + H  +  A+ +S+  IP+G+ +        F   +   F++ +R S 
Sbjct: 129 KYLLGIWFLLHWNGHLVLIEAINRSFSLIPLGKGVLDLPPGQPFGRWITDLFLLAIRFSL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           P +   ++ ++ +G + + VPQI ++ +  P  IGLG + L   I  +V  F
Sbjct: 189 PIMGALLLADVGLGFVARTVPQINVFILGIPLKIGLGLILLMAVIPFVVDLF 240


>gi|323705429|ref|ZP_08117004.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535331|gb|EGB25107.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 260

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 104/237 (43%), Gaps = 4/237 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             ++  R+    +L P      +P   ++  A   SI++   +   ID  N      Y +
Sbjct: 14  FLIVFVRMLGIFILTPLFGTKTLPSTFKIGLAFFTSIMIFELVNVKIDANNL---YQYVE 70

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V  E  +G + GL   +    +   G +I   +G ++   +   +      + + + I+
Sbjct: 71  IVFNEFLIGLLIGLSSMISFSAIYLAGQIIDYQLGFSIVNVLAAGEETQVPLIGNFVYIL 130

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIF-SSFVNMLQTTFMIMLRLSSPFL 190
            LL   +ID HH++F  L +SY  IP+G          +    ++   F++  R+S+P +
Sbjct: 131 TLLLFLLIDGHHKLFQLLFQSYSMIPVGTPFLHLESINTVITKIVSDMFVLGFRISAPIV 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
              ++ +I++ ++++ +PQ+ ++ I  P  I +G   L + + + +      F   +
Sbjct: 191 VSTLLTDITLSIISRTIPQLNVFMIGMPIKIFVGIFTLFIMLPMYLAVIDVLFNGMY 247


>gi|261344132|ref|ZP_05971776.1| flagellar biosynthetic protein FliR [Providencia rustigianii DSM
           4541]
 gi|282567724|gb|EFB73259.1| flagellar biosynthetic protein FliR [Providencia rustigianii DSM
           4541]
          Length = 259

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 100/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ +     P  +      + R+  A    +++ P L     +   +  A
Sbjct: 12  WLSQGFYPFIRLLALFGTAPFFNEKQSITKARIALAFFIVLIISPQLP---VVNIPLFSA 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +++ ++ +G   GL +++    ++  G VI   +GL+  T    +       L  +
Sbjct: 69  MGLWVIVQQVVIGTAMGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +I LL     D H  + Y L  S+  IPI       + F  F+    T F+  L L+ 
Sbjct: 129 FNLITLLLFLSFDGHLWLIYILTNSFELIPIQTTPLNRDGFWIFLQFANTIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+  +++ N+++G+LN++ PQ+ ++ +  P  + +G   L L I I+           F
Sbjct: 189 PFITLFLILNLALGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISILPRYTERLIHQAF 248


>gi|170748117|ref|YP_001754377.1| flagellar biosynthesis protein FliR [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654639|gb|ACB23694.1| putative flagellar biosynthetic protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 248

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 120/239 (50%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL-QNFVNR 66
            ++ +F+I CRVG C+++ PGLS + +  ++RL  A+  ++ + P L             
Sbjct: 5   TILGVFVIFCRVGGCLLVAPGLSSARVAPRIRLLVALTVTLAVAPLLLPRFGAGLRDAAP 64

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                 +  E   G   G   R +   L+   S ++T IGL       ++D+ A +   S
Sbjct: 65  VDILWWIGCETLTGLAIGFFGRSFYFALETLASGVATMIGLGGIPGNPVADTEAASLAGS 124

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           LI +   + ++ +D H ++F  L+ SY  IP G       + +  V+     F + LR++
Sbjct: 125 LIVMAATILVFALDLHWELFRGLIASYDRIPPGHPFGSRLMLAGLVDRTGAAFAMALRVT 184

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           SPF+ + ++ N+++GL NKL PQIP++FI+TP+++  G   L      ++ QF   + +
Sbjct: 185 SPFIIYSVIVNLALGLANKLTPQIPVFFIATPFILFGGLAILLFLSNDLLGQFILDYEH 243


>gi|328474452|gb|EGF45257.1| flagellar biosynthesis protein FliR [Vibrio parahaemolyticus 10329]
          Length = 260

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 91/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ S +M++      ++  ++RL   +A +  ++P +         ++  
Sbjct: 11  WIANYFWPYVRISSMLMVMTVTGARFVSPRIRLYLGLAITFAVMPAIPAISQDIQLLSFR 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +   +  ++ +G   G++ +         G ++     L   + +  ++      L  L
Sbjct: 71  GF-MTIAEQMIIGVAMGMVTQFMIQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ T+PIG        F      L   F   L +S 
Sbjct: 130 FMFLTTMFFLATDGHLKMLQLVVFSFKTLPIGSGTLTAVDFRDMAGWLGIMFKTALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     +  +   +   +  G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLICWYILAGLYSHYELYWALG 248


>gi|322378523|ref|ZP_08052971.1| flagellar biosynthesis protein FliR [Helicobacter suis HS1]
 gi|322379824|ref|ZP_08054119.1| flagellar biosynthesis protein FliR [Helicobacter suis HS5]
 gi|321147747|gb|EFX42352.1| flagellar biosynthesis protein FliR [Helicobacter suis HS5]
 gi|321149037|gb|EFX43489.1| flagellar biosynthesis protein FliR [Helicobacter suis HS1]
          Length = 275

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 98/247 (39%), Gaps = 3/247 (1%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    +  +    L+  R+   I L P    + IP+ +R   +   ++V  P L      
Sbjct: 25  LAYMSDQNVEGFLLLFLRLSGVIALFPFFDNNLIPVSIRGALSFFLTLVFYPTLP---HP 81

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
             +     +      E FLG      ++V    + F    IS ++GL + ++        
Sbjct: 82  PLYTTAETFLIACCAEFFLGLCASFFLQVVFHAIAFATDTISFSMGLTMASAYDPISGAQ 141

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  +  ++ ++ +L +     HH +   +  S   IP+G  +   +I  + +  L   FM
Sbjct: 142 KAIVGQVVLLLAILIMLQTSMHHLIILWVQHSLEKIPLGGFVFTSHIAQASMQALGHLFM 201

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +   ++ P L   +  +I  G++ K  PQ  +  I  P  I +  L L L +  I+++F 
Sbjct: 202 VGFSMAFPILAIIMFGDIVFGMIMKTHPQFNLLAIGFPLKIAIALLGLILIMASIMHRFK 261

Query: 241 HSFLYGF 247
              L  F
Sbjct: 262 EQLLQAF 268


>gi|15596645|ref|NP_250139.1| flagellar biosynthesis protein FliR [Pseudomonas aeruginosa PAO1]
 gi|9947399|gb|AAG04837.1|AE004574_8 flagellar biosynthetic protein FliR [Pseudomonas aeruginosa PAO1]
          Length = 258

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 108/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S  L + RV + +M +P +    +P++VRL  A+   +VL+P L     +     +
Sbjct: 11  GWIASFVLPLFRVAALLMTMPVIGTQLVPVRVRLYLALGVCVVLVPNLPSMPQVDALSMK 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L+  ++ +G + G  +++        G +IS  +GL   + +  ++ ++   L  
Sbjct: 71  AML--LIGEQILVGALLGFSLQLLFHAFVIAGQIISMQMGLGFASMVDPANGVSVPVLGQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    ++ H  VF  + +S+ T+P+G+ L  GN F      L       L L+
Sbjct: 129 FFTMLVTLLFLAMNGHLVVFEVIAESFVTLPVGEGL-SGNHFWIIAGKLGWVMGAALLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++ G + +  PQ+ I+ I  P  + LG + L +    ++ Q+       
Sbjct: 188 LPAITALLVVNLAFGAMTRAAPQLNIFSIGFPLTLVLGLVILWIGTADLLSQYQVLAGEA 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|146309438|ref|YP_001189903.1| flagellar biosynthetic protein FliR [Pseudomonas mendocina ymp]
 gi|145577639|gb|ABP87171.1| flagellar biosynthetic protein FliR [Pseudomonas mendocina ymp]
          Length = 264

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 104/237 (43%), Gaps = 4/237 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + + +   CR+ + + + P  +   + ++VR+  A+A ++ L   L D   +     +
Sbjct: 13  TSLQAYWWPFCRILALLSMAPLFNHKAVSVRVRILLALALTVALGAALPDMPPIDPLSLQ 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDS-LAETPLN 125
              + L   ++  G + GL +++        G V+ST +G+++       +   + + + 
Sbjct: 73  GLMTAL--EQIAFGVLLGLTLQLVFTIFMLVGEVVSTQMGMSMARYNDPVNGVSSSSIVY 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L  I+ +L  + ID H      L +S+   P+G  L++     SFV          + +
Sbjct: 131 QLYFILLVLLFFAIDGHLVTVSVLYQSFLFWPVGSGLHY-LGAQSFVQAFAWVLAAAVLV 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P +F   +     GLLN++ P + ++ +  P  I +G L + L++  +   + H 
Sbjct: 190 TLPIVFCLTLVQFCFGLLNRISPAMNLFSLGFPISILMGLLCIYLTLPNLPDSYLHL 246


>gi|296133031|ref|YP_003640278.1| flagellar biosynthetic protein FliR [Thermincola sp. JR]
 gi|296031609|gb|ADG82377.1| flagellar biosynthetic protein FliR [Thermincola potens JR]
          Length = 259

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/236 (17%), Positives = 98/236 (41%), Gaps = 1/236 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             +++ RV   +++ P  S   +P QV+    +  SI++              +   +  
Sbjct: 14  FLVVMARVSGVLLVAPVFSSRNLPAQVKAGLIVLISIIVF-MAKHPQMATVPTSIIPFVL 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ EL +G + G    +    +   G  I   IG  +   +     ++   + +   +I
Sbjct: 73  LLISELVIGLIIGFASYLIFSVIYIAGQEIDMHIGFAMVNVVDPLSGISVPLVGTFKYMI 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L     + ++ +F AL  SY  IP+        I +  + M      + ++L+ P + 
Sbjct: 133 AILVYLTTNSYNYLFAALFHSYDVIPLLGFQPNKAISTYLIGMFGNVLALSVKLAVPIVG 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             +V  +++G++ + VPQ+ ++ +  P  I +G + L L +   ++     F   +
Sbjct: 193 ALLVAEVALGIIARTVPQMNVFLVGIPAKIVIGIILLVLILPFYMFFLDMLFETNY 248


>gi|225181593|ref|ZP_03735034.1| flagellar biosynthetic protein FliR [Dethiobacter alkaliphilus AHT
           1]
 gi|225167701|gb|EEG76511.1| flagellar biosynthetic protein FliR [Dethiobacter alkaliphilus AHT
           1]
          Length = 253

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/235 (20%), Positives = 97/235 (41%), Gaps = 1/235 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           LFLI  R+ + I +LP  +   IP   ++ FA  F+ ++        + +   +  YY  
Sbjct: 9   LFLIFVRLSALIAVLPFFTWRGIPALPKIGFAGVFAYLIF-LASSPQEFEIPEHFYYYVL 67

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            V  E+  G   G L+ +     +  G ++    GL + +          T       + 
Sbjct: 68  AVGSEVLFGLALGFLVLLIFAAARIAGQMVDVQAGLMMASVFDPQFGSQVTLFGQFYYLF 127

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            L+    ++ HH +F A+ +S   +  G  +    +  + +  +   F+I  +L+ P + 
Sbjct: 128 ALVFYLTVNGHHMLFMAIARSIELVTPGGVVFSPQLIPNVMQFIFQMFIIAFQLAVPVVA 187

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             I  ++++GLL+K VPQ+ ++ +  P  +G+    + L    +       F   
Sbjct: 188 VLIFSDLALGLLSKTVPQLHVFMVGMPLKVGVALFIIYLIFPYLAQVLETVFARM 242


>gi|217976248|ref|YP_002360395.1| type III secretion system inner membrane R protein [Methylocella
           silvestris BL2]
 gi|217501624|gb|ACK49033.1| type III secretion system inner membrane R protein [Methylocella
           silvestris BL2]
          Length = 249

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/236 (27%), Positives = 124/236 (52%), Gaps = 1/236 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL-QNFVNRA 67
           +++ F++ CR+G+C+M++PG+S + IP++VRL    A ++ L P L D +    +  +  
Sbjct: 7   VLTAFVLFCRIGACLMIMPGISSARIPVRVRLFVGFAITLGLTPILSDEVGPKISAESPF 66

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
              + ++ E  +G + G L R++   L    + I+ AIGL+   +    D+     + SL
Sbjct: 67  ILVQTILSESLIGGLIGFLGRIFFGALDALANAIAMAIGLSSPLAPPTDDNEPAPAIVSL 126

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  L+  ++ + H +V   L+ SY   P+              N L  +F + LR+SS
Sbjct: 127 ISLGALVLFFLTNLHWEVLRGLLASYSVWPVSGLFEARLGLVEIGNSLARSFALALRVSS 186

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           PF+ + ++ N++IG+ ++  PQIPIYFI+ P +   G   L ++   ++  F   F
Sbjct: 187 PFIVYALIVNLAIGIASRFAPQIPIYFITVPAVAAGGLFLLYITCRSLLELFVAGF 242


>gi|268589972|ref|ZP_06124193.1| flagellar biosynthetic protein FliR [Providencia rettgeri DSM 1131]
 gi|291314689|gb|EFE55142.1| flagellar biosynthetic protein FliR [Providencia rettgeri DSM 1131]
          Length = 259

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/240 (21%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + +   P  +      +VR+  A    +++ P L     +   +  A
Sbjct: 12  WLSQGFYPFIRLLALLGTAPFFNEKQAITKVRVALAFFVVLIVSPQLP---VVNIPLFSA 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +++ ++ +G   GL +++    ++  G VI   +GL+  T    +       L  +
Sbjct: 69  MGLWVIVQQMVIGVAMGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +I LL     D H  + Y +V S+  IPI       + F  FV    T F+  L L+ 
Sbjct: 129 FNVITLLLFLAFDGHLWLIYIVVNSFELIPIQTAPLNRDGFWVFVQFANTIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+  +++ N+++G+LN++ PQ+ ++ +  P  + +G   L L I I+           F
Sbjct: 189 PFITLFLILNLALGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISILPRYTERLVHQAF 248


>gi|34498579|ref|NP_902794.1| flagellar biosynthetic protein FliR [Chromobacterium violaceum ATCC
           12472]
 gi|34104433|gb|AAQ60791.1| flagellar biosynthetic protein FliR [Chromobacterium violaceum ATCC
           12472]
          Length = 252

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 91/241 (37%), Gaps = 9/241 (3%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +        R+    +  P  +   +P + +  FA+  +++        +        
Sbjct: 11  AWVSVFAWPFARIVGLFLAEPVFAYRGVPRRFKAAFALVLTVI--------LAPLLPPLP 62

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    +++ +L +G   G ++R+    ++ TG +I    GL          +     L+ 
Sbjct: 63  AEGIAILVQQLLIGLSMGFVMRIVISAVELTGFIIGAQTGLGFAMFYDPVHAAQVPVLSQ 122

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ +         D HH V  AL  S+  +PIG          +        F   + L+
Sbjct: 123 MLSLFTFFLFLAFDGHHVVLGALAHSFQVLPIG-MPMPAQGIKALTLWGAHLFEWGVWLA 181

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N++IG++ +  PQ  I+    P  I +G   L L++ +++      +  G
Sbjct: 182 MPIIGALLITNLAIGVMTRAAPQFNIFSFGFPLTIMIGFCTLYLTLPMMIPVIERMYQAG 241

Query: 247 F 247
           F
Sbjct: 242 F 242


>gi|163789633|ref|ZP_02184071.1| flagellar biosynthetic protein fliR/B [Carnobacterium sp. AT7]
 gi|159875165|gb|EDP69231.1| flagellar biosynthetic protein fliR/B [Carnobacterium sp. AT7]
          Length = 250

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 101/232 (43%), Gaps = 3/232 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + ++ LI  RV S I++ PG S   +P   ++  +M  ++     +      +       
Sbjct: 5   LQTIILIFIRVTSFIVVSPGFSFKGLPSVAKIALSMGITLAAYSAVPVM---EQEAGTVL 61

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           ++ LV+ E+ LG   G + +++   ++  G+ +   +G ++      S  +  +    + 
Sbjct: 62  FAVLVIKEVLLGIALGFITKLFFTAVEIAGNFVDFQVGFSMGAVYDPSMGINVSYYGKIY 121

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + +   ++ + HH V  +LVKS+ T+PI             + +L   F I   ++ P
Sbjct: 122 YWLSMCVFYLTNLHHVVIKSLVKSFTTVPISNSNLGDFGVEGMMKLLGIIFEIAFNIAVP 181

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
            +   ++  + +GL+++ VPQI +  +  P  I    + + + +  +V    
Sbjct: 182 MMIVALLTEVILGLISRSVPQINVLILGMPLKIVASFVMILVLLPTLVKNIQ 233


>gi|268316330|ref|YP_003290049.1| flagellar biosynthetic protein FliR [Rhodothermus marinus DSM 4252]
 gi|262333864|gb|ACY47661.1| flagellar biosynthetic protein FliR [Rhodothermus marinus DSM 4252]
          Length = 258

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/245 (19%), Positives = 104/245 (42%), Gaps = 2/245 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M +     ++ + L+  R+   ++  P      IP++VR+  A+  +  L   +   +  
Sbjct: 1   MPLLNPEYLLRVLLVFVRISGVLLAAPFFGQLSIPVRVRVLLAVLLAYSLSGLVAGPLP- 59

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
            +      +   V +E   G + G    +    ++  G +I   IGL++       +  A
Sbjct: 60  PHADQALGFIVAVALEALTGLLLGFAAHMIFWAVEMAGDLIGFQIGLHMAQVFNPLEGHA 119

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
             PL  L+ +  L+   ++D HH V  ALV+S+  +P+    N        V  +    +
Sbjct: 120 ANPLGRLLSLAALMIFVLLDGHHVVLRALVESFRVVPLAGA-NLAASQPLLVQWVWDFLV 178

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + LRL++PF+   ++ ++++G+  ++VPQ  ++ I+ P  + +G       +       +
Sbjct: 179 LALRLAAPFMVTILLIDVALGIFARVVPQADLFSIALPLKLLVGLALALFYMRAFFPLMA 238

Query: 241 HSFLY 245
                
Sbjct: 239 TLISN 243


>gi|118474587|ref|YP_892577.1| flagellar biosynthesis protein FliR [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118413813|gb|ABK82233.1| flagellar biosynthetic protein FliR [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 257

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 104/242 (42%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           +  +++ FL++ R G+ ++  P  +   IP+ ++   +  F+I L P     + L+N   
Sbjct: 9   QNNVVTFFLLLVRTGALMVFFPFFNHMQIPVIIKAVLSFMFAIFLFPLAHAPVGLENLSV 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
             Y       EL  G   G+L+ +    LQ  G  IS  +G ++ + +     +    ++
Sbjct: 69  E-YLILETFSELMFGMCAGVLLMLVFGALQLAGGQISMIMGFSMASVIDPQSGVNMPLIS 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++  I LLA  + D HH V   +  S   IP+G      NI       +   F+    +
Sbjct: 128 NMLNFIVLLAFLLFDGHHIVLQFIAYSLQFIPLGGFYPDENIVKYTAKGVINLFLFGFII 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P L   ++ ++  G+L K +PQ  +  +  P  I +  + +   I  +V  F+   + 
Sbjct: 188 SFPILALSLLADLIFGMLMKTMPQFNLLVVGFPIKIAIAFVVIMAIISAMVKLFTSLMMQ 247

Query: 246 GF 247
             
Sbjct: 248 VL 249


>gi|119476305|ref|ZP_01616656.1| Flagellar biosynthesis pathway, component FliR [marine gamma
           proteobacterium HTCC2143]
 gi|119450169|gb|EAW31404.1| Flagellar biosynthesis pathway, component FliR [marine gamma
           proteobacterium HTCC2143]
          Length = 258

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 95/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + S      R+G+  +  P      +P +VR+  A   ++ + P L     +      
Sbjct: 11  GWLGSAMWPFFRIGAFFLAAPIFGTQLVPARVRIVLAFLMTLAIAPNLPPMPVVDAVSVS 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L   ++ +G   G  ++++       G +I+  +GL   + +  ++ +  T L+ 
Sbjct: 71  A--FVLTAQQILIGVAMGFSMQIFLQIFVVGGQIIAMHMGLGFASMVDPANGVTVTVLSQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L    ++ H  +   L  S+ T+P+G                   F   L L+
Sbjct: 129 FHLMLITLLFVSMNGHLAMIEVLAASFYTLPVGFAFISKTALLDLAGHAGWMFTSALLLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+S+G++ +  PQ+ I+ I  P ++ LG   + +++   +  F       
Sbjct: 189 LPAVAALMIVNMSLGVVTRAAPQLNIFSIGFPSMLLLGLCIVWVTMIGYLPLFDRFTREA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|88858096|ref|ZP_01132738.1| flagellar biosynthesis protein [Pseudoalteromonas tunicata D2]
 gi|88819713|gb|EAR29526.1| flagellar biosynthesis protein [Pseudoalteromonas tunicata D2]
          Length = 259

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 96/241 (39%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M    L + R+ + +M++ G+ +  +P +++   A+  ++V++P L         +  
Sbjct: 10  QWMADFLLPLTRISAMLMVMVGIGVRTVPTRIKAALAVMVTLVVIPVLPP--AEFTNLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ +  +G   G    +        G +++   GL   T +  ++      +  
Sbjct: 68  FEMVLVVLQQTLIGVAMGFASVLMLNTFVMAGQLLAMQSGLGFATMIDPTNGQNVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  W  D H  +   LV S+ TIPI         F          F   L LS
Sbjct: 128 FYLILATLLFWTYDGHLIMVKMLVLSFTTIPIDGNWWHVANFREVAVWGGWLFATALVLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              L   ++ +IS G++ +  PQ+ I+ I  P+ + +G + +  ++   V QF   +   
Sbjct: 188 LAPLTAMLITSISFGVMTRAAPQLNIFSIGFPFTLMMGLIIIWATMGNFVVQFDFQWHKM 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|307731354|ref|YP_003908578.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1003]
 gi|307585889|gb|ADN59287.1| flagellar biosynthetic protein FliR [Burkholderia sp. CCGE1003]
          Length = 260

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 108/240 (45%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +      R+ + +   P L    +P++V++  A   +I++ P L     +  F   
Sbjct: 11  AWLTAFLWPFVRILALVATAPVLGNRSLPLRVKIGLAAFVTIIVAPTLGALPQVTVFSAE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +   ++ +  +G   G+ +++    +  TG  +   +GL   T      S +   L+S
Sbjct: 71  GVWI--IVNQFLIGVALGMTMQIVFQAISATGDFVGLGMGLGFATFFNAQASSSSQVLSS 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            +  I +L   VID H Q+  AL+ S+ ++P+   +     + +      T F   L LS
Sbjct: 129 YMYTIAMLVFLVIDGHLQMISALLASFSSLPVSANILGAPGWRTLAGFGSTIFSAGLLLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+++G+LN+  PQI ++ I  P  + +G L L L I  ++  F+  F  G
Sbjct: 189 LPVVAALLITNLALGILNRAAPQIGVFQIGFPLTMLIGLLLLQLMIPNMIPFFARLFTVG 248


>gi|254457578|ref|ZP_05071006.1| flagellar biosynthetic protein FliR [Campylobacterales bacterium GD
           1]
 gi|207086370|gb|EDZ63654.1| flagellar biosynthetic protein FliR [Campylobacterales bacterium GD
           1]
          Length = 255

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/243 (20%), Positives = 103/243 (42%), Gaps = 3/243 (1%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
            +  ++   L+  R  +  M  P  S   IPM ++   A  F+IV    +     LQ  +
Sbjct: 9   SDTYIVGFILLFFRFAALFMAAPIFSHKNIPMTIKTSMAFFFTIVFYSSMP---PLQIDI 65

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           N       ++ EL  G   G+++ +    + F G  IS  +G ++ +++     ++   +
Sbjct: 66  NVPTVVLAILSELLFGLAIGVVLLLAYNVITFAGGQISFMMGFSMASAIDPQTGVSMPII 125

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
           +  + ++GL+ L  ID HH +   +  S   IP+G  L   ++F+  +      F++   
Sbjct: 126 SQFLSLMGLMILLAIDLHHWLLLFIDGSLSAIPLGGFLLTEDLFNYMIKATSNMFIVGFM 185

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           ++ P +    + ++  G+L K +PQ  +  I  P  I +  + L  +    +       L
Sbjct: 186 IAFPIIALSWLADVIFGMLMKTMPQFNLLVIGFPIKIMVAFMVLIATFSATMLILKSQML 245

Query: 245 YGF 247
             F
Sbjct: 246 EAF 248


>gi|56551545|ref|YP_162384.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56543119|gb|AAV89273.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 265

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 96/242 (39%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  +    + + R G+  +  P L  +  P+ VR+  A+A  +  +      +     V+
Sbjct: 10  ENYLWIWLIALLRPGAAFVAAPLLGANAFPVTVRVMLALAVGLPSVMDAHLILPDSGLVS 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV+ E+  G   G  +++       T  +I  A+GL   + +   +      L 
Sbjct: 70  FTGL-FLVVGEIITGIAIGFAVQIGYAAGYCTSELIGNAMGLGFASMIDPVNGSNSNVLT 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            +  I+G       D H  +   +V+SY T+P+G       +F          F I + +
Sbjct: 129 QIFTILGAFFFLAADGHLLLIRIIVESYQTMPVGGPGLNNQLFLKLTQFAGQLFSIGMLI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  I+  + +G L++  P + ++ +  P  + +G L + +S+  I      +   
Sbjct: 189 ALPVTFSIILIQVMMGFLSRTAPALNLFAVGMPMALIIGILLIAISVPAISEGVIDAIRS 248

Query: 246 GF 247
           G 
Sbjct: 249 GL 250


>gi|171057715|ref|YP_001790064.1| flagellar biosynthetic protein FliR [Leptothrix cholodnii SP-6]
 gi|170775160|gb|ACB33299.1| flagellar biosynthetic protein FliR [Leptothrix cholodnii SP-6]
          Length = 253

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 90/241 (37%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  L     R  +     P LSM  +P+++++  A+  ++     L     L      
Sbjct: 11  EWLTPLLWPFLRTLALFSAAPVLSMRIVPVRLKVGLALLVAVSAQASLPPMPSLPLDSPG 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    +   ++ +G   G   RV    ++F G +I   +GLN       +     T    
Sbjct: 71  A--LMMGAQQVVIGVTLGFSARVVFAAVEFAGELIGLQMGLNFAGFFDPATGSQGTATAR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
               IG L   V++ H  +  A+V S+   P+  +                 F + L ++
Sbjct: 129 FFSTIGSLLFVVMNGHLLLVMAVVHSFNAFPVSDQPLSVITTLQPQVWGAEIFRLGLWIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +G+++++  QI I+ +     + +G   + L++ ++      +    
Sbjct: 189 LPIIAMLLFVNLVLGVISRVAQQIQIFSVGFGITVSVGLFGVLLTLPMLQGPLMAALERM 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|333004055|gb|EGK23589.1| flagellar biosynthetic protein FliR [Shigella flexneri K-272]
 gi|333017828|gb|EGK37135.1| flagellar biosynthetic protein FliR [Shigella flexneri K-227]
          Length = 261

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLNLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGSEPLNSNAFLAPTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|302670738|ref|YP_003830698.1| flagellar biosynthetic protein FliR [Butyrivibrio proteoclasticus
           B316]
 gi|302395211|gb|ADL34116.1| flagellar biosynthetic protein FliR [Butyrivibrio proteoclasticus
           B316]
          Length = 261

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 107/239 (44%), Gaps = 3/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    LI  RV S I + P       P  V++ F +  SI+L   +    +  ++     
Sbjct: 11  LEIFLLIFVRVASFIFIAPFFGGRQTPNLVKIGFGLLLSIMLYGAVP--FEAPSYNTIIG 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y+ +V+ E+  G + G  +++  L   F G+++   +GL++      + +   T   SL 
Sbjct: 69  YTVIVLKEVLAGFLIGYAVQLCELISAFAGTIVDMQVGLSMVNIFDPNTNEQVTITGSLY 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +  + L +   +  +  AL  ++  IPI G  +N   + +S +  L+   +I  R+  
Sbjct: 129 SQVLTMMLILTGMYQYILKALADTFYLIPINGAVINADRLLASIMEFLRDYIVIGFRICL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P      + N+ +G+L K+ PQ+ ++ +     I +G L + +++ ++    +  F+  
Sbjct: 189 PIFIITFITNVILGVLAKVSPQMNMFAVGIQIKIIIGLLIMFITVTMLNDASNFVFINM 247


>gi|260752856|ref|YP_003225749.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552219|gb|ACV75165.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 265

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 96/242 (39%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  +    + + R G+  +  P L  +  P+ VR+  A+A  +  +      +     V+
Sbjct: 10  ENYLWIWLIALLRPGAAFVAAPLLGANAFPVTVRVMLALAVGLPSVMHAHLILPDSGLVS 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV+ E+  G   G  +++       T  +I  A+GL   + +   +      L 
Sbjct: 70  FTGL-FLVVGEIITGIAIGFAVQIGYAAGYCTSELIGNAMGLGFASMIDPVNGSNSNVLT 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            +  I+G       D H  +   +V+SY T+P+G       +F          F I + +
Sbjct: 129 QIFTILGAFFFLAADGHLLLIRIIVESYQTMPVGGPGLNNQLFLKLTQFAGQLFSIGMLI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  I+  + +G L++  P + ++ +  P  + +G L + +S+  I      +   
Sbjct: 189 ALPVTFSIILIQVMMGFLSRTAPALNLFAVGMPMALIIGILLIAISVPAISEGVIDAIRS 248

Query: 246 GF 247
           G 
Sbjct: 249 GL 250


>gi|229544410|ref|ZP_04433468.1| flagellar biosynthetic protein FliR [Bacillus coagulans 36D1]
 gi|229324895|gb|EEN90572.1| flagellar biosynthetic protein FliR [Bacillus coagulans 36D1]
          Length = 259

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 100/242 (41%), Gaps = 7/242 (2%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
                L+  RV +  +++P  S   +P + R+      S+++      TI  + F     
Sbjct: 8   FSIFLLVFIRVTTFFIMMPLFSHRSVPARFRIGLGFFLSVLVT----YTIHAKPFTMDGA 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L++ E  +G + G +       +Q  G+ I    G ++   +              +
Sbjct: 64  YFMLMIKEALVGLLLGFVAYFILSAVQLAGTFIDFQAGFSMANVIDPQSGAQTPLTGEYL 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELN---FGNIFSSFVNMLQTTFMIMLRL 185
               LL L  ++ HH +   +  SY  IP+ Q        N+      +L   F++  ++
Sbjct: 124 YTFALLLLLSLNGHHLLLDGIYYSYSFIPLDQAWVHLGSFNLAKYLATLLARVFLVAFQM 183

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S+P +    + +I++G++ + VPQ+ I+ +  P  I +  + L +++  I     H F +
Sbjct: 184 SAPVVAVLFLTDIALGIIARTVPQLNIFVVGFPVKIAVSLIALAVAMGTIYIAVEHLFEW 243

Query: 246 GF 247
            F
Sbjct: 244 MF 245


>gi|152965634|ref|YP_001361418.1| flagellar biosynthetic protein FliR [Kineococcus radiotolerans
           SRS30216]
 gi|151360151|gb|ABS03154.1| flagellar biosynthetic protein FliR [Kineococcus radiotolerans
           SRS30216]
          Length = 274

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 85/227 (37%), Gaps = 3/227 (1%)

Query: 16  VCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV 75
             R  + +ML P  +   +  QV+   ++   + +   L D++              V+ 
Sbjct: 19  SVRSAAFLMLAPPFANKAVNGQVKALLSVGLGLAVAERLRDSVPAVEP---GALITAVVQ 75

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           +  +G V G  + +    +Q  G ++    G  + ++              L        
Sbjct: 76  QAVVGAVMGAFVALVFAAVQAAGDMLDLFGGFQMASAYDPLMQSQTAVFGKLYTWTSTAL 135

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
           L V   H  +    ++SY  +P+   L+ G +   F   +    +  +++++P +    +
Sbjct: 136 LVVSGGHLLILQGFLRSYDVLPLDAGLDTGTVARVFTEGVAQLVISAVQIAAPLIAVLFL 195

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            +I +GLL+++ P + ++ +S P  I +       +  ++       
Sbjct: 196 TDIGLGLLSRVAPALNVFAMSFPVKILITLTLAGFAFSMLPGVVDDM 242


>gi|283784008|ref|YP_003363873.1| flagellar biosynthetic protein [Citrobacter rodentium ICC168]
 gi|282947462|emb|CBG87009.1| flagellar biosynthetic protein [Citrobacter rodentium ICC168]
          Length = 260

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 100/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +++ L+    R+ + I  +P    + + ++VR+  ++A +IV+ P +   +        +
Sbjct: 12  LVLGLWFPFVRIMAFIRYVPVFDNAALTIRVRIILSLALAIVITPMIPHPVPDSLLSMNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L   ++  G + GL+ +   L LQ  G ++S  +G+++          + T L  L
Sbjct: 72  --LILTAEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPGSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  ++  + +D H  +   L K +   PIG  L+  ++  +            + L+ 
Sbjct: 130 INVYAVILFFAMDGHLLLVSVLYKGFTYWPIGNALHPQSL-RTLALAFSWVLGSAMLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + +Y +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRVAPPLNLYSLGFPINMLAGLICFATLLYNLPDHYLHL 243


>gi|310764876|gb|ADP09826.1| Flagellar biosynthetic protein FliR [Erwinia sp. Ejp617]
          Length = 259

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 97/239 (40%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +   FL++ R+ + + + P  S   +  +VR+  A+  + ++   + D+      +    
Sbjct: 14  LGHYFLVMVRIAALLTVAPVFSEKSVNTRVRVGLALLIAALIGGNIPDS---HIALYSFQ 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               V  +L +G   GL +++  + ++  G +I   +GL+  T    S       +   +
Sbjct: 71  GVWAVGKQLLIGAALGLSMQLLFVAVRMAGEIIGMQMGLSFATFFDPSAG-NVPVIARFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L   V + H  +   L +S+  +P+         F   V      F   L L  P
Sbjct: 130 NLLVTLLFLVFNGHLWLIALLAESFHQLPVDAAPLHNGGFFLLVQQAGLVFREGLMLGLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +   +  N ++GLLN+L PQ+ I+ I  P  + +G + L L  + +           F
Sbjct: 190 IISLLLCINFTLGLLNRLTPQLSIFVIGFPLTLTVGMVALSLISQTLAPFIEKLMATVF 248


>gi|259907618|ref|YP_002647974.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae Ep1/96]
 gi|224963240|emb|CAX54724.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae Ep1/96]
 gi|283477460|emb|CAY73376.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae DSM 12163]
          Length = 259

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 96/239 (40%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +   FL++ R+ + + + P  S   +  +VR+  A+  + ++   + D+      +    
Sbjct: 14  LGHYFLVMVRIAALLTVAPVFSEKSVNTRVRVGLALLIAALIGGNIPDS---HIALYSFQ 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               V  +L +G   GL +++  + ++  G +I   +GL+  T    S       +   +
Sbjct: 71  GVWAVGKQLLIGAALGLSMQLLFVAVRMAGEIIGMQMGLSFATFFDPSAG-NVPVIARFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L   V + H  +   L +S+  +P+             V      F   L L  P
Sbjct: 130 NLLVTLLFLVFNGHLWLIALLAESFHQLPVDAAPLHNGGLFLLVQQAGLVFREGLMLGLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +   +  N ++GLLN+L PQ+ I+ I  P  + +G + L L  + +           F
Sbjct: 190 IISLLLCINFTLGLLNRLTPQLSIFVIGFPLTLTVGMVALSLISQTLAPFIEKLMATVF 248


>gi|295111380|emb|CBL28130.1| Flagellar biosynthesis pathway, component FliR [Synergistetes
           bacterium SGP1]
          Length = 264

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 95/229 (41%), Gaps = 1/229 (0%)

Query: 18  RVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-DTIDLQNFVNRAYYSKLVMVE 76
           R    +   P  +    P  VR  FA   +      L    + L  F +    + L + E
Sbjct: 20  RFVGLVFSAPVFTSVMAPTPVRYLFAALLTFSAAGGLGGAEVPLFYFDSVFSIALLGVRE 79

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
           + +G   G L  +  + L+  G  + T IG ++   +  +     + +  L  ++GL   
Sbjct: 80  VLIGVALGFLSALPLVALRVAGEQVGTVIGFSMAQVLDPTTQTESSIIGQLEFLVGLWFY 139

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVF 196
           +  + H  +  A+++S    P+G+ L F          LQ  F++ +R++ PF    ++ 
Sbjct: 140 YHWNGHLLMIQAVMESVRLAPVGRLLPFPPDLIEVGTWLQDLFILAMRITLPFFCSLVLA 199

Query: 197 NISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           ++ +G L + VPQ+ I+ +  P  + LG + L   + + V      F  
Sbjct: 200 DVGLGFLARTVPQMNIFVLGLPIKVALGFMVLAAVLPLTVDLIYTQFER 248


>gi|258622508|ref|ZP_05717530.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM573]
 gi|258585208|gb|EEW09935.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM573]
          Length = 258

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/237 (21%), Positives = 101/237 (42%), Gaps = 3/237 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             I+  L+    RVG+  + +P    + IP+ VR   A+A  ++  P +     +  F  
Sbjct: 9   SAILGQLWWPFFRVGAVFISMPFFGDALIPIWVRSLLALAIVVITAPLIPTMPAVDLFSM 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            + +  L   ++  G + GL++ +        G ++S  +GL +       + ++   L 
Sbjct: 69  TSLF--LAFEQVIWGIIFGLILHMLFTVFAMLGQIVSLQMGLGMAMMNDPVNGISVAVLG 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L  I   L    ++ H  V   L++S+   P+G  +         +N     F   L L
Sbjct: 127 RLFLIFSTLLFLALEGHLLVIDVLIQSFVIWPVGSGI-TSLSLQGVINAFGWMFASSLAL 185

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P +   ++ NIS G++N+  P + IY +  P  + LG   + +S+  I  +++  
Sbjct: 186 ALPAIISMLLANISFGVMNRAAPSLNIYALGFPMTMLLGLFSVLISVSGIPDRYTDL 242


>gi|258624669|ref|ZP_05719604.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM603]
 gi|262173374|ref|ZP_06041051.1| flagellar biosynthesis protein FliR [Vibrio mimicus MB-451]
 gi|258583061|gb|EEW07875.1| flagellar biosynthetic protein FliR [Vibrio mimicus VM603]
 gi|261890732|gb|EEY36719.1| flagellar biosynthesis protein FliR [Vibrio mimicus MB-451]
          Length = 258

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/237 (21%), Positives = 101/237 (42%), Gaps = 3/237 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             I+  L+    RVG+  + +P    + IP+ VR   A+A  ++  P +     +  F  
Sbjct: 9   SAILGQLWWPFFRVGAVFISMPFFGDALIPIWVRSLLALAIVVITAPLIPTMPAVDLFSM 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            + +  L   ++  G + GL++ +        G ++S  +GL +       + ++   L 
Sbjct: 69  TSLF--LAFEQVIWGIIFGLILHMLFTVFAMLGQIVSLQMGLGMAMMNDPVNGISVAVLG 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L  I   L    ++ H  V   L++S+   P+G  +         +N     F   L L
Sbjct: 127 RLFLIFSTLLFLALEGHLLVIDVLIQSFVIWPVGSGI-TSLSLQGVINAFGWMFASSLAL 185

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P +   ++ NIS G++N+  P + IY +  P  + LG   + +S+  I  +++  
Sbjct: 186 ALPAIISMLLANISFGVMNRAAPSLNIYALGFPMTMLLGLFSVLISVSGIPDRYTDL 242


>gi|121602553|ref|YP_989418.1| flagellar biosynthesis protein FliR [Bartonella bacilliformis
           KC583]
 gi|120614730|gb|ABM45331.1| flagellar biosynthetic protein FliR [Bartonella bacilliformis
           KC583]
          Length = 265

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 73/240 (30%), Positives = 133/240 (55%), Gaps = 1/240 (0%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-DL 60
           ++    +++   L+  RVG+C+ML+PG+S   IP+QVRL  A++FS+++LP + D   D 
Sbjct: 15  SVPLNQLVLLAMLVFARVGACLMLMPGVSSIRIPVQVRLFIAVSFSLIILPMVADFFKDF 74

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               + A + + +  E+ +G   G++  VY   LQF  ++I+ ++G + Q    + DS  
Sbjct: 75  GEKPDFALFVRALCSEMLIGVTFGVIAHVYLWALQFMATIIAMSMGYSGQPGHNVIDSTP 134

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           ET +  L+ ++G++  +  D H      L+ SY  +      N       + + L   F+
Sbjct: 135 ETQIAHLLVLVGVMLFFASDLHMFAIRGLLASYDVVSPVFIPNPEAALIDYRDALSKAFL 194

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
             LR+++PF+ + ++ NI++GL+NKL P IP+YFIS P+++  G   L   +  I+  FS
Sbjct: 195 TTLRIAAPFIVYAVLVNIAVGLVNKLTPNIPVYFISLPFVVAGGLFLLYFIMPEILNFFS 254


>gi|254517019|ref|ZP_05129077.1| flagellar biosynthetic protein FliR [gamma proteobacterium NOR5-3]
 gi|219674524|gb|EED30892.1| flagellar biosynthetic protein FliR [gamma proteobacterium NOR5-3]
          Length = 256

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 111/241 (46%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           ++  +      R+ + ++  P  S S I ++VR+  A+  S ++ P L  T  ++     
Sbjct: 10  VLFHTYLWPFLRLSAMLLAAPIFSYSSISVRVRVLLAVLVSALVAPLLPVTPVVEPLS-- 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L + E+ +G V G ++++    +   G  ++ ++GL    ++   + +    ++ 
Sbjct: 68  ALGLVLALREVAIGLVMGFVMQLVFAAVVVAGHSVAMSMGLGFAMAVDPQNGVQVPVVSQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L  ++  L    ID H  +  A+V+S+  IP+G   +   +FS+   +    F   L L+
Sbjct: 128 LNVVLATLLFLAIDGHLMLITAVVESFELIPVGSAFSPEGMFSNVAALGTQLFASALLLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P L   ++ N++ G++ +  PQ+ I+ +  P  I  G +F+ L++ + +         G
Sbjct: 188 LPALTAILMINVAFGVITRAAPQLNIFAVGFPVTIIAGFVFMLLALPMFISTLQRFLSLG 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|315932323|gb|EFV11266.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 255

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 106/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSAIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLILELF 246


>gi|163794130|ref|ZP_02188103.1| flagellar biosynthetic protein FliR [alpha proteobacterium BAL199]
 gi|159180744|gb|EDP65263.1| flagellar biosynthetic protein FliR [alpha proteobacterium BAL199]
          Length = 255

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 68/238 (28%), Positives = 126/238 (52%), Gaps = 1/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +  + L+  R  + ++LLPG+   +IP++VRL FA+A ++ + P +   +      + A 
Sbjct: 11  IFQIMLVFARTSAVLLLLPGIGEVFIPVRVRLLFAVALALAVAPVIAPQLP-PEPTSAAG 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              LV+ E+ +G   GL+ R+  L L   G VIS + GL   T    S S   + +  ++
Sbjct: 70  LLTLVVGEVLIGLYFGLVARILWLTLDTAGRVISFSTGLASATVFNPSLSEQGSAIGLVL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G++ L++ D HH V  A+V+SY     G EL  G+   +   ++  +F + ++LS+P
Sbjct: 130 TLLGIMMLFIADLHHMVIRAVVESYAVFRPGGELMIGDFSEAITELVSGSFKVAVQLSAP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           F  F ++F +++G+L +L+PQ+ I+FI  P  I LG       +  ++  F   +   
Sbjct: 190 FFVFGLLFFVTLGVLARLMPQLQIFFIGLPAQIYLGLFVWVTILGALMSAFLTYYADT 247


>gi|114320140|ref|YP_741823.1| flagellar biosynthetic protein FliR [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226534|gb|ABI56333.1| flagellar biosynthetic protein FliR [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 260

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 93/215 (43%), Gaps = 2/215 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + SL   + RVG+ +M+ P      +P++VR+ F +A ++ +LP + +   +      
Sbjct: 10  AWVGSLMWPLMRVGAMVMVAPVFGNQLMPVRVRVFFGLALAVAVLPAVGEVPPVDPLSAE 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +   ++ +G + G ++ +    +   G  ++ A+GL   T +     ++   L+ 
Sbjct: 70  GLLISV--QQVLIGLIMGFMLLLAVNAVVVAGESMALAMGLGFATMVDPQTGMSVPVLSQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           ++ +I  L    I  H  +      S+  +PI  E      F          F   + ++
Sbjct: 128 VMLVIVTLVFLGIGGHLMLIELTAASFSALPIAAEGVGREAFFEVAAWASQMFAGAVLIA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLI 221
            P +   ++ N+++G++ +  PQ+ ++ +  P  +
Sbjct: 188 LPVVTVLLIINLALGVMTRAAPQMNVFSVGLPITM 222


>gi|27380921|ref|NP_772450.1| flagellar biosynthesis protein FliR [Bradyrhizobium japonicum USDA
           110]
 gi|27354087|dbj|BAC51075.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA 110]
          Length = 256

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 124/238 (52%), Gaps = 1/238 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +  +  L+  RVG+ +MLLPGL  + IP +V+L  A+  ++++LP       +    + 
Sbjct: 10  ALAAAFMLVFARVGAMVMLLPGLGETNIPTRVKLSIALLLTLIILPLHRSAYHVD-MGSL 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L++ E+ +G V G   RV    LQ  GSVI+  +GL   TS+  +       + +
Sbjct: 69  APLLVLMLHEIAIGIVLGATARVTLSALQVAGSVIAQQMGLGFVTSVDPTQGQQGVLVGN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G+  L+  D HH V  AL  SY     G+ ++ G++ S         F + L+LS
Sbjct: 129 FLTMLGVTLLFATDSHHLVIAALNDSYAIFSPGETVSSGDVASLATRAFAAAFRLGLQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
            PFL F +VFNI +G+L +L+PQ+ +YF+  P  I  G L L + +  ++  F   F+
Sbjct: 189 GPFLVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIFAGFLVLAVVLTAMMGTFLDYFI 246


>gi|292489150|ref|YP_003532037.1| flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|292900268|ref|YP_003539637.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291200116|emb|CBJ47242.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291554584|emb|CBA22215.1| Flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|312173308|emb|CBX81563.1| Flagellar biosynthetic protein FliR [Erwinia amylovora ATCC
           BAA-2158]
          Length = 259

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 98/239 (41%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +   FL++ R+ + + + P  S   +  +VR+  A+  +++L   + D+      +    
Sbjct: 14  LGHYFLVMVRIAALLTVAPVFSEKGVNTRVRVGLALLIAVLLGGNIPDS---HIALYSFQ 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               V  +L +G   GL +++  + ++  G ++   +GL+  T    +       +   +
Sbjct: 71  GVWAVGKQLLIGAALGLSMQLLFVAVRMAGEIVGMQMGLSFATFFDPNAG-NVPVIARFL 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  L   V + H  +   L +S+  +P+         F   V      F   L L  P
Sbjct: 130 NLLVTLLFLVFNGHLWLIALLAESFHQLPVDAAPLHNGGFFLLVQQAGLVFREGLMLGLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +   +  N ++GLLN+L PQ+ I+ I  P  + +G + L L  + +           F
Sbjct: 190 IISLLLCINFTLGLLNRLTPQLSIFVIGFPLTLTVGMVALSLISQTLAPFIEKLMATVF 248


>gi|329298605|ref|ZP_08255941.1| flagellar biosynthesis protein FliR [Plautia stali symbiont]
          Length = 262

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 109/241 (45%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ +     P L+   IP +V++  A+  + +L+P L     ++  +  
Sbjct: 11  HWVAQFFWPMVRLLALFASAPLLNERSIPKRVKIGLAVVTTWILMPLLP---PVEVTLFT 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +++ +L +G   GL +++    ++  G +I   +GL+  T +  +  +    L  
Sbjct: 68  PAGFWMLVQQLLIGVGIGLTMQLAFSAMRLVGEMIGLQMGLSFATLLDPNSRINMPLLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L     + H  +   LV S+ T+PI  +    N F +        F+  + L+
Sbjct: 128 FLDMLAMLLFLTFNGHLWLISLLVDSFHTLPINDQPLNANAFMALTKAASLIFLNGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G L L + + ++     H F   
Sbjct: 188 LPLIILLLTLNLALGLLNRVSPQLSVFAIGFPITLTVGILSLGMMMPLLAPFCEHLFGEV 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|300024562|ref|YP_003757173.1| type III secretion system inner membrane R protein [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526383|gb|ADJ24852.1| type III secretion system inner membrane R protein [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 254

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 66/246 (26%), Positives = 123/246 (50%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M+   +  ++   ++ CRVG+C M+LPG S   IP+Q+RL  A+A S+ ++P ++D +  
Sbjct: 1   MSELTQQTLLVPLIVFCRVGACFMVLPGFSSDRIPVQLRLFVAIAISLAIMPIVYDDVRP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ E   G   G ++R++ L L+F    ++   G     S  I  +  
Sbjct: 61  VAAGPAEGLVSIIVTESLAGLFLGFIVRIFFLALEFAAIAMANLAGYGSAFSHAIEGNDP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
            TP +  + +  ++  +V D H  +   L  SY  + +G E       S  V+   + F 
Sbjct: 121 STPYSVFVTLPAVVMFFVADLHIAIIRMLHNSYAALKVGSEFAAPPNLSMIVSTFGSAFK 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + L+LS+  + + ++ N++ G LNK++PQIP YF+STP+++  G + L      I+  FS
Sbjct: 181 LTLQLSAALVVYSVMVNLAFGFLNKMIPQIPSYFVSTPFVVLGGLIILLQIDSGIISIFS 240

Query: 241 HSFLYG 246
              +  
Sbjct: 241 SLVMQA 246


>gi|157363488|ref|YP_001470255.1| flagellar biosynthetic protein FliR [Thermotoga lettingae TMO]
 gi|157314092|gb|ABV33191.1| flagellar biosynthetic protein FliR [Thermotoga lettingae TMO]
          Length = 258

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 54/237 (22%), Positives = 103/237 (43%), Gaps = 3/237 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E   ++  L+V R      + P  +  ++P+QV++   +  S  +LP + + I L   V 
Sbjct: 8   ETKFLAWVLVVTRNAGMFTIAPFFADWFVPLQVKVLLVVFLSWTVLPSINEVIPLHTPV- 66

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A     ++    +G   G L  +  + L   G V  T +G  L +              
Sbjct: 67  -AQIVLSMLSNYVIGLTIGFLALLPVIALSIAGEVFGTQMGFALSSVFDPQR-EEVPIHG 124

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L+ + GL     +  H  ++ A+V S  +IP+ + L   N  S     +   F I +++
Sbjct: 125 ELLYVFGLYIFVALKGHLLIYQAVVDSLNSIPVSKTLIDFNFVSVLTEKISEMFSIAMKI 184

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
             P + F  V +IS+G++++LVPQ+ ++ +  P  I +G + +   I +    FS  
Sbjct: 185 GMPMIGFMFVTSISLGIISRLVPQMNVFMVGMPLKILVGFILMVGMIPVWADVFSQI 241


>gi|30063388|ref|NP_837559.1| flagellar biosynthesis protein FliR [Shigella flexneri 2a str.
           2457T]
 gi|56480008|ref|NP_707835.2| flagellar biosynthesis protein FliR [Shigella flexneri 2a str. 301]
 gi|110805919|ref|YP_689439.1| flagellar biosynthesis protein FliR [Shigella flexneri 5 str. 8401]
 gi|30041640|gb|AAP17368.1| flagellar biosynthetic protein FliR [Shigella flexneri 2a str.
           2457T]
 gi|56383559|gb|AAN43542.2| flagellar biosynthetic protein FliR [Shigella flexneri 2a str. 301]
 gi|110615467|gb|ABF04134.1| flagellar biosynthetic protein FliR [Shigella flexneri 5 str. 8401]
 gi|281601389|gb|ADA74373.1| Flagellar biosynthetic protein FliR [Shigella flexneri 2002017]
 gi|313650172|gb|EFS14585.1| flagellar biosynthetic protein FliR [Shigella flexneri 2a str.
           2457T]
 gi|332756106|gb|EGJ86459.1| flagellar biosynthetic protein FliR [Shigella flexneri 4343-70]
 gi|332757213|gb|EGJ87550.1| flagellar biosynthetic protein FliR [Shigella flexneri 2747-71]
 gi|332766688|gb|EGJ96892.1| flagellar biosynthetic protein FliR [Shigella flexneri 2930-71]
 gi|333003308|gb|EGK22854.1| flagellar biosynthetic protein FliR [Shigella flexneri K-218]
 gi|333017636|gb|EGK36948.1| flagellar biosynthetic protein FliR [Shigella flexneri K-304]
          Length = 261

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGSEPLNSNAFLAPTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|187733359|ref|YP_001879729.1| flagellar biosynthesis protein FliR [Shigella boydii CDC 3083-94]
 gi|187430351|gb|ACD09625.1| flagellar biosynthetic protein FliR [Shigella boydii CDC 3083-94]
          Length = 261

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 105/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  + V+ P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFVIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLPLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|77918768|ref|YP_356583.1| flagellar biosynthetic protein FliR [Pelobacter carbinolicus DSM
           2380]
 gi|77544851|gb|ABA88413.1| flagellar biosynthetic protein FliR [Pelobacter carbinolicus DSM
           2380]
          Length = 258

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 99/241 (41%), Gaps = 1/241 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +     +    +   RV S    LP    +  P+++R+  ++  ++V+ P L + +    
Sbjct: 5   LFSIASIQGFLVCAARVTSLFSALPIFGSAQTPVRIRIALSVTIALVVYPLLPELLPA-T 63

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            +       L+  E  +G + G + R+  + ++F GS+I   +G               +
Sbjct: 64  PLTPIGLGILIAQETMVGLMIGFIARLVFIAVEFGGSIIGYQMGFAAANVFDPQSQHQVS 123

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            ++    +  +L     D HH     +  SY  +P G     G        +    F + 
Sbjct: 124 LISQFQNVFAILLFLAFDVHHLFLRLIADSYRLLPAGDAKLGGEAVLFLSRLTGEMFTLA 183

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++ S+P L   ++  + +G+++++  Q+  + +S P  IG+  L + L+++++       
Sbjct: 184 VKFSAPVLIVLLLSGLVLGIMSRMFQQLNAFMLSFPINIGVSFLSIGLTMQLLAVMLQRE 243

Query: 243 F 243
           F
Sbjct: 244 F 244


>gi|86150314|ref|ZP_01068540.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88596317|ref|ZP_01099554.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562791|ref|YP_002344570.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85839139|gb|EAQ56402.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88191158|gb|EAQ95130.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360497|emb|CAL35294.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|284926403|gb|ADC28755.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315926597|gb|EFV05978.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni DFVF1099]
          Length = 255

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 107/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+G  I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMGGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLILELF 246


>gi|327441038|dbj|BAK17403.1| flagellar biosynthesis pathway, component FliR [Solibacillus
           silvestris StLB046]
          Length = 258

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 101/233 (43%), Gaps = 7/233 (3%)

Query: 17  CRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVE 76
            RV +  + +P  S   IP QVR+  A+A + ++      T +++ F   A+Y  LV+ E
Sbjct: 16  VRVSAFFVSVPLFSYRTIPPQVRIILAVALAWMMY----YTFNIEPFEINAFYLLLVLKE 71

Query: 77  LFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLAL 136
             +G + GL   +    +Q  G  I   +G  +   +          +   +  + LL L
Sbjct: 72  AIIGLMLGLAAMIIVSAVQIAGGFIDFQMGFAMANIIDPQTGAQSPLMGQFLNFLMLLLL 131

Query: 137 WVIDFHHQVFYALVKSYGTIPIGQELNF---GNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
             I+ HH +   +  SY  +P+ Q              + +  + F I  ++S+P +   
Sbjct: 132 LSINGHHLILDGIYYSYQFMPMDQFFPNFGEEGTALFIIKIFVSVFAIAFQMSAPIVATL 191

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +  +++G+  K VPQ+ I+ I  P  I +G L L +++ ++V        + 
Sbjct: 192 FLVTLALGITGKTVPQMNIFVIGFPIKIAVGFLVLIVTMGVLVGVMKELIEFM 244


>gi|39936945|ref|NP_949221.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           CGA009]
 gi|192292773|ref|YP_001993378.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           TIE-1]
 gi|39650802|emb|CAE29325.1| putative flagellar biosynthetic protein FliR [Rhodopseudomonas
           palustris CGA009]
 gi|192286522|gb|ACF02903.1| flagellar biosynthetic protein FliR [Rhodopseudomonas palustris
           TIE-1]
          Length = 255

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 65/237 (27%), Positives = 122/237 (51%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            +  +  L+  R+G+ +ML+P    S IP +V+L  A+  ++++LP       +    + 
Sbjct: 10  ALAATFMLVFARIGAMVMLMPTFGESNIPTRVKLSIALLLTLIMLPLHRSAYQID-MSSL 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ E+ +G V G   RV    LQ  G+VI+  +GL   +++  +       + +
Sbjct: 69  TPLLVLMLQEIAVGIVLGATARVTLSALQVAGAVIAQQLGLGFVSAVDPTQGQQGVVVGN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G+  L+  D H+ V  AL  SY     G+ L+ G++ +         F + L+LS
Sbjct: 129 FLTMLGVTLLFATDMHYLVIQALSDSYKVFAPGELLHTGDVAALATKAFAAAFKLGLQLS 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +PFL F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L + +  ++  F   F
Sbjct: 189 APFLVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIVIGFIVLAVVLTTMMGAFLGYF 245


>gi|251772430|gb|EES52997.1| Flagellar biosynthesis protein FliR [Leptospirillum
           ferrodiazotrophum]
          Length = 269

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 93/232 (40%), Gaps = 1/232 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI+ R    ++ +P  +   +P +V+   A+A S +L P +   ++       A    
Sbjct: 19  FVLILARTSGVLIAMPAFNSRAVPTKVKALVAVALSALLFPVVGGRVNFHETGYDA-LLF 77

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
            ++ E  +G   G    +    +   G +     G  +   +          L +    I
Sbjct: 78  SILTEFVVGVSMGFAAYLVFAAVALAGQLAGVQAGFGIVDVINPLGVAEVPLLGNFQTQI 137

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L     +  + + +AL +SY  + +G     G+ F+   ++      + L L+SPF+ 
Sbjct: 138 AFLIFLATNAQYAMLWALARSYDVVGVGGASFSGSYFAGIAHLFGRMMSLGLVLASPFIV 197

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
             ++ N+ +G L+K++PQ+ +  +  P ++  G +   L +  +      + 
Sbjct: 198 GGVILNLVLGFLSKMMPQMNLISLGLPVMVLGGLVLTILGLPFLGTVLGEAM 249


>gi|197104397|ref|YP_002129774.1| flagellar biosynthesis protein FliR [Phenylobacterium zucineum
           HLK1]
 gi|196477817|gb|ACG77345.1| flagellar biosynthesis protein FliR [Phenylobacterium zucineum
           HLK1]
          Length = 253

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 127/237 (53%), Gaps = 1/237 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + +  L+  R+G+ IML+PGL  ++IP ++RL FA+A +++L P L  T       +   
Sbjct: 10  VFAAGLVFARLGAIIMLIPGLGETFIPARIRLSFALALALMLFPVLGATAP-PIPASAGA 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            +  V+ EL +G + G ++R++ L L   G ++S    L+   +     +     L++ +
Sbjct: 69  LAGEVIRELLIGLMIGAILRIFMLSLATAGEIVSLGTTLSFAQTANPMQAQPTPTLSTFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
           G++G++ +   D HH    ALV+SY   P G+E+  G+     +      F + L+L++P
Sbjct: 129 GMLGIVLILTTDLHHMFLAALVRSYAIFPFGREVPVGDAGQLAIQTTSRAFALGLQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +   ++ N+++GL+ +++P   ++FI++P L+ LG     +S+ +I   +   +  
Sbjct: 189 VVVLSLIVNVAVGLVGRVMPTFQVFFIASPLLVLLGLSVFAVSLGVIGMVWVDRYRE 245


>gi|300717243|ref|YP_003742046.1| flagellar biosynthesis protein [Erwinia billingiae Eb661]
 gi|299063079|emb|CAX60199.1| Flagellar biosynthesis protein [Erwinia billingiae Eb661]
          Length = 261

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 109/240 (45%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +  LF  + RV + IM  P LS   I  +V++   +  + VLLP L  T      +   
Sbjct: 12  WISQLFWPLARVLALIMTAPLLSEKSISKKVKIGLGVMITYVLLPSLPPT---NVTLFSV 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   G  ++     ++  G VI   +GL+  T    +  L    L   
Sbjct: 69  GGFWLLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPASRLNMPVLARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   +  S+ T+PIG +   GN F +        F+  LRL+ 
Sbjct: 129 LDMLAMLLFLSFNGHLWLISMVADSFHTLPIGGDPINGNAFLALTKAASLIFLNGLRLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRVAPQLSVFAIGFPVTLSIGIIFISLMMPLLAPFCEHLFSEVF 248


>gi|224372500|ref|YP_002606872.1| flagellar biosynthesis protein FliR [Nautilia profundicola AmH]
 gi|223589960|gb|ACM93696.1| flagellar biosynthetic protein FliR [Nautilia profundicola AmH]
          Length = 255

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 107/239 (44%), Gaps = 3/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L+  R+ S +  +P  + + IPM V+  FA   SI+L P    T      +N A 
Sbjct: 12  VVTYLLLFVRISSFLAFMPFFNYTAIPMNVKAAFAFWLSILLFPI---TPKFAYEINIAT 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               V+ E+      G+ +++    L++ G  IS  +G  L   M  +  +  T ++   
Sbjct: 69  VLLSVLNEVAFAFFVGMALQMVFDVLKYAGEQISFVMGFTLANVMDPNAGVQTTIISQFF 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + ++        H     L K++  +P G+  ++ N++  F+  +   F++ + ++ P
Sbjct: 129 TWVAVMMFLSFGGDHLEIMFLDKTFAMLPFGEFFSYHNVYEYFITYMSKYFLLGIAMAFP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            +   ++ +I  G++ K +PQ  +  +  P  I +  + L   I  ++  FS+  L  F
Sbjct: 189 IIAISLMGDIIFGMIMKTMPQFNLLVVGFPIKITISFMVLIAIIASLMQLFSNEILQVF 247


>gi|315127307|ref|YP_004069310.1| flagellar biosynthesis protein FliR [Pseudoalteromonas sp. SM9913]
 gi|315015821|gb|ADT69159.1| flagellar biosynthesis protein FliR [Pseudoalteromonas sp. SM9913]
          Length = 259

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 100/240 (41%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +    L + R+ S IM++ G+    +P ++++  A+  + +++P L        F   
Sbjct: 10  QWLSDFLLPLVRISSMIMIMAGIGAKNVPARIKMGLAVVVTFLVVPVLPAATFTNLFS-- 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ ++ +G   G    +        G +++   GL   + +  S+ ++   +  
Sbjct: 68  FEMILVVLQQMLIGVAIGFASTLLLNTFVLAGQILAMQTGLGFASVVDPSNGMSVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  +V + H  +   +V S+  +PI       + +   V      F   L LS
Sbjct: 128 FYLILATLLFFVFNGHLMMIQMVVHSFEVLPIDGNWWAVDHYWDIVTWGGWMFTTALVLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              L   +V N++ G++ +  PQ+ I+ I  P+ +  G + +  ++   V QF   +L  
Sbjct: 188 LAPLTAMLVINMAFGIMTRAAPQLNIFSIGFPFTLVAGLVIIWATLGNFVTQFEFQWLKM 247


>gi|260776471|ref|ZP_05885366.1| flagellar biosynthesis protein FliR [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607694|gb|EEX33959.1| flagellar biosynthesis protein FliR [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 260

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 94/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  +VRL   +A +  ++P +    D    ++  
Sbjct: 11  WIANYFWPYTRIAAMLMVMSVTGARFVSTRVRLYLGLAITFAVMPVIPAVPDTIELLSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + ++ +G   G + +         G ++     L   + +  ++      L  L
Sbjct: 71  GFMTL-LEQIIIGVAMGTITQFMIQTFVILGQILGMQASLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  +     D H ++   +V S+ ++PIG        F      L   F + L +S 
Sbjct: 130 FMFLATMFFLATDGHLKMIMLVVMSFKSLPIGSGSLNSVDFRELALWLGIMFKVALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     I  +   +   +L G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALIVGLLLCWYIIAGLFSHYELFWLQG 248


>gi|86152607|ref|ZP_01070812.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|121612403|ref|YP_001000854.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157415443|ref|YP_001482699.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|283956577|ref|ZP_06374056.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|85843492|gb|EAQ60702.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87249142|gb|EAQ72103.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|157386407|gb|ABV52722.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|283791826|gb|EFC30616.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|307748085|gb|ADN91355.1| Flagellar biosynthetic protein fliR [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 255

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 106/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLILELF 246


>gi|103488401|ref|YP_617962.1| flagellar biosynthetic protein FliR [Sphingopyxis alaskensis
           RB2256]
 gi|98978478|gb|ABF54629.1| flagellar biosynthetic protein FliR [Sphingopyxis alaskensis
           RB2256]
          Length = 259

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/242 (16%), Positives = 93/242 (38%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E ++    L + R G+  +  P    + +P+Q+RL  A+A  +  +      +  +  V+
Sbjct: 10  EAMLQLWMLGMIRPGAAFIAAPVFGAANVPVQLRLVIALAVGVPAVAASGMVLPAEGIVS 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 +V  E+ +G   G ++++        G VIS A+GL   + +      + + + 
Sbjct: 70  VPGIFFIV-GEVVIGLAIGFVLQMGLAAALLAGEVISNAMGLGFASMVDPLSGASSSAIG 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++        D H  +   +V SY  +P G      +     +      F   L +
Sbjct: 129 QFLAMLATALFLAADGHLLLIDIVVDSYTALPPGNAFPSWDALGGVIRFGSLMFAAALTI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  I+  I +G++ +  P + ++ +  P  +  G + L ++   +          
Sbjct: 189 ALPVGFVLILVQIIMGVIGRSAPALNLFAVGIPATLLAGIVLLGVATPAMAEAIIRILSD 248

Query: 246 GF 247
             
Sbjct: 249 AL 250


>gi|114570481|ref|YP_757161.1| flagellar biosynthetic protein FliR [Maricaulis maris MCS10]
 gi|114340943|gb|ABI66223.1| flagellar biosynthetic protein FliR [Maricaulis maris MCS10]
          Length = 250

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 58/245 (23%), Positives = 116/245 (47%), Gaps = 1/245 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M      ++ +  L+  R+G+ +MLLPG     IP++ RL FA+ F ++L P +  ++ +
Sbjct: 1   MIPELPALVYAAGLVFARLGAILMLLPGFGEPSIPVRFRLAFALLFCLILGPIIAPSLPV 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                 A  + +VM EL +G + G + R++       G VI    GL +  S   S    
Sbjct: 61  MPEQPLA-MAGIVMSELIIGLMIGAVARIFMSTAAVAGQVIGMQSGLAMAQSFDPSQGAQ 119

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
              +++ + +  L+ L   + HH +      SY     G   +  +     ++     F 
Sbjct: 120 GALISTFLNLTFLMLLLATNTHHMLLQMAANSYQVFDPGSMPSLTDAADWALSAFIDAFR 179

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I ++L+SP + + ++F +++G+L++L+PQ  I+FI+ P  I +G   L +++  +   + 
Sbjct: 180 IGVQLASPLIMYGLLFYLALGVLSRLMPQAQIFFIAMPSNIMIGLFILAIALGAMSAVWL 239

Query: 241 HSFLY 245
                
Sbjct: 240 ERMQR 244


>gi|85859182|ref|YP_461384.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
 gi|85722273|gb|ABC77216.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
          Length = 259

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 111/244 (45%), Gaps = 2/244 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSM-SYIPMQVRLCFAMAFSIVLLPFLWDTID 59
           + +     +  L  I  RV S I+++P       IP+ ++   ++  + +L PF+     
Sbjct: 3   LPVITPEQIACLIFIFLRVSSMIVVMPIFGGDKTIPVGIKGGLSLLITFLLFPFVRMDFG 62

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
            Q  +       +++ E+ +G + G + R    G+QF G +I   +G ++   +    S 
Sbjct: 63  FQ-LMELTPMVVIMIGEILIGVIIGFVARFIFAGIQFAGELIGFQMGFSVVNIIDPVTST 121

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
             + ++ L   + +L    ++ HH    A+ +S+  I   Q      + +    +    F
Sbjct: 122 QVSLISQLKYFLAMLVFLAVNAHHIFLSAMAESFVRISPMQFHLTERVIAPLCLLSMEVF 181

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           +I +++S+P +   I  ++++G++ + VPQI I+ +  P  I LG +FL LS  I V   
Sbjct: 182 IIAVKISAPVVAVLIFTHVALGVVARTVPQINIFIVGFPLQIALGLIFLGLSAPIFVNYC 241

Query: 240 SHSF 243
              F
Sbjct: 242 IRLF 245


>gi|205356203|ref|ZP_03222969.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|205345808|gb|EDZ32445.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
          Length = 255

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 106/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFAMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLILELF 246


>gi|115523201|ref|YP_780112.1| flagellar biosynthesis protein FliR [Rhodopseudomonas palustris
           BisA53]
 gi|115517148|gb|ABJ05132.1| type III secretion system inner membrane R protein
           [Rhodopseudomonas palustris BisA53]
          Length = 248

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 86/244 (35%), Positives = 134/244 (54%), Gaps = 3/244 (1%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-D 59
           M  +    ++++FLI CRVG+C+M+ PG S S IPMQVRL  A+  +++L P L  T+  
Sbjct: 1   MIDATSTSVLAVFLIFCRVGTCMMVAPGYSRSNIPMQVRLFLAINVTLMLSPLLVATVRP 60

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           L           ++  EL +G V GL  RV+   L+   ++I++AIGLNL  +    D+ 
Sbjct: 61  LVEGAAAPAIIAIIWSELVVGLVIGLTARVFFAALETMATMIASAIGLNLAGTT--EDTE 118

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
               L  LI +   +  ++ D H ++   L+ SY        ++  N  +  V  L   F
Sbjct: 119 HVPALVPLITLTATVLFFITDQHWELLRGLISSYRVWVPAVGISGENGLAQLVEHLSQAF 178

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            + LR++SPF+ + I+ N++IGL NKL P IP+YFIS P+++  G L L L+    V QF
Sbjct: 179 TLALRIASPFVVYSIIVNLAIGLANKLTPSIPVYFISLPFVLFGGLLLLYLTSREAVLQF 238

Query: 240 SHSF 243
           S +F
Sbjct: 239 SIAF 242


>gi|86150984|ref|ZP_01069200.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124645|ref|YP_004066649.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85842154|gb|EAQ59400.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018367|gb|ADT66460.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 255

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 106/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +    + ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIVLGFVVLIAILLVMMQYFKNLILELF 246


>gi|326796453|ref|YP_004314273.1| flagellar biosynthetic protein FliR [Marinomonas mediterranea
           MMB-1]
 gi|326547217|gb|ADZ92437.1| flagellar biosynthetic protein FliR [Marinomonas mediterranea
           MMB-1]
          Length = 260

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/236 (22%), Positives = 95/236 (40%), Gaps = 4/236 (1%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +S  L   RVG+ +M LP      + +QVR+ FA   SI + P +         V    +
Sbjct: 14  ISFLLPFFRVGAFLMALPLFGSRLVSVQVRILFAFVISIAITPIVDIPSFDPISVA---F 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             L+  +L  G V G +I +        G + +   GL    S   ++ +    +     
Sbjct: 71  IPLIAEQLLAGFVMGFVITILFQAFSLAGQLAAMKAGLGFAMSNDPANGVTVATMGQYFL 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            +  LA    + HH +F  +V+S+   PIG       ++   V +    F   L +  P 
Sbjct: 131 SMVGLAFVGTNGHHVMFEFIVESFDYWPIGSGFALERLWD-VVQLGGWMFEKALLIVLPL 189

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
               ++ N+S G++ K  PQ+ I+ +  P ++    LF  + +   +  +   F  
Sbjct: 190 TVAVLIMNVSFGVVAKASPQLNIFALGFPVILLFSLLFFWMMLGDFLDIYRLFFED 245


>gi|332533114|ref|ZP_08408983.1| flagellar biosynthetic protein FliR [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037396|gb|EGI73850.1| flagellar biosynthetic protein FliR [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 259

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +    L + R+ S IM++ GL    +P ++++  ++  + +++P L        F   
Sbjct: 10  QWLSDFLLPLVRISSMIMIMAGLGAKNVPTRIKMGLSVVVTFLVVPVLPPATFTNLFS-- 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ ++ +G   G    +        G +++   GL   + +  S+  +   +  
Sbjct: 68  FEMILVVIQQMLIGVAIGFASILLLNTFVLAGQILAMQTGLGFASVIDPSNGASVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  +  + H  +   +V S+  +PI       + +   V      F   L LS
Sbjct: 128 FFLILATLLFFAFNGHLMMIQMVVHSFQVLPIDGTWWSVDHYWDIVTWGGWMFTTALVLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              L   +V NIS G++ +  PQ+ I+ I  P+ +  G   +  ++     QF   +L  
Sbjct: 188 LAPLTAMLVINISFGIMTRAAPQLNIFAIGFPFTLVAGLTIIWATLGNFTLQFEFQWLKM 247


>gi|254255043|ref|ZP_04948360.1| Flagellar biosynthesis pathway component FliR [Burkholderia dolosa
           AUO158]
 gi|124899688|gb|EAY71531.1| Flagellar biosynthesis pathway component FliR [Burkholderia dolosa
           AUO158]
          Length = 287

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 97/238 (40%), Gaps = 2/238 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            ++    CR+ + +   P L  + IPM+ R   A+  +  + P +     +      A  
Sbjct: 37  AAIIWPFCRIAAALAAAPILGDAMIPMRARALAALVLAFTVQPGIPAGPSIDPLSLAA-- 94

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             ++  ++ +G + G    +    L   GS++S+ IGL++       +      L++++ 
Sbjct: 95  VAVIGEQVAIGGLLGFAFHLVLSALLAFGSIVSSQIGLSMAQMNDPMNGQPSDVLSNVMY 154

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++ +L  + +D H  +   L +S+   PIG      +    F   +   F     L+ P 
Sbjct: 155 VLFILLFFAVDGHLLMTQVLARSFDVWPIGGSAFDFSALRRFALAVGWMFSAAAALALPV 214

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            F  +V  + +GLLN+  P + ++ +        G L + L +  +   +    ++  
Sbjct: 215 TFATLVVQVGLGLLNRAAPTLNLFSLGFSVTTMFGLLLVVLLLPSLPDHYHRMVIHVL 272


>gi|57238051|ref|YP_179300.1| flagellar biosynthesis protein FliR [Campylobacter jejuni RM1221]
 gi|148926184|ref|ZP_01809869.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|57166855|gb|AAW35634.1| flagellar biosynthetic protein FliR [Campylobacter jejuni RM1221]
 gi|145845355|gb|EDK22448.1| flagellar biosynthetic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|315058611|gb|ADT72940.1| Flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 255

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 105/239 (43%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +      ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITAQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLILELF 246


>gi|323491457|ref|ZP_08096641.1| flagellar biosynthesis protein FliR [Vibrio brasiliensis LMG 20546]
 gi|323314326|gb|EGA67406.1| flagellar biosynthesis protein FliR [Vibrio brasiliensis LMG 20546]
          Length = 260

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 95/239 (39%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  +VRL   +A +  ++P L    D    V+ A
Sbjct: 11  WIANYFWPYTRIAAMLMVMSVTGARFVFTRVRLYLGLAITFAVMPALPAVPDTIELVSFA 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +  L + ++ +G   G + +         G ++     L   + +  ++      L  L
Sbjct: 71  GFMTL-LEQIIIGVAMGTVTQFMIQTFVILGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              +  L     D H ++   +V S+ +IPIG        F      L   F + L +S 
Sbjct: 130 FMFLATLFFLATDGHLKMIMLVVMSFKSIPIGTGSLTTVDFRELALWLGIMFKVALSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     I  +   +   +L G
Sbjct: 190 SGIIALLTINLSFGVMTRAAPQLNIFSLGFAFALMVGLLICWYIIAGLYNHYEIFWLQG 248


>gi|254470011|ref|ZP_05083415.1| flagellar biosynthetic protein FliR [Pseudovibrio sp. JE062]
 gi|211960322|gb|EEA95518.1| flagellar biosynthetic protein FliR [Pseudovibrio sp. JE062]
          Length = 257

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 120/242 (49%), Gaps = 1/242 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           +I++S  L+  R+G+ IML+P    ++IP++VRL  A+  + V LP   +        + 
Sbjct: 10  VIVVSFLLMFARIGTMIMLVPAFGETFIPVRVRLTIALLLTYVFLPINSNLYPDDVMSSL 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGIS-DSLAETPLN 125
                L+  EL +G   GL +++ +  L   G++++   GL        +        + 
Sbjct: 70  PKLLALLGGELMVGFFIGLSMKLISYALSVAGTIMANQSGLAFAMGGDATNSGQQGALMG 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           + + ++G+  ++V + H+ +  A+  S+   P G  L  G++ +  V  +   F + +RL
Sbjct: 130 NFLNVLGICMVFVTNLHYVMIAAMQDSFVLFPPGNPLPVGDLSTLAVETVTHMFSVAVRL 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +PF+   IVF  S+GLLNKL+PQ+ I+FI+ P  I +G     L +  ++  +   F  
Sbjct: 190 GAPFIVVGIVFYFSLGLLNKLMPQMQIFFIAMPVNIMIGFGIFLLLLSTLMGYYLSEFRE 249

Query: 246 GF 247
             
Sbjct: 250 AL 251


>gi|240145486|ref|ZP_04744087.1| flagellar biosynthetic protein FliR [Roseburia intestinalis L1-82]
 gi|257202301|gb|EEV00586.1| flagellar biosynthetic protein FliR [Roseburia intestinalis L1-82]
          Length = 259

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 105/236 (44%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           L LI+ R+   + + P       P Q ++ F+   ++++  F+  T     +     Y+ 
Sbjct: 14  LILILVRISCFVYIAPFFGTKNAPSQAKIGFSFFVALLVYGFVDKT--AIEYTGLIGYAI 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E   G + G    +    + F G++I   IGL++ T    + +   T   +L    
Sbjct: 72  IVLKEGITGLLIGFAANICNSIILFAGNIIDMDIGLSMVTEFDPTMNTQVTITGNLYNYF 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            LL L   D HH +  A+V S+  IPI GQ  N+ ++  S    +   F+I  R+  P  
Sbjct: 132 ILLLLIATDMHHVILQAVVDSFTVIPINGQFFNWDSLAGSITQYMTDLFVIGFRIFLPIF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              ++ N  +G+L K+ PQ+ ++ +     I +G   L L+I ++    S  F   
Sbjct: 192 ACMMILNCILGILAKVAPQMNMFAVGMQMKILVGFGVLFLTISLLPGIASFIFTEM 247


>gi|153951433|ref|YP_001397725.1| flagellar biosynthesis protein FliR [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152938879|gb|ABS43620.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 255

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 105/239 (43%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  S   +      ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPSSGTSMPITAQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNIGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLIAILLVMMQYFKNLILELF 246


>gi|119469998|ref|ZP_01612803.1| flagellar biosynthesis protein R [Alteromonadales bacterium TW-7]
 gi|119446708|gb|EAW27981.1| flagellar biosynthesis protein R [Alteromonadales bacterium TW-7]
          Length = 259

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 96/240 (40%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +    L + R+ S IM++ GL    +P +++L  ++   + LL            +  
Sbjct: 10  QWLSDFLLPLVRISSMIMIMAGLGAKNVPTRIKLGLSVV--VTLLVVPVLPPATFTNLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                +V+ ++ +G   G    +        G +++   GL   + +  S+  +   +  
Sbjct: 68  FEMILVVIQQMLIGIAIGFASTLLLNTFVLAGQILAMQTGLGFASVIDPSNGASVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  +V + H  +   +V S+  +PI       + +   V      F   L LS
Sbjct: 128 FFLILATLLFFVFNGHLMMIQMVVHSFEVLPIDGNWWSVDHYWDIVTWGGWMFTTALVLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              L   +V NIS G++ +  PQ+ I+ I  P+ +  G + +  ++   + QF   +L  
Sbjct: 188 LAPLTAMLVINISFGIMTRAAPQLNIFAIGFPFTLVAGLVIIWATLGNFILQFEFQWLKM 247


>gi|226225722|ref|YP_002759828.1| flagellar biosynthetic protein FliR [Gemmatimonas aurantiaca T-27]
 gi|226088913|dbj|BAH37358.1| flagellar biosynthetic protein FliR [Gemmatimonas aurantiaca T-27]
          Length = 295

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 55/239 (23%), Positives = 106/239 (44%), Gaps = 3/239 (1%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
            S   +  +L L   R+G  +++ P  S   +PM++R    + F+++LLP    T D   
Sbjct: 12  FSAPGVATALVLTALRIGGLLLIAPAWSAKSVPMKLRTAMLVLFAVLLLPTALATTDRAT 71

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
                      + E  +G   G    +   G +F G +++T IGL+        ++    
Sbjct: 72  LAITP---ATFLAETAIGFAFGFAAALVIAGAEFAGELMTTTIGLSGAAIFDPVNNTQGA 128

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
              S + ++ L  L +   H  +  A+ KS+  +P+G  ++    F +      T F   
Sbjct: 129 IFGSFMQLMALTLLLITGGHIVMIEAIAKSFSVLPLGAPIDMQAGFLALTKAGGTIFATG 188

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           L+ ++P +   +V NI++ +L +  PQ+ I  ++ P  IG+G L    S+ +IV+    
Sbjct: 189 LQFAAPVIAAILVTNIALAILGRAAPQLQIMSLAFPLQIGIGLLTFAGSVGLIVHALGE 247


>gi|291536021|emb|CBL09133.1| flagellar biosynthetic protein FliR [Roseburia intestinalis M50/1]
          Length = 259

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 105/236 (44%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           L LI+ R+   + + P       P Q ++ F+   ++++  F+  T     +     Y+ 
Sbjct: 14  LILILVRISCFVYIAPFFGTKNAPSQAKIGFSFFVALLVYGFVDKT--AIEYTGLIGYAI 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E   G + G    +    + F G++I   IGL++ T    + +   T   +L    
Sbjct: 72  IVLKEGITGLLIGFAANICNSIILFAGNIIDMDIGLSMVTEFDPTMNTQVTITGNLYNYF 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPI-GQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            LL L   D HH +  A+V S+  +PI GQ  N+ ++  S    +   F+I  R+  P  
Sbjct: 132 ILLLLIATDMHHVILQAVVDSFTVVPINGQIFNWDSLAGSITQYMTDLFVIGFRIFLPIF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              ++ N  +G+L K+ PQ+ ++ +     I +G   L L+I ++    S  F   
Sbjct: 192 ACMMILNCILGILAKVAPQMNMFAVGMQMKILVGFGVLFLTISLLPGIASFIFTEM 247


>gi|241761182|ref|ZP_04759271.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374801|gb|EER64262.1| flagellar biosynthetic protein FliR [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 265

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 96/242 (39%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  +    + + R G+  +  P L  +  P+ VR+  A+A  +  +      +     V+
Sbjct: 10  ENYLWIWLIALLRPGAAFVAAPLLGANAFPVTVRVMLALAVGLPSVMDAHLILPDSGLVS 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV+ E+  G   G  +++       T  +I  A+GL   + +   +      L 
Sbjct: 70  FTGL-FLVVGEIITGIAIGFAVQIGYAAGYCTSELIGNAMGLGFASMIDPVNGSNSNVLT 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            +  I+G       D H  +   +V+SY T+P+G       +F          F I + +
Sbjct: 129 QIFTILGAFFFLAADGHLLLIRIIVESYQTMPVGGPGLNNQLFLKLTQFAGQLFSIGMLI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  I+  + +G L++  P + ++ +  P  + +G L + +S+  I      +   
Sbjct: 189 ALPVTFSIILIQVMMGFLSRTAPALNLFAVGMPMALIIGILLIAISVPAISEGVIDAIRS 248

Query: 246 GF 247
           G 
Sbjct: 249 GL 250


>gi|294675614|ref|YP_003576229.1| flagellar biosynthetic protein FliR [Rhodobacter capsulatus SB
           1003]
 gi|294474434|gb|ADE83822.1| flagellar biosynthetic protein FliR [Rhodobacter capsulatus SB
           1003]
          Length = 258

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 110/240 (45%), Gaps = 4/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++   F++  RVG  + ++P      +P +V+L    AF+++++P     ++  +     
Sbjct: 15  LLWVGFIVFLRVGGTMAVMPAFGEMMVPTRVKLGLTFAFTLIVMPGALPFVNAPD--TSL 72

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             +  +  E+ +G   GL++R++ L LQ  G++ + +  L+     G +    +  +  L
Sbjct: 73  PVAVWMFAEIVIGLFIGLMLRLFVLCLQIAGTIAAQSTSLS--QLFGGTTGEPQPAVGEL 130

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + + GL     +  H +V    + SY  +P G   +        +  +   F +   +++
Sbjct: 131 LVLAGLAIAVHLGLHVKVTEIFLGSYQALPPGAFPDADLFRQWGLGGISRAFALGFSIAA 190

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+   +++N+++G +N+ +PQ+ +  I  P     G   L +++   +  ++ +F    
Sbjct: 191 PFVIAGLIYNVALGAINRAMPQLMVSMIGAPAQTLGGLALLMIALPTGLLVWNDAFDAFL 250


>gi|319781654|ref|YP_004141130.1| flagellar biosynthetic protein FliR [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167542|gb|ADV11080.1| flagellar biosynthetic protein FliR [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 250

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 84/245 (34%), Positives = 136/245 (55%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++  + ++++ FL  CR+G+C ML+PGLS + +P+QVRL  A+A +  LL FLWD I  
Sbjct: 1   MSVLSQGVVIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDKIFP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ EL +G + G + R+Y   L+F GS I+  +G        I +   
Sbjct: 61  FVDPRPQILVPMIISELLVGGLIGAMTRLYMEALRFMGSAIAMLVGYGGTGGPAIEEPEP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L ++I    LL L+V DF H++  ALV SY   P+    N         + +  TF 
Sbjct: 121 QAALAAIISFSALLMLFVFDFDHEIIRALVSSYTVAPVNIFFNPQAALVDVTDTVSDTFF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +++RL SPF+ + I+ N++IG +NKL PQIPIYFIS P++I  G +    ++  ++  F 
Sbjct: 181 LVIRLGSPFVAYAILVNLTIGFVNKLTPQIPIYFISQPFIIAGGMIIFYFAVGTMLSLFV 240

Query: 241 HSFLY 245
             F+ 
Sbjct: 241 DGFVD 245


>gi|283954736|ref|ZP_06372252.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283793576|gb|EFC32329.1| flagellar biosynthetic protein FliR [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 255

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 106/239 (44%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++  L++ R+   I+  P  S + IPM ++    +  ++ L P       L++    ++
Sbjct: 12  VVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTIVLFLTMYLYPLAR----LESLHLDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G + GL++++    +   G  I+  +G  + + +  +   +    + ++
Sbjct: 68  FVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTMGFTMASILDPNSGTSMPITSQIL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ L+     D HH +   L  S G I +G      N+       +   F+I   +S P
Sbjct: 128 NLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPHENLMHYLNMGMFNIFIIGFTMSFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  GLL K +PQ  +  I  P  I LG + L   + +++  F +  L  F
Sbjct: 188 ILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIALGFVVLVAILLVMMQYFKNLVLELF 246


>gi|313497811|gb|ADR59177.1| FliR [Pseudomonas putida BIRD-1]
          Length = 258

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P ++RL  A+A ++V++P L    +      R
Sbjct: 11  TWVATFILPLFRVTAVLMTMPIFGTRMLPARIRLYVAVAVTVVIVPALPPLPEFDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++ 
Sbjct: 71  GML--LCAEQIIVGALFGLALQLLFQAFVVAGQIVAVQMGMAFASMVDPANGVNVTVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L 
Sbjct: 129 FMTMLVSVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V NI+ G++ +  PQ+ I+ I  P  + +G     + +  ++  +       
Sbjct: 188 LPVIAALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMGMFIFWVGLADVLSHYQALASET 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|170683764|ref|YP_001742350.1| lateral flagellar export/assembly protein LfiR [Escherichia coli
           SMS-3-5]
 gi|170521482|gb|ACB19660.1| lateral flagellar export/assembly protein LfiR [Escherichia coli
           SMS-3-5]
          Length = 260

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|146294568|ref|YP_001184992.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens CN-32]
 gi|145566258|gb|ABP77193.1| flagellar biosynthetic protein FliR [Shewanella putrefaciens CN-32]
          Length = 259

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/246 (20%), Positives = 110/246 (44%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +    +++   +   CR+    M++P L  +Y+P+ VR+  A++ + +L P L     + 
Sbjct: 6   STEISMLIGGFWWPFCRIMGAFMIMPLLGNAYVPVMVRIFLALSIAALLAPMLPPVPPVD 65

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                + +  L + +L +G +  L + +    +   G+++S  +GL +      ++  + 
Sbjct: 66  AISLASLF--LAIEQLLIGFMLALFLTLLIHVMTMLGNIMSMQMGLAMAVMNDPANGDSS 123

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
             ++    I G L    ++ H      +V S+   PIG  +    +    V+ L   F  
Sbjct: 124 PIISEWFQIFGTLIFLALNGHLVAINIIVDSFRLWPIGHGIFELPLM-GLVSRLAWLFAA 182

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            L L+ P +   ++ NI+ G+L++  P + I+ +  P  + +G L + LS+  I  ++S 
Sbjct: 183 SLMLAIPAVLAMLMVNITFGVLSRSAPSLNIFSLGFPMTMLMGLLCVFLSLSGIPSRYSD 242

Query: 242 SFLYGF 247
             L   
Sbjct: 243 LCLDAL 248


>gi|323136993|ref|ZP_08072073.1| type III secretion system inner membrane R protein [Methylocystis
           sp. ATCC 49242]
 gi|322397754|gb|EFY00276.1| type III secretion system inner membrane R protein [Methylocystis
           sp. ATCC 49242]
          Length = 250

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 71/239 (29%), Positives = 125/239 (52%), Gaps = 1/239 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-DLQNFV 64
           E  +   F+I CR+G C+M+ PG S   +P+++RL  A+  ++ L P L DT+       
Sbjct: 5   ESAIAPTFIIFCRIGGCLMVAPGFSSERVPVRIRLYIAIGVTLALAPALIDTLQPGLRGA 64

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
           +      ++M EL +G   GLL R+Y L L+   + ++  IGL       + ++     L
Sbjct: 65  DPLKLGAIIMGELTIGVFIGLLARLYFLALETLATAVAMTIGLGNIFGSALIEAEPAPAL 124

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
           ++ + I  ++ ++V D H ++   L  SY T P+       +  +    +L  ++++ LR
Sbjct: 125 STFVVICAIMLVFVTDQHLEMIRGLYLSYQTTPVFSPAAPESYLNELTRVLTQSYLLALR 184

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +SSPFL F ++ N++ G L +L PQ+P+YFIS P++I LG     +  +     FS  F
Sbjct: 185 ISSPFLLFGLIVNLAFGFLARLTPQVPVYFISGPFVIVLGIYGFSIVAQDFFTAFSGQF 243


>gi|303326360|ref|ZP_07356803.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. 3_1_syn3]
 gi|302864276|gb|EFL87207.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. 3_1_syn3]
          Length = 263

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 102/234 (43%), Gaps = 1/234 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +SL L + RV   + +LP  S + IP+ V+    + FS+ + P L  +  +    +    
Sbjct: 12  LSLLLTMMRVSIVMFMLPVFSTNNIPIPVKAAVTIVFSLGVWPHLALSGAIM-PAHPFDM 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             +++ E+ LG V G+ +    +G+Q  G ++   +G  +                  + 
Sbjct: 71  VLMLLGEVVLGLVLGMAVNFLFMGIQAGGELLGFQMGFTMINFADPLTGNQTGATAFFLW 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++ LLA   +D H  +      S+  +P G      N+    +++    F++ L++++P 
Sbjct: 131 MVSLLAFLALDGHLYMIKGFAASFALVPPGGLFIGENLLWQVLDLAAQVFVLALKIAAPV 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +    +  +++ L+ +  PQI I     P  IG+G  F+ L + ++     H  
Sbjct: 191 MVALFMVEVALALVARTSPQIHIMEFGFPIKIGVGFFFVGLLLVVMADHVEHFI 244


>gi|32471371|ref|NP_864364.1| flagellar biosynthetic protein fliR [Rhodopirellula baltica SH 1]
 gi|32443212|emb|CAD72043.1| probable flagellar biosynthetic protein fliR [Rhodopirellula
           baltica SH 1]
          Length = 264

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 104/231 (45%), Gaps = 4/231 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW---DTIDLQNFVNRAYYS 70
           L++ R+G  +M +P +    +P ++R   A+  + +L+P L    D   +    N    +
Sbjct: 17  LVLTRLGMLLMAMPAIG-VGVPKRIRALLALVLTAILMPTLAAQCDHPSMPTIDNLPELA 75

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             +  E  +G + G   ++   GLQ  G  I++  G+ L  S+  + S +   L  ++G+
Sbjct: 76  VAIGREALIGMLIGATTQMVITGLQLAGEAITSTGGMQLGDSIDPTTSSSMPALARMVGM 135

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +    + +   H  V   LV+S+  IP G      ++  + + ++  +    +R++ P +
Sbjct: 136 LVTTVMLITGAHRVVLRLLVESFQHIPPGNVQFTDSMMDAVIVVMGNSMASGVRVAGPVI 195

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              ++ N+  GL+++ +PQI +  I          +   L+I  + + F  
Sbjct: 196 AALLLANLVTGLISRTLPQINVLAIGLSINALAMLVVTALTIGSVAWLFQE 246


>gi|269836607|ref|YP_003318835.1| flagellar biosynthetic protein FliR [Sphaerobacter thermophilus DSM
           20745]
 gi|269785870|gb|ACZ38013.1| flagellar biosynthetic protein FliR [Sphaerobacter thermophilus DSM
           20745]
          Length = 260

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 63/238 (26%), Positives = 115/238 (48%), Gaps = 2/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L+V R+G+ +M +PG +   +P  +++  A+A S+VL+PF       +   + A 
Sbjct: 12  IAVFLLMVTRIGTMLMFMPGFAGRSVPPAIKVLAALALSLVLVPFTRP--GTETLTDPAS 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           ++  +  E  LG + G  I V    ++   S++   IGLNL      S  L  TPLN+  
Sbjct: 70  FTVGLAREFLLGLLMGFGIAVVFGAIEMAASLVGAQIGLNLSGVFNPSLDLQGTPLNTFY 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +   L  +  + HH V  AL +S+ T+PIG      N  ++ + +    F+  LR+  P
Sbjct: 130 LVAAALVFFSANGHHLVLMALHRSFQTVPIGSAALADNAGTAIIALASLMFVDALRIGLP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
                +  +  +G+LN++VPQ+ ++F+  P  I  G   L L++  ++   +     G
Sbjct: 190 VAGTLLAVDACLGVLNRMVPQMNVFFVGLPVKIFAGFAVLLLTLPFLIRVLAPMVTDG 247


>gi|13472611|ref|NP_104178.1| flagellar biosynthesis protein FliR [Mesorhizobium loti MAFF303099]
 gi|14023357|dbj|BAB49964.1| flagellar biosynthesis protein; FliR [Mesorhizobium loti
           MAFF303099]
          Length = 250

 Score =  108 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 86/245 (35%), Positives = 136/245 (55%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++  + ++++ FL  CR+G+C ML+PGLS + +P+QVRL  A+A +  LL FLWD I  
Sbjct: 1   MSVLSQSVVIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDRIIP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ EL +G + G + R+Y   L+F GS I+  IG        I +   
Sbjct: 61  FVDPRPQILVPMIISELLIGGLIGAMTRLYMEALRFMGSAIAMLIGYGGSGGPAIEEPEP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L ++I    LL L+V DF H++  ALV SY   P+    N         + +  TF 
Sbjct: 121 QAALAAIISFSALLMLFVFDFDHEIVRALVASYTVAPVNVFFNPQAALVDITDTVSDTFF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +++RL SPF+ + I+ N++IG +NKL PQIPIYFIS P++I  G +    +I  ++  F 
Sbjct: 181 LVIRLGSPFVAYAILVNLTIGFVNKLTPQIPIYFISQPFVIAGGMIIFYFAIGTMLSLFV 240

Query: 241 HSFLY 245
             F+ 
Sbjct: 241 DGFVD 245


>gi|15616706|ref|NP_239918.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11386790|sp|P57186|FLIR_BUCAI RecName: Full=Flagellar biosynthetic protein fliR
 gi|25346394|pir||D84939 flagellar biosynthetic protein fliR [imported] - Buchnera sp.
           (strain APS)
 gi|10038769|dbj|BAB12804.1| flagellar biosynthetic protein fliR [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 258

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 103/242 (42%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ + F  + RV S   + P      I  + ++  +   S ++ PFL    ++   +  
Sbjct: 11  TLISNFFWPMIRVLSFFSVAPIFKEKLINRKSKILLSGMISWLVWPFLP---EVHTVLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +   L++ ++ +G V G   ++    +  +G +I   +GL+  T    +  +  + ++ 
Sbjct: 68  YFGFLLILQQILIGIVLGFTAQLLFATINLSGEIIGLQMGLSFATFFNNNSQIGTSIISR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+ L     ++ H  +   ++ S+ ++PI       NIF   +    + F+  L L 
Sbjct: 128 FLNILALFVFITLNMHLYLISIVIDSFYSMPIDGYFLNVNIFFILLKFSSSIFLNGLLLV 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  +  + LLN+L PQI I+ I  P  + LG L L   I +++          
Sbjct: 188 LPIMIILLSISFVMSLLNRLSPQISIFSIGFPLNLILGMLMLYFLIPVMLPFLKKILDDL 247

Query: 247 FF 248
            F
Sbjct: 248 IF 249


>gi|308050044|ref|YP_003913610.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
 gi|307632234|gb|ADN76536.1| flagellar biosynthetic protein FliR [Ferrimonas balearica DSM 9799]
          Length = 259

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++  ++    R+     L+P  S  ++P++V++  A   + ++ P L     +      A
Sbjct: 12  MIGRIWWPFFRIAGAFALMPFFSNGHVPVRVKVLLAFFLATLVGPVLPTPPPVDPLSAHA 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +   +L +G + GL++ +    L   G ++S  +GL +      ++ +    L   
Sbjct: 72  --LLIAFEQLAVGAMMGLILSMLLHILSMLGQMLSMQMGLAMSVMNDPANGVNHALLGQW 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + + G L    +D H      +V+S+   PIG  +    +    +     TF + L L+ 
Sbjct: 130 MVMYGTLLFLALDGHLVALGIVVESFTLWPIGSGVQELPLMMLIMK-FGWTFAMALMLAI 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ NI+ G+LNK  P + +Y +  P  + LG + + +S   +  +++   L   
Sbjct: 189 PAVMAMLMVNITFGVLNKSAPTLNVYSLGFPLAMMLGLVSILISFSGLPGRYTDLCLDAL 248


>gi|209884539|ref|YP_002288396.1| flagellar biosynthetic protein FliR [Oligotropha carboxidovorans
           OM5]
 gi|209872735|gb|ACI92531.1| flagellar biosynthetic protein FliR [Oligotropha carboxidovorans
           OM5]
          Length = 258

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 120/237 (50%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           ++  +  L+  RVG+ +MLLPG   + +P+++RL  A+  +++LLP       +      
Sbjct: 10  VLAATFMLVFARVGAMMMLLPGFGEANVPVRLRLGIALLLAMILLPLHRAAYHVDLTSIN 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    +V  E+ +G V G   R     L   GS+I+  IGL   T++  +       L +
Sbjct: 70  AVMILMV-HEIIIGVVLGATARFTLAALSVAGSIIAQQIGLGFVTAVDPTQDQQSVILAN 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+GL  ++  D H+ V  AL  SY     G+ +  G++ +         F I ++L+
Sbjct: 129 FLTILGLTLIFATDTHYLVIAALNDSYTLFQPGELMPSGDVAALATKAFTMAFTIGVQLA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +PF+ F ++FN+ +GLL +++PQ+ +YF+  P  I  G L L + +  ++  F   F
Sbjct: 189 APFIIFGLIFNLGLGLLARMMPQMQVYFVGVPLSILAGFLLLGIVLVALMGTFLDYF 245


>gi|77165625|ref|YP_344150.1| flagellar biosynthesis protein FliR [Nitrosococcus oceani ATCC
           19707]
 gi|76883939|gb|ABA58620.1| Flagellar biosynthesis protein FliR [Nitrosococcus oceani ATCC
           19707]
          Length = 236

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 93/224 (41%), Gaps = 3/224 (1%)

Query: 24  MLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMVELFLGCVH 83
           M +P      +P+++RL  A+A ++V+ P +  T      V       LVM +  +G   
Sbjct: 1   MAMPLFGSKVVPVRIRLVLALALTVVIAPVIPATSVAALSVEGG---LLVMQQFLIGFAM 57

Query: 84  GLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLALWVIDFHH 143
            L++++        G +++T +GL   + M   + +A + ++ L  ++  L    ++ H 
Sbjct: 58  ALVLQMVFQAFAIGGQIVATQMGLGFASLMDPQNGVAVSMVSQLYTVLITLVFLGLNGHL 117

Query: 144 QVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIVFNISIGLL 203
            V   L +S+  +P+G E      F              + ++ P +    + N++ G++
Sbjct: 118 VVIQVLAESFYVLPLGVERASLGGFWQLAGAGSWMLAGSVLIALPAIGALSLVNLTFGVM 177

Query: 204 NKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           ++  PQ+  + I  P  + LG   L  ++        +      
Sbjct: 178 SRAAPQLNPFSIGFPLTLILGFWVLLFTLPNAPSHLVNLTDTAL 221


>gi|26991042|ref|NP_746467.1| flagellar biosynthesis protein FliR [Pseudomonas putida KT2440]
 gi|24986074|gb|AAN69931.1|AE016632_2 flagellar biosynthetic protein FliR [Pseudomonas putida KT2440]
          Length = 258

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + +  L + RV + +M +P      +P ++RL  A+A ++V++P L    +      R
Sbjct: 11  TWVATFILPLFRVTAVLMTMPIFGTRMLPARIRLYVAVAVTVVIVPALPPLPEFDPLSLR 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L   ++ +G + GL +++        G +++  +G+   + +  ++ +  T ++ 
Sbjct: 71  GML--LCAEQIIVGALFGLALQLLFQAFVVAGQIVAVQMGMAFASMVDPANGVNVTVISQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++  +   +++ H  VF  L +S+ T+P+G  L   N F      +   F   L L 
Sbjct: 129 FMTMLVSVLFLLMNGHLVVFEVLTESFTTLPVGSALVV-NHFWELAGRMGWVFGAGLLLI 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V NI+ G++ +  PQ+ I+ I  P  + +G     + +  ++  +       
Sbjct: 188 LPVIAALLVVNIAFGVMTRAAPQLNIFSIGFPLTLVMGMFIFWVGLADVLSHYQALASET 247

Query: 247 F 247
            
Sbjct: 248 L 248


>gi|238785489|ref|ZP_04629472.1| Flagellar biosynthetic protein fliR [Yersinia bercovieri ATCC
           43970]
 gi|238713591|gb|EEQ05620.1| Flagellar biosynthetic protein fliR [Yersinia bercovieri ATCC
           43970]
          Length = 260

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 107/241 (44%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++   F  + RV + I   P LS   I  +V++  A+  + ++ P L     +   +  
Sbjct: 11  TMVSHYFWPLIRVLALITTAPVLSERQINRKVKVGLAVLITFLIAPALP---PVNIPLVS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    +   ++ +G   GL ++     ++  G VI   +GL+  T    S     + L+ 
Sbjct: 68  SGALWVAAQQILIGVTIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNTSVLSR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ ++ +L     + H  +   L  S+ T+PI  E   G+ F +        FM  L L+
Sbjct: 128 LLNLLAMLLFLSFNGHLWLISLLADSFHTLPIQFEPLNGSGFLTLAQTGSLIFMNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN++ PQ+ ++ I  P  + +G L L L + ++     H F   
Sbjct: 188 LPLITLLLTLNLALGMLNRMTPQLSVFVIGFPLTLTVGILSLGLIMPLLAPFAEHLFSEF 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|114777580|ref|ZP_01452561.1| Flagellar biosynthesis protein FliR [Mariprofundus ferrooxydans
           PV-1]
 gi|114552051|gb|EAU54568.1| Flagellar biosynthesis protein FliR [Mariprofundus ferrooxydans
           PV-1]
          Length = 260

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 116/235 (49%), Gaps = 2/235 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++   L++ RV + IM+LP L    +P Q++    +  +I++ P + D +        A 
Sbjct: 11  IIIGLLVMLRVSALIMMLPILGHQLVPAQIKRGLIVLLTILIFPLVADKVAAIPLKPVA- 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +  + + E+ +     L  ++    +Q  G +IS  +G+++           ++ ++ L 
Sbjct: 70  FVIVAIHEILVAAAIALFAQLIFAAIQLAGQLISFQMGMSVANVFDPMTHSQQSVVSQLA 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + +L    +  HH    AL++S+   PI Q + F    S+  +   T F++ L++++P
Sbjct: 130 VTLAMLLWISVGAHHMFITALIESFTLFPIHQAIYFP-ALSTLTDAAATMFVLALKIAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            +    +  +++GLL++ VPQI ++F+S P  +GLG L   L +   VY  S +F
Sbjct: 189 LMVLMTLVYVALGLLSRAVPQIQVFFVSFPLTVGLGLLTFALGMPAFVYLVSDAF 243


>gi|167623391|ref|YP_001673685.1| flagellar biosynthesis protein FliR [Shewanella halifaxensis
           HAW-EB4]
 gi|167353413|gb|ABZ76026.1| flagellar biosynthetic protein FliR [Shewanella halifaxensis
           HAW-EB4]
          Length = 265

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 91/237 (38%), Gaps = 2/237 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +      + R+ S  M++     +  P +VRL  ++A ++ + P L     +  F   A 
Sbjct: 12  IAGYLWPLTRISSMFMVMAVFGATTTPTRVRLLLSVAVTVAVAPVLPAMPTIDLFSLSAA 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +      ++ +G   G    +       TG +I     L   + +  S       + +  
Sbjct: 72  FVT--AQQIIIGVAMGFATLLLMQTFVLTGQIIGMQTSLGFASMVDPSSGQQTPVIGNFF 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  +    +D H  +   ++ S+ +IP+  +      +  F   +   F   L +S  
Sbjct: 130 LLLTTVIFLAVDGHLLLIKMVIASFDSIPVSMQGLSLVSYRLFTEFVGYMFGAALTMSLS 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +   +  N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F   +  
Sbjct: 190 AIVALLTINLSFGVMTRASPQLNIFSIGFPVTMIAGLFILWLTLSPIMTHFDEVWRE 246


>gi|238799424|ref|ZP_04642853.1| Flagellar biosynthetic protein fliR [Yersinia mollaretii ATCC
           43969]
 gi|238716728|gb|EEQ08615.1| Flagellar biosynthetic protein fliR [Yersinia mollaretii ATCC
           43969]
          Length = 260

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 106/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++   F  + RV + I   P LS   I  +V++  A+  + ++ P L     +   +  
Sbjct: 11  ALVSQYFWPLIRVLALITTAPVLSEKQINRKVKVGLAVLITFLIAPALP---PVNIPLVS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           +    +   ++ +G   GL ++     ++  G VI   +GL+  T    S     + L+ 
Sbjct: 68  SGALWVAAQQILIGVTIGLTMQFAFAAIRLAGEVIGLQMGLSFATFFDPSGGPNTSVLSR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ ++ +L     + H  +   L  S+ T+PI  E   G  F +        FM  L L+
Sbjct: 128 LLNLLAMLLFLTFNGHLWLISLLADSFHTLPIQFEPLNGGGFLTLAQTGSLIFMNGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++G+LN++ PQ+ ++ I  P  + +G L L L + ++     H F   
Sbjct: 188 LPLITLLLTLNLALGMLNRMTPQLSVFVIGFPLTLTVGILSLGLIMPLLAPFAEHLFSEF 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|218133681|ref|ZP_03462485.1| hypothetical protein BACPEC_01550 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991056|gb|EEC57062.1| hypothetical protein BACPEC_01550 [Bacteroides pectinophilus ATCC
           43243]
          Length = 260

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 109/234 (46%), Gaps = 2/234 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI+ R+ + +   P  + +  P +V++ F+ A +I++     D      +     Y+ 
Sbjct: 14  FILILVRISTFVYAAPFFNTANTPNRVKIGFSFALAILVYTL--DLGITYTYSGMLDYAA 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V+ E  +G + G         + F+G +I   +G+++ T    +       +++L   +
Sbjct: 72  IVLSEAAVGLLLGYAANASVQIIMFSGHIIDVDMGISMATIFDPTTKTQVGIMSNLYYYL 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L L V   +  +  A+V +Y  IPIGQ     +++++ V+ +   F+I  R++ P   
Sbjct: 132 LSLLLIVSGLYRYLVSAIVDTYKVIPIGQAAFRPSLYTTIVDFIGDYFVIGFRIALPMFA 191

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
             ++ N  +G+L ++ PQ+ ++ +     I +G + +  ++ ++    ++ F  
Sbjct: 192 CMMLLNCILGVLARIAPQMNMFVMGMQLKIFVGIIVVTFTLVMLPSVSNYIFQE 245


>gi|194434960|ref|ZP_03067203.1| flagellar biosynthetic protein FliR [Shigella dysenteriae 1012]
 gi|194416795|gb|EDX32921.1| flagellar biosynthetic protein FliR [Shigella dysenteriae 1012]
          Length = 260

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 11  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 67

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 68  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 127

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 128 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + ++     H F   F
Sbjct: 188 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLVAPFCEHLFSEMF 247


>gi|327537627|gb|EGF24339.1| flagellar biosynthetic protein fliR [Rhodopirellula baltica WH47]
          Length = 264

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 104/231 (45%), Gaps = 4/231 (1%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW---DTIDLQNFVNRAYYS 70
           L++ R+G  +M +P +    +P ++R   A+  + +L+P L    D   +    N    +
Sbjct: 17  LVLTRLGMLLMAMPAIG-VGVPKRIRALLALVLTAILMPTLAAQCDHPSMPTIDNLPELA 75

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
             +  E  +G + G   ++   GLQ  G  I++  G+ L  S+  + S +   L  ++G+
Sbjct: 76  VAIGREALIGMLIGATTQMVITGLQLAGEAITSTGGMQLGDSIDPTTSSSMPALARMVGM 135

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           +    + +   H  V   LV+S+  IP G      ++  + + ++  +    +R++ P +
Sbjct: 136 LVTTVMLITGAHRVVLRLLVESFQHIPPGNVQFTDSMMDAVIVVMGNSMASGVRVAGPVI 195

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
              ++ N+  GL+++ +PQI +  I          +   L+I  + + F  
Sbjct: 196 AALLLANLVTGLISRTLPQINVLAIGLSINALAMLVVTALTIGSVAWLFQE 246


>gi|293408346|ref|ZP_06652185.1| flagellar biosynthetic protein FliR [Escherichia coli B354]
 gi|291471524|gb|EFF14007.1| flagellar biosynthetic protein FliR [Escherichia coli B354]
          Length = 260

 Score =  108 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 100/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +++ L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LVLGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIELAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|219681462|ref|YP_002467847.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682018|ref|YP_002468402.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471137|ref|ZP_05635136.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|219621751|gb|ACL29907.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624305|gb|ACL30460.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311085826|gb|ADP65908.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086399|gb|ADP66480.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311086978|gb|ADP67058.1| flagellar biosynthetic protein FliR [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 258

 Score =  108 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 103/242 (42%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ + F  + RV S   + P      I  + ++  +   S ++ PFL    ++   +  
Sbjct: 11  TLISNFFWPMIRVLSFFSVAPIFKEKLINRKNKILLSGMISWLVWPFLP---EVHTVLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
            +   L++ ++ +G V G   ++    +  +G +I   +GL+  T    +  +  + ++ 
Sbjct: 68  YFGFLLILQQILIGIVLGFTAQLLFATINLSGEIIGLQMGLSFATFFNNNSQIGTSIISR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + I+ L     ++ H  +   ++ S+ ++PI       NIF   +    + F+  L L 
Sbjct: 128 FLNILALFVFITLNMHLYLISIVIDSFYSMPIDGYFLNVNIFFILLKFSSSIFLNGLLLV 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  +  + LLN+L PQI I+ I  P  + LG L L   I +++          
Sbjct: 188 LPIMIILLSISFVMSLLNRLSPQISIFSIGFPLNLILGMLMLYFLIPVMLPFLKKILDDL 247

Query: 247 FF 248
            F
Sbjct: 248 IF 249


>gi|56964017|ref|YP_175748.1| flagellar biosynthesis protein FliR [Bacillus clausii KSM-K16]
 gi|56910260|dbj|BAD64787.1| flagellar biosynthetic protein FliR [Bacillus clausii KSM-K16]
          Length = 260

 Score =  108 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 99/240 (41%), Gaps = 7/240 (2%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           +  LI  RV S  ++LP  +   +P  ++L  +   +      L  ++D+        + 
Sbjct: 10  AFLLIFIRVSSFFVVLPLFNHRTVPAPLKLGLSAFLAA----TLAVSLDVPELALDLPFL 65

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L + E  +G   GL+  +    +Q  G VI   +G  L   +            S + +
Sbjct: 66  LLALKEFAIGIAAGLMASMILYAVQVAGGVIDFHLGFMLANVVDPQTGAQSPLTGSYLYL 125

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQ---ELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             +L L +ID HH +   ++ SY  +P+ Q       G++      ++   F + + ++ 
Sbjct: 126 FAMLYLLIIDGHHLLLDGVIYSYQFVPLDQLVLPFGSGHVMEHVTQVMVMLFAMAVSMAM 185

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P      + ++++G++++ VPQ+ ++ +  P  +  G +   + I +     +  F    
Sbjct: 186 PVAGALFLVDVALGIISRTVPQMNVFVVGIPIKMLAGFIVFAIYIGVFFMSVNVLFEELL 245


>gi|323968366|gb|EGB63773.1| flagellar biosynthetic protein FliR [Escherichia coli M863]
 gi|327253082|gb|EGE64736.1| flagellar biosynthetic protein FliR [Escherichia coli STEC_7v]
          Length = 261

 Score =  108 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|284989538|ref|YP_003408092.1| flagellar biosynthetic protein FliR [Geodermatophilus obscurus DSM
           43160]
 gi|284062783|gb|ADB73721.1| flagellar biosynthetic protein FliR [Geodermatophilus obscurus DSM
           43160]
          Length = 254

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 92/228 (40%), Gaps = 3/228 (1%)

Query: 5   PEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV 64
           P   M +L L   R    ++L P  +   IP  V+   A+A S+ L+  +   +      
Sbjct: 6   PAGTMAALLLGTARATGFVLLAPPFNSRSIPAPVKGALALALSVALMTRIAPELPDP--- 62

Query: 65  NRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
              +     + E+ +G   G ++ V    +Q+ G +I    G +LQ +         + +
Sbjct: 63  TTGFLVVGAVTEVAIGAALGFVVHVLFAAVQYAGDLIDLTGGFSLQPAYDPLSMTTSSSV 122

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
             L  ++    L+    H  V      SY  +P+G  +    +    +  L   F+  L+
Sbjct: 123 GRLHYLLATTLLFTSGGHLLVVRGFATSYEGLPVGGSVPTEQLAQVLITALSMMFLAALQ 182

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSI 232
           ++ P +   ++ ++++ LL++  P + I+    P  I L    L L+ 
Sbjct: 183 IAGPMVAVLLLADVALALLSRAAPALNIFSFGFPVKIMLTMALLGLTF 230


>gi|149184190|ref|ZP_01862508.1| flagellar biosynthetic protein FliR [Erythrobacter sp. SD-21]
 gi|148831510|gb|EDL49943.1| flagellar biosynthetic protein FliR [Erythrobacter sp. SD-21]
          Length = 261

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/242 (16%), Positives = 90/242 (37%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  M  +  ++ R+G+ ++  P    + +PM VR+    A +I +  ++   +     + 
Sbjct: 12  EQDMWRVVFLMTRIGAALLAAPFFGATSVPMAVRVSITGALAIFVATWM-PEVQTPEAIL 70

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                  +  E+ +G   G ++++          +I   +G+++  S         T   
Sbjct: 71  SLEGLLAIAGEVVIGLALGFVLQLAFAAPTIAAELIGGGMGMSMAVSQDAMGGGTTTSFG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               I+  L       H      + +SY   P GQ       F++        F   +R+
Sbjct: 131 QYFVIVLTLIFLSTGAHLHWVALVAESYSAFPPGQTWLGAERFAAIAGFASFMFETAIRI 190

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P     ++  +  G+L++  P + ++ +  P  +  G   L +S  +I  QF+     
Sbjct: 191 ALPVTLILLLVQVITGILSRSAPSLNLFALGLPAGVLAGMAALIISAPLIYDQFAGLVAD 250

Query: 246 GF 247
             
Sbjct: 251 AL 252


>gi|307720324|ref|YP_003891464.1| flagellar biosynthetic protein FliR [Sulfurimonas autotrophica DSM
           16294]
 gi|306978417|gb|ADN08452.1| flagellar biosynthetic protein FliR [Sulfurimonas autotrophica DSM
           16294]
          Length = 254

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 105/242 (43%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  ++   L+  R     + +P  +   IPM ++   A  F++V    +     L   ++
Sbjct: 9   ETNVVGFLLLFFRFAGLFIAVPIFNHQNIPMNIKASMAFFFAVVFYSSMPA---LHISID 65

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                  V+ EL LG   G+++++    + F G  IS  +G ++ +++     ++   ++
Sbjct: 66  VPTILVAVLGELLLGLSVGVVLQLAYNVITFAGGQISFMMGFSMASAIDPQSGVSMPIIS 125

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + ++GL+ L  ++ HH +   +  S  T+P+G  +   ++F   ++     F++   +
Sbjct: 126 QFLSLMGLMILLSLNLHHWMLLFIDHSLKTVPLGGFVMSKDLFHYIMHATSNMFLVGFII 185

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +    + ++  G+L K +PQ  +  I  P  I +  + L  +   I+         
Sbjct: 186 AFPIIALSWLADVIFGMLMKTMPQFNLLVIGFPIKIMVAFVVLIATFTAIMLILKGQIQE 245

Query: 246 GF 247
            F
Sbjct: 246 AF 247


>gi|300818630|ref|ZP_07098838.1| flagellar biosynthetic protein FliR [Escherichia coli MS 107-1]
 gi|300528802|gb|EFK49864.1| flagellar biosynthetic protein FliR [Escherichia coli MS 107-1]
          Length = 261

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|92116949|ref|YP_576678.1| flagellar biosynthesis protein FliR [Nitrobacter hamburgensis X14]
 gi|91799843|gb|ABE62218.1| flagellar biosynthetic protein FliR [Nitrobacter hamburgensis X14]
          Length = 256

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 68/235 (28%), Positives = 123/235 (52%), Gaps = 1/235 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  R+G+ +MLLPG    +IP++V+L  A+  ++++LP       +    + A  
Sbjct: 13  AAFMLVFARIGAMVMLLPGFGEVFIPVRVKLAIALLLTLIILPLHRSAYHVD-MQSVAPL 71

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
           + L++ E+ +G V G   RV    L   GSVI+  +GL   TS+  +       + + + 
Sbjct: 72  AVLMVHEIIIGVVLGATARVTLAALSVAGSVIAQQLGLGFVTSIDPTQGQQGALMGNFLT 131

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++G+  L+  D H+ V  AL  SY     G+ +  G++ +         F I L+LS+PF
Sbjct: 132 LLGIALLFATDTHYLVIAALNDSYKIFSPGELMPSGDVAALATRAFAAAFKIGLQLSAPF 191

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFL 244
           L F +VFNI +G+L +L+PQ+ +YF+  P  I +G + L   +  ++  +   F+
Sbjct: 192 LVFGLVFNIGLGVLARLMPQMQVYFVGVPLSIFIGFVILAAVLASMMGTYMDYFI 246


>gi|56460296|ref|YP_155577.1| flagellar biosynthesis protein FliR [Idiomarina loihiensis L2TR]
 gi|56179306|gb|AAV82028.1| Flagellar biosynthesis protein FliR [Idiomarina loihiensis L2TR]
          Length = 261

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 96/237 (40%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + RV S IM +   S + +  +V++  ++A  + + P L +       ++ 
Sbjct: 10  EWLEQHLWPLTRVSSMIMSMALFSGTIVNSRVKIFLSLAIIMAVSPALPEINAGVEMMSV 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  +   ++ +G   GLL  ++       G +I+  IGL   + +  ++      +  
Sbjct: 70  GGFL-VTAQQVVIGVALGLLSILFLQTFVLGGQIIAMQIGLGFASMVDPTNGQQVPVIAQ 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L     D H  + + +V S+  IP+G      +   +        F   L   
Sbjct: 129 FFLMLASLVFLAFDGHLLMIHMVVASFDAIPVGMTGLDADALFAVAEWGVYMFSAALTAM 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              +   ++ N+S G++ +  PQ+ I+ I  P  +  G + + L++   ++ F + +
Sbjct: 189 LSGVIALLLINLSFGVMTRAAPQLNIFAIGFPITMVSGLVVVWLTMGGFIFHFENQW 245


>gi|296282254|ref|ZP_06860252.1| flagellar biosynthetic protein FliR [Citromicrobium bathyomarinum
           JL354]
          Length = 261

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 94/242 (38%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  +  +  ++ RVG+ ++  P    S +P+ VR+ F  A +I +       +     + 
Sbjct: 12  EADIWRVVFLMTRVGAALLAAPFFGASNVPVVVRISFTGAMAIFI-SIWLPEVATPPALL 70

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                  +  E  +G + G ++++          VI  ++GL++ T+   +   + T   
Sbjct: 71  TLDGMLALAGEALIGLMLGFVLQIAFAAPTIAAEVIGGSMGLSMATTTDPNGGGSTTAFG 130

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               I+  L     + H      + +SY   P GQ       F +      T F   LR+
Sbjct: 131 QYFIIVLTLIFLATNAHLHWLALVTESYRAFPPGQTWIGPERFETIFMFGGTLFETALRI 190

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P     ++  I  G+L++  P + ++ +  P  +  G   L ++  +I  QF+     
Sbjct: 191 ALPVTLILLLVQIVTGILSRSAPSLNLFALGLPAGVLAGIAALIIAAPLIYDQFTDLVQV 250

Query: 246 GF 247
             
Sbjct: 251 AL 252


>gi|170725985|ref|YP_001760011.1| flagellar biosynthesis protein FliR [Shewanella woodyi ATCC 51908]
 gi|169811332|gb|ACA85916.1| flagellar biosynthetic protein FliR [Shewanella woodyi ATCC 51908]
          Length = 261

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 92/238 (38%), Gaps = 2/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + S    + RV S +M +  +  +  P+++RL  +M  +  + P L    ++  F   + 
Sbjct: 8   IASYMWPLFRVASMLMAMAIVGANTTPVRIRLLLSMTITFAIAPVLPPMENVDLFSLSSG 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +     + + +    G +  +       TG +I     L   + +  S       + +  
Sbjct: 68  FIIFQQIIIGV--AMGFVTLLVMQTFVLTGQIIGMQTSLGFASMVDPSSGQQTPVIGNFF 125

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  +    +D H  +   LV S+ TIPI  +      +          F   L +S  
Sbjct: 126 LLLTTMIFLAVDGHLVLIRMLVVSFDTIPISDQGISIASYKLLAEWGAYMFGAALTMSMT 185

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +   ++ N+S G++ +  PQ+ I+ I  P  +  G   L L++  I+  F   +   
Sbjct: 186 AIVALLMINLSFGVMTRASPQLNIFAIGFPVTMVTGLFILWLTLTPIMEHFGAVWRDA 243


>gi|329849683|ref|ZP_08264529.1| flagellar biosynthetic protein FliR [Asticcacaulis biprosthecum
           C19]
 gi|328841594|gb|EGF91164.1| flagellar biosynthetic protein FliR [Asticcacaulis biprosthecum
           C19]
          Length = 273

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 121/241 (50%), Gaps = 1/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             + ++ LI+ R+ S IML+PGL    +P ++R+  A+  ++V+ P + +T+      + 
Sbjct: 26  TQLWAVGLILLRLASMIMLMPGLGDQAVPARLRIGLALMLALVITPIVGNTLP-PLPNSL 84

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                + + E+ +G + G L+RV    L   G ++S    L+   +   + +   T L +
Sbjct: 85  GDMLGIALHEIIIGLMIGTLMRVLIFALVIAGEIMSLQTTLSFAQTANPAQAQPSTSLGT 144

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++G++ ++  + HH    A+V SY      +++  G+  +  +  +  TF++ L++S
Sbjct: 145 FLAMLGMVLIYATNLHHLFIRAMVDSYQVFAPTRDVMVGDATTLMLQTVTKTFLLALQMS 204

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           +P + F ++FNI+ G + +++P  P++F +TP  +  G   + L +      F   +   
Sbjct: 205 APLIAFALIFNIATGFIGRMMPNFPVFFAATPVSVLAGLSIMALGLGATGMVFIEHYEEL 264

Query: 247 F 247
            
Sbjct: 265 L 265


>gi|326622853|gb|EGE29198.1| flagellar biosynthetic protein FliR [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 245

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 100/232 (43%), Gaps = 3/232 (1%)

Query: 16  VCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVMV 75
           + RV + I   P LS   IP +V+L   +  ++V+ P L         +       L M 
Sbjct: 1   MLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPAN---DTPLFSIAALWLTMQ 57

Query: 76  ELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLLA 135
           ++ +G   G  ++     ++  G  I   +GL+  T +     L    L  ++ ++ +L 
Sbjct: 58  QILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLL 117

Query: 136 LWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYIV 195
               + H  +   LV ++ T+PIG      N F +        F+  L L+ P +   + 
Sbjct: 118 FLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLT 177

Query: 196 FNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            N+++GLLN++ PQ+ I+ I  P  + +G + +   + +I     H F   F
Sbjct: 178 LNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIF 229


>gi|34498460|ref|NP_902675.1| flagellar biosynthetic protein FliR [Chromobacterium violaceum ATCC
           12472]
 gi|34104315|gb|AAQ60674.1| flagellar biosynthetic protein FliR [Chromobacterium violaceum ATCC
           12472]
          Length = 259

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ +++   CR+ +   + P +  + +PM+ R+  A+A ++  +P +     +  F    
Sbjct: 11  LVPAVWWPFCRLMAAFAIAPFIGDAVVPMRARVGLALALAVACIPGMPAHSPIDPFTLHG 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
                 + ++ +G + GL  ++    L   G ++S+ +GL++       +  +   ++SL
Sbjct: 71  --VAASVEQVVIGLLFGLAFQLTLSVLALLGFLLSSQMGLSMAIMNDPGNGNSSDVVSSL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++  L  + +D H  +   +  S+   P+G  +            +       + L+ 
Sbjct: 129 LYLLAALLFFAMDGHLVLVQVVYASFRAWPLGGGIP-QASLPVLAASVGWVMSAAMILAL 187

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +F   V     G++N++ P + ++ +  P +   G   L L ++++  Q+        
Sbjct: 188 PVVFATFVVQAGFGMINRVAPALNLFSLGFPVVTLFGLSTLTLLMQVLPPQYLSLSEQTL 247


>gi|300936101|ref|ZP_07151042.1| flagellar biosynthetic protein FliR [Escherichia coli MS 21-1]
 gi|300458750|gb|EFK22243.1| flagellar biosynthetic protein FliR [Escherichia coli MS 21-1]
          Length = 260

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 100/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           +++ L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LVLGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|149195094|ref|ZP_01872186.1| Flagellar biosynthesis protein FliR [Caminibacter mediatlanticus
           TB-2]
 gi|149134807|gb|EDM23291.1| Flagellar biosynthesis protein FliR [Caminibacter mediatlanticus
           TB-2]
          Length = 254

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 49/246 (19%), Positives = 100/246 (40%), Gaps = 3/246 (1%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           T+  ++ +++  L+  R+ S +  LP  +   IPM V+   ++  SI+  P +     + 
Sbjct: 4   TLLSDVNVVTFLLLFIRISSFLSFLPFFNYMNIPMNVKAALSIWLSILFFPIVP---KVN 60

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
             +N       +  E+      G+ +++    L+F    IS  +G  +   +  +     
Sbjct: 61  FEINLINILLAIFNEIAFAFFVGMALQLIFDILKFAAEQISFVMGFTMANVIDPNFGGQS 120

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMI 181
           T L+     I +L        H     L K    +P G   N+  I+  F+  +   FMI
Sbjct: 121 TILSQFFIWIAILVFLTFGGDHLEILLLSKFMSNLPFGAFFNYHKIYEYFLVYMGKYFMI 180

Query: 182 MLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
            + L+ P +   ++ +I  G++ K +PQ  +  +  P  I +  + L   +  ++  FS 
Sbjct: 181 GVGLAFPIIAISLMSDIIFGMIMKTMPQFNLLVVGFPIKIFVSFIVLMAILSSMMLVFSR 240

Query: 242 SFLYGF 247
                F
Sbjct: 241 EIKEVF 246


>gi|20807871|ref|NP_623042.1| flagellar biosynthesis protein FliR [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516435|gb|AAM24646.1| Flagellar biosynthesis/type III secretory pathway protein
           [Thermoanaerobacter tengcongensis MB4]
          Length = 260

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 100/236 (42%), Gaps = 3/236 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L+  R+    +L P     ++P   ++      S+++   +       +  N   
Sbjct: 11  VQVFILLFVRMLGIFILAPFFGTKHVPTVFKIGLGFFASLIVFDVMPPVS--ISIDNVLT 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LV+ E  +G   GL   +    +   G +I   +G  L   + I        + + I
Sbjct: 69  YFLLVISEFLVGLTIGLASMISFSAVYLAGQLIDYQLGFGLVNILDIHSEAQVPLMGNFI 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTFMIMLRLSS 187
            I+ +L   +++ H+ +F  L KS   IPIG+   +   +      M+   F I  R+S+
Sbjct: 129 YIMTILIFMLMNGHYLLFTFLAKSTEIIPIGKIYFDLSGMLQVLTKMVSDMFAIGFRISA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   ++ ++ +G++++ +PQ+ ++ +  P  + +G   L + + + +      F
Sbjct: 189 PIILTTVLTDLVLGIISRTIPQLNVFMVGMPAKVFVGIFTLIIMLPMYLTIVDFIF 244


>gi|89056678|ref|YP_512129.1| flagellar biosynthetic protein FliR [Jannaschia sp. CCS1]
 gi|88866227|gb|ABD57104.1| flagellar biosynthetic protein FliR [Jannaschia sp. CCS1]
          Length = 256

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 55/244 (22%), Positives = 116/244 (47%), Gaps = 5/244 (2%)

Query: 4   SPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNF 63
             EI + +   +  RVG+C ++LPGL    IP++VRL  A+AF++ L P +   + +   
Sbjct: 11  LSEIWLATGIAVFLRVGACFLVLPGLGEQMIPVRVRLGAALAFTVFLTPAMQPVLSVSAV 70

Query: 64  VNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
           +           E   G + G+ +R     LQ  G++ + +  L+    +G +       
Sbjct: 71  IPP---LTAFFSEAIAGLIIGMALRYLVHALQVAGTIAAQSTSLS--QILGGATPDPLPA 125

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           + +++ + GL    +   H  +    + SY  +P G      ++    V+ +  +F + +
Sbjct: 126 MGAILMLGGLTLAVISGLHVHLVQTFLHSYDVLPFGNLPGPRDLAGWSVDQVSASFSLAV 185

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            L++PFL   +++N+++G++NK +PQ+ + F+  P +   G   L ++   I+  + H+F
Sbjct: 186 SLAAPFLVASLLYNVALGVINKAMPQLMVAFVGAPAITWGGLFLLLITTPFILPVWLHAF 245

Query: 244 LYGF 247
               
Sbjct: 246 EGAL 249


>gi|157373226|ref|YP_001471826.1| flagellar biosynthetic protein FliR [Shewanella sediminis HAW-EB3]
 gi|157315600|gb|ABV34698.1| flagellar biosynthetic protein FliR [Shewanella sediminis HAW-EB3]
          Length = 257

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 104/242 (42%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
              +   +    R+    M++P LS SYIP+ VR+  A+  S +L P L     +     
Sbjct: 10  SSFIGIFWWPFFRIMGAFMVMPFLSSSYIPVTVRVLLALTISTLLAPMLPPLPSVDAISI 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A +  L + +L +G + GL + +    +   G+++S  +GL +      ++  +   L 
Sbjct: 70  GALF--LAIEQLLVGFMLGLFLTIMIHVMTLLGAMMSMQMGLAMAVMNDPANGSSNPILG 127

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
               + G L    +D H      LV S+   PIG  +    +    V+     F   L L
Sbjct: 128 QWFLLYGTLLFLALDGHLVAIGVLVDSFRLWPIGSGVLDLPLM-GLVSRFAWIFASALML 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   ++ NI+ G+L++  P + ++ +  P  + +G L + LS   +  ++S   L 
Sbjct: 187 ALPSILAMLMVNITFGVLSRAAPSLNVFALGFPMSMLMGLLCVMLSFSGLPTRYSDICLD 246

Query: 246 GF 247
             
Sbjct: 247 AL 248


>gi|119503677|ref|ZP_01625760.1| flagellar biosynthetic protein FliR [marine gamma proteobacterium
           HTCC2080]
 gi|119460739|gb|EAW41831.1| flagellar biosynthetic protein FliR [marine gamma proteobacterium
           HTCC2080]
          Length = 257

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/233 (15%), Positives = 94/233 (40%), Gaps = 2/233 (0%)

Query: 15  IVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLVM 74
              RV + +++ P  S S + ++ R+  A+  + +  P +        F        + +
Sbjct: 19  PFLRVSAMLLIAPVFSASGVSVRFRVLLAVLIAALAAPIIPTPPTTDLFSANG--LLMAI 76

Query: 75  VELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGLL 134
            E+ +G   G ++++    + + G  +S  +GL    ++   + +    L+ +  I+  L
Sbjct: 77  REVGIGFAIGFVLQLVFGAIVYAGQAVSMTMGLGFAMAVDPQNGVQVPVLSQMYVILATL 136

Query: 135 ALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFYI 194
               ++ H  +   ++ SY  +P        +   +   +    F   + L+ P +   +
Sbjct: 137 LFLSLNGHLILIATVIDSYQILPANLSGIPVSSLGAVAALGSKVFASGISLALPAMAAML 196

Query: 195 VFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           + N++ G++ +  PQ+ I+ +  P  +  G   L +++  ++   S       
Sbjct: 197 MVNVTFGVITRTAPQLNIFAVGFPMTLMGGFFVLFINMPNLIAALSQFLDQAL 249


>gi|16125328|ref|NP_419892.1| flagellar biosynthesis protein FliR [Caulobacter crescentus CB15]
 gi|221234067|ref|YP_002516503.1| flagellar biosynthesis protein FliR [Caulobacter crescentus NA1000]
 gi|3023777|sp|Q45975|FLIR_CAUCR RecName: Full=Flagellar biosynthetic protein fliR
 gi|535424|gb|AAA66207.1| FliR [Caulobacter crescentus CB15]
 gi|13422378|gb|AAK23060.1| flagellar biosynthesis protein FliR [Caulobacter crescentus CB15]
 gi|220963239|gb|ACL94595.1| flagellar biosynthesis protein FliR [Caulobacter crescentus NA1000]
          Length = 251

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 60/234 (25%), Positives = 120/234 (51%), Gaps = 1/234 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  RVG+ +M +PG+    IP ++RL FA+  +++L P + +T+              V
Sbjct: 15  LVFARVGAMVMTMPGIGDQAIPARIRLSFALLMALILAPLVQNTVG-PIPSTLGGLGGAV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G ++R++   L   G +IS    L+   S   S   + T + + + ++GL
Sbjct: 74  IHEVLIGLMIGSVLRLFMTSLTTAGEIISMQTTLSFAQSTNPSMEGSSTAVATFLSMLGL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
             +   D HH    A+VKSY   P  + +   +  +  V  +  +F + ++L++P + F 
Sbjct: 134 TLVMATDLHHLFIAAIVKSYTIFPFTRAVPVNDAAALAVQTVAQSFSLGVQLAAPVIVFS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           +VFN++ GL+ +++P   I+F+++P  + LG   L LS+  I   ++  +    
Sbjct: 194 LVFNLATGLVGRIMPAFQIFFVASPLSVILGLSLLALSLSGIAMVWTDRYRELL 247


>gi|254503465|ref|ZP_05115616.1| Bacterial export protein, family 1 [Labrenzia alexandrii DFL-11]
 gi|222439536|gb|EEE46215.1| Bacterial export protein, family 1 [Labrenzia alexandrii DFL-11]
          Length = 258

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 125/239 (52%), Gaps = 1/239 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             ++++ FL+ CR+G+C+M++PG   + IPM+VRL  A   S+ L P L   I       
Sbjct: 13  SSLVLATFLLFCRIGACLMVIPGFGSNRIPMRVRLFVAFGISLALSPLLVPDIQQALPDE 72

Query: 66  RAYYS-KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPL 124
                   +  EL  G   G L R++   L+   +++S AIGL+    M I    A  P+
Sbjct: 73  ALGTVSFFIGAELLTGLFIGFLGRIFIAALETLTTLVSMAIGLSNMPGMPIDGVDALPPV 132

Query: 125 NSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLR 184
            +L  +     +++ D H ++   LV+SY  IP G+ L        F   L  TF++ LR
Sbjct: 133 ANLFTLTATAMIFIADQHWEILRGLVQSYEVIPPGRPLAAMASLEQFAEQLARTFVLALR 192

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           + SPF+ + IV N+++GL+NKL PQIP+YFIS P++I  G  FL L     +  F   +
Sbjct: 193 VVSPFIVYTIVVNLAVGLINKLTPQIPVYFISLPFVIAGGLYFLYLVAAEAIMIFLDGY 251


>gi|212709500|ref|ZP_03317628.1| hypothetical protein PROVALCAL_00542 [Providencia alcalifaciens DSM
           30120]
 gi|212687838|gb|EEB47366.1| hypothetical protein PROVALCAL_00542 [Providencia alcalifaciens DSM
           30120]
          Length = 259

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 53/240 (22%), Positives = 100/240 (41%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R  +     P  +      +VR+  A    +V+ P L  T      +  A
Sbjct: 12  WLSQGFYPFVRFLALFGTAPFFNEKQAISKVRIALAFFTVLVISPQLPITT---IPLFSA 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               + + ++ +G   GL +++    ++  G VI   +GL+  T    +       L  +
Sbjct: 69  MGLWVTVQQIVIGAAMGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +I LL     D H  + Y L  S+  +PI       + F  F+    T F+  L L+ 
Sbjct: 129 LNLITLLLFLSFDGHLWLIYILTNSFELLPIQTTPLHRDGFWIFLQFANTIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+  +++ N+S+G+LN++ PQ+ ++ +  P  + +G   L L I I+           F
Sbjct: 189 PFITLFLILNLSLGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISILPRYTERLIHQAF 248


>gi|323977869|gb|EGB72955.1| flagellar biosynthetic protein FliR [Escherichia coli TW10509]
          Length = 261

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|260853446|ref|YP_003227337.1| putative lateral flagellar export pore protein [Escherichia coli
           O26:H11 str. 11368]
 gi|300817292|ref|ZP_07097510.1| flagellar biosynthetic protein FliR [Escherichia coli MS 107-1]
 gi|307315218|ref|ZP_07594797.1| flagellar biosynthetic protein FliR [Escherichia coli W]
 gi|331666525|ref|ZP_08367399.1| flagellar biosynthetic protein FliR [Escherichia coli TA271]
 gi|257752095|dbj|BAI23597.1| predicted lateral flagellar export pore protein [Escherichia coli
           O26:H11 str. 11368]
 gi|300530268|gb|EFK51330.1| flagellar biosynthetic protein FliR [Escherichia coli MS 107-1]
 gi|306905399|gb|EFN35936.1| flagellar biosynthetic protein FliR [Escherichia coli W]
 gi|315059467|gb|ADT73794.1| Flagellar biosynthetic protein fliR [Escherichia coli W]
 gi|323158015|gb|EFZ44116.1| flagellar biosynthetic protein FliR [Escherichia coli EPECa14]
 gi|323171039|gb|EFZ56688.1| flagellar biosynthetic protein FliR [Escherichia coli LT-68]
 gi|323181525|gb|EFZ66945.1| flagellar biosynthetic protein FliR [Escherichia coli 1357]
 gi|323379975|gb|ADX52243.1| flagellar biosynthetic protein FliR [Escherichia coli KO11]
 gi|331065749|gb|EGI37633.1| flagellar biosynthetic protein FliR [Escherichia coli TA271]
          Length = 260

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   +        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|329888174|ref|ZP_08266772.1| flagellar biosynthetic protein FliR [Brevundimonas diminuta ATCC
           11568]
 gi|328846730|gb|EGF96292.1| flagellar biosynthetic protein FliR [Brevundimonas diminuta ATCC
           11568]
          Length = 256

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 62/237 (26%), Positives = 114/237 (48%), Gaps = 1/237 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + +  LI  RVG+ +MLLPG   SY+P +VRL  A+  S+ L P +  ++        A 
Sbjct: 10  VWAGGLIFARVGAILMLLPGFGESYVPPRVRLSLALVLSLALWPIVGASLPALPATLGAT 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               VM E+  G   G ++R +   L   G ++S    L    +     +   T L++ +
Sbjct: 70  -VGWVMREVLTGLAIGAILRSFMTALTTAGEIVSLQTTLGFSQTANPLQAQPGTTLSAFL 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++G+  ++  + HH     +V SY  I   + L   +     V  L  +FM+ ++L++P
Sbjct: 129 MLLGVTLVFATNTHHLFIGGMVGSYEAIAPAKPLIVSDFTQMAVKTLSQSFMLGVQLAAP 188

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            L F ++FN++ GL+ +++P   +YF + P  + LG     LS+ ++   F   +  
Sbjct: 189 VLVFALIFNLASGLVARVMPSFQVYFAAAPLSVILGLSVFTLSLGVVGTVFIDRYRS 245


>gi|300822280|ref|ZP_07102421.1| flagellar biosynthetic protein FliR [Escherichia coli MS 119-7]
 gi|300525163|gb|EFK46232.1| flagellar biosynthetic protein FliR [Escherichia coli MS 119-7]
 gi|309702239|emb|CBJ01556.1| flagellar biosynthesis protein FliR [Escherichia coli ETEC H10407]
 gi|323937220|gb|EGB33500.1| flagellar biosynthetic protein FliR [Escherichia coli E1520]
          Length = 261

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFSAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   L  ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLADTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|285018168|ref|YP_003375879.1| flagellar biosynthetic protein flir [Xanthomonas albilineans GPE
           PC73]
 gi|283473386|emb|CBA15891.1| probable flagellar biosynthetic protein flir [Xanthomonas
           albilineans]
          Length = 263

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 51/242 (21%), Positives = 92/242 (38%), Gaps = 3/242 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R+G+ +M++P +    IP ++R+  A   ++ L P L    D   F   
Sbjct: 16  AMIGAILWTMLRIGAMLMVMPLVGTRAIPARIRVILAATLAMALAPLLPPVPDWNGFD-- 73

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     V  EL +G   G ++R+        G +IS + GL           +    +  
Sbjct: 74  ATVVLSVARELAVGASMGFMLRMIFEAGAMAGEMISQSTGLGFAQMADPLRGVNSGVIGQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              +   L  +  + H  V   LV SY  +PIG  L       +   +   +     L L
Sbjct: 134 WFYLAFGLLFFTANGHLAVVALLVDSYKALPIGSALPDAQAMITVAPDFFMSMMRGALTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   +  N++ G L K  P +    I  P  + LG   L + +  +       F  
Sbjct: 194 ALPVIVAMLAVNLAFGALAKAAPALNPIQIGLPVAMVLGLALLAILVNEMGPPVQRLFDA 253

Query: 246 GF 247
            F
Sbjct: 254 AF 255


>gi|307293816|ref|ZP_07573660.1| flagellar biosynthetic protein FliR [Sphingobium chlorophenolicum
           L-1]
 gi|306879967|gb|EFN11184.1| flagellar biosynthetic protein FliR [Sphingobium chlorophenolicum
           L-1]
          Length = 260

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 42/242 (17%), Positives = 93/242 (38%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E+ +    + + R G+  +  P      +P+Q+RL  ++A  +  L  +   +      +
Sbjct: 10  EVQLWIWLIAMIRPGAAFIAAPVFGAPAVPLQLRLILSLALGMAALNSVHIVLPADGVAS 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV  E+  G   G  +++        G  I   +GLN    +  S   A   + 
Sbjct: 70  -FQGVMLVAGEVLAGLAIGFAVQIGYAAALVAGEAIGNTMGLNFAAMVDPSSGQATQAVG 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + I+    L  +D H  +   +V+SY  +P G  +   +     +          L +
Sbjct: 129 QFLSILSTFLLLAMDGHLMLVSFVVQSYQALPPGGAMLGNDAIWHLIEFGGALLGAGLTI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  ++  I +G+L +  P + ++ +  P  +  G + L ++  ++    + +   
Sbjct: 189 ALPVGFALVLVQIVMGMLARTAPALNLFSVGMPVALMAGLILLAVTAPVMGEGITAALKA 248

Query: 246 GF 247
           G 
Sbjct: 249 GL 250


>gi|299068760|emb|CBJ40000.1| FliR: flagellar biosynthesis inner membrane protein. fliR/mopE/spaR
           family [Ralstonia solanacearum CMR15]
          Length = 262

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  + + IP  +++ F +  ++ L P L     +      
Sbjct: 11  GWIALYWWPLVRVLAFIAVAPPFANTEIPTSIKVAFGVVLTVALAPMLPVPSGIAVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   G+ +++    +   G ++S  IGL   T +    + +   L  
Sbjct: 71  GLWITLL--QVAIGMALGVCVQMVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+      G  + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLMHALFDSFTALPVSAAPLAGGGWQTLAGGGAAVFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++  +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMVVNLAFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMNA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|218554530|ref|YP_002387443.1| flagellar biosynthesis protein FliR [Escherichia coli IAI1]
 gi|218689945|ref|YP_002398157.1| flagellar biosynthesis protein FliR [Escherichia coli ED1a]
 gi|301018200|ref|ZP_07182715.1| flagellar biosynthetic protein FliR [Escherichia coli MS 69-1]
 gi|301644591|ref|ZP_07244580.1| flagellar biosynthetic protein FliR [Escherichia coli MS 146-1]
 gi|218361298|emb|CAQ98882.1| flagellar export pore protein [Escherichia coli IAI1]
 gi|218427509|emb|CAR08404.2| flagellar export pore protein [Escherichia coli ED1a]
 gi|300399787|gb|EFJ83325.1| flagellar biosynthetic protein FliR [Escherichia coli MS 69-1]
 gi|301077066|gb|EFK91872.1| flagellar biosynthetic protein FliR [Escherichia coli MS 146-1]
          Length = 261

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|183598642|ref|ZP_02960135.1| hypothetical protein PROSTU_02046 [Providencia stuartii ATCC 25827]
 gi|188020825|gb|EDU58865.1| hypothetical protein PROSTU_02046 [Providencia stuartii ATCC 25827]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ +     P  +      +VR+  A    +++ P L     +   +  A
Sbjct: 12  WLSQGFYPFIRLLALFGTAPFFNEKQSITKVRVILAFFIILIVSPQLP---VVNIPLFSA 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +++ ++ +G   GL +++    ++  G VI   +GL+  T    +       L  +
Sbjct: 69  MGLWVIVQQIVIGVAIGLTMQMAFAAVRHAGEVIGLQMGLSFATFFDPTGGPNMPILGRI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + +I LL     D H  + Y L+ S+  IPI       + F S      + F+  L L+ 
Sbjct: 129 LNLIMLLLFLSFDGHLWLIYILIHSFELIPIQVSPLSRDGFWSLAQFASSIFINGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           PF+  +++ N+++G+LN++ PQ+ ++ +  P  + +G   L L I I+           F
Sbjct: 189 PFITLFLILNLALGILNRMTPQLSVFVVGFPLTLTIGISMLGLIISILPRYSERLIHQAF 248


>gi|16129897|ref|NP_416460.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89108782|ref|AP_002562.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|170081594|ref|YP_001730914.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238901155|ref|YP_002926951.1| flagellar export pore protein [Escherichia coli BW2952]
 gi|253773101|ref|YP_003035932.1| flagellar biosynthesis protein FliR [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|2506425|sp|P33135|FLIR_ECOLI RecName: Full=Flagellar biosynthetic protein fliR
 gi|1736616|dbj|BAA15775.1| flagellar export pore protein [Escherichia coli str. K12 substr.
           W3110]
 gi|1788261|gb|AAC75017.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|169889429|gb|ACB03136.1| flagellar export pore protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238861104|gb|ACR63102.1| flagellar export pore protein [Escherichia coli BW2952]
 gi|253324145|gb|ACT28747.1| flagellar biosynthetic protein FliR [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448937|gb|ACX39359.1| flagellar biosynthetic protein FliR [Escherichia coli DH1]
 gi|315136587|dbj|BAJ43746.1| flagellar biosynthesis protein FliR [Escherichia coli DH1]
          Length = 261

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLNLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|118589958|ref|ZP_01547362.1| flagellar biosynthesis protein [Stappia aggregata IAM 12614]
 gi|118437455|gb|EAV44092.1| flagellar biosynthesis protein [Stappia aggregata IAM 12614]
          Length = 258

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 129/243 (53%), Gaps = 1/243 (0%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
           +     +++++FL+ CR+G+C+M++PG   + +P+ VRL  A++ ++ L P L   +   
Sbjct: 9   STFSSSLLLAVFLLFCRIGACLMVIPGFGSNRVPVHVRLFIALSVALALSPLLAPGVQAS 68

Query: 62  NFVNR-AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               +    +  +  EL  G   G L R++   L+   +++S AIGL+    M I    +
Sbjct: 69  LPDEQLGTVAGFIGAELLTGAFIGFLGRIFLAALETLTTLVSMAIGLSNMPGMPIDGVDS 128

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
             P+ +L  +     +++ + H ++   L  SY  IP+GQ L        F   L  TF+
Sbjct: 129 LPPVANLFTVTATAMVFITNQHWEILRGLAASYEAIPVGQPLAAVTGLEQFAEQLAKTFL 188

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + LR+ SPF+ + +V N ++GL+NKL PQIP+YFIS P++I  G  FL L I   +  F 
Sbjct: 189 LALRVCSPFIVYTVVVNFAVGLVNKLTPQIPVYFISMPFVIAGGLYFLYLVIAEAIMIFL 248

Query: 241 HSF 243
             +
Sbjct: 249 DGY 251


>gi|91223203|ref|ZP_01258469.1| putative flagellar biosynthetic protein FliR [Vibrio alginolyticus
           12G01]
 gi|91192016|gb|EAS78279.1| putative flagellar biosynthetic protein FliR [Vibrio alginolyticus
           12G01]
          Length = 258

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 102/237 (43%), Gaps = 3/237 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             I+  L+    RVG+  + +P    + IP+ VR   A++  ++  P +     ++ F  
Sbjct: 9   SAILGQLWWPFFRVGAVFISMPFFGDAIIPVWVRTLLALSIVVITGPLMPPMPQVELFSM 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            + +  L   +   G + GL++ +        G VIS  +GL +       + L+   L 
Sbjct: 69  TSLF--LAFEQAIWGVMFGLILHMLFNVFTMLGQVISLQMGLGMAMMNDPINGLSVAILG 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            +  I   L    ++ H  V   +++S+   P+G  +         VN+    F   L L
Sbjct: 127 RIFLIFSTLLFLALEGHLLVIDIVIQSFVVWPVGSGI-TSLSLQGVVNIFGWMFASSLAL 185

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P +   ++ NIS G++N+  P + +Y +  P  + LG   + +S+  +  +++  
Sbjct: 186 ALPAIVSMLLANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVSGVPGRYTAL 242


>gi|124265770|ref|YP_001019774.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
 gi|124258545|gb|ABM93539.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
          Length = 256

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/244 (19%), Positives = 103/244 (42%), Gaps = 5/244 (2%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +  +     RV +  +  P LSM  +P++V++  A   +I     L     +   ++ 
Sbjct: 11  AWLSPMVWPFLRVLALFISAPVLSMRSVPVRVKVALAFFITIAAQASLPPMPVIA--LDS 68

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A   + V+ +L +G   G   R+   G++F G +I   +GLN         +   T ++ 
Sbjct: 69  AQAFEAVIQQLVIGLALGFSARIVMAGIEFAGEMIGLQMGLNFAAFFDPISASQSTAVSR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVN---MLQTTFMIML 183
             G        V++ H  +  A+++S+   P+         F S +         F + L
Sbjct: 129 FFGTSAAWLFVVMNGHLLLTAAVIQSFHAFPVATPEAAPLAFLSALQPQLWGAEVFRLGL 188

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
            ++ P +   +  N+ +GL++++  QI I+ I  P  +G+G + + L++  +   F+ + 
Sbjct: 189 WIALPIITMLLFMNLVLGLISRVASQINIFAIGFPITLGVGLVGITLTLPFMEQPFTMAL 248

Query: 244 LYGF 247
               
Sbjct: 249 ERML 252


>gi|194429944|ref|ZP_03062454.1| flagellar biosynthetic protein FliR [Escherichia coli B171]
 gi|194412033|gb|EDX28345.1| flagellar biosynthetic protein FliR [Escherichia coli B171]
 gi|323158571|gb|EFZ44585.1| flagellar biosynthetic protein FliR [Escherichia coli E128010]
          Length = 261

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 105/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +     +  F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGRLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|114566402|ref|YP_753556.1| flagellar biosynthetic protein FliR [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337337|gb|ABI68185.1| flagellar biosynthetic protein FliR [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 253

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 105/239 (43%), Gaps = 1/239 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + S F ++ R+    +  P  S   +P +VR    +  +  L  F+      +N      
Sbjct: 5   LESFFFLLARLSGLFITAPIFSSRMMPGRVRALIVIMLAATLAYFVPVEYS-RNINTPGL 63

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   + VE+F+G   G +I      +Q +G ++   +G ++   +          + +  
Sbjct: 64  FIAALAVEIFIGYTIGFVIYAVLATIQLSGQLMDMLMGFSIVNVVDPQSGTQIPLMGNFT 123

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + LL    ID HH +  AL +SY  +P+      G      V +    F++ +++++P
Sbjct: 124 QALALLTYLAIDGHHYLLQALAQSYAIVPVMSAHLPGGFLELLVEVGTYIFVVAVKIAAP 183

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   +  ++++G + + VPQ+ ++ +  P  I LG + L L + I ++ ++  F   F
Sbjct: 184 MLVAILTSDVAMGFIARTVPQMNVFLVGLPLKIFLGLITLLLLLPIYLWVYNVLFAEFF 242


>gi|327254529|gb|EGE66145.1| flagellar biosynthetic protein FliR [Escherichia coli STEC_7v]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLIFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|306813327|ref|ZP_07447520.1| flagellar biosynthetic protein FliR [Escherichia coli NC101]
 gi|305854090|gb|EFM54529.1| flagellar biosynthetic protein FliR [Escherichia coli NC101]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 98/235 (41%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S +  +VR+  ++A +I++ P +   +        +
Sbjct: 12  LALGLWFPFVRIMAFLRYMPVLDNSALTARVRIILSLALAIIITPLIPHPVPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|218703504|ref|YP_002411023.1| Flagellar biosynthetic protein fliR [Escherichia coli UMN026]
 gi|293403335|ref|ZP_06647426.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298378946|ref|ZP_06988827.1| flagellar biosynthetic protein FliR [Escherichia coli FVEC1302]
 gi|300898062|ref|ZP_07116431.1| flagellar biosynthetic protein FliR [Escherichia coli MS 198-1]
 gi|59889760|emb|CAH19115.1| Lateral flagellar export/assembly protein (FliR-like) [Escherichia
           coli]
 gi|218430601|emb|CAR11467.1| Flagellar biosynthetic protein fliR [Escherichia coli UMN026]
 gi|284920024|emb|CBG33080.1| flagellar biosynthetic protein [Escherichia coli 042]
 gi|291429188|gb|EFF02208.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gi|298280059|gb|EFI21563.1| flagellar biosynthetic protein FliR [Escherichia coli FVEC1302]
 gi|300358240|gb|EFJ74110.1| flagellar biosynthetic protein FliR [Escherichia coli MS 198-1]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 100/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  + +G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLVGLVCFATLLYNLPDHYLHL 243


>gi|82543589|ref|YP_407536.1| flagellar biosynthesis protein FliR [Shigella boydii Sb227]
 gi|81245000|gb|ABB65708.1| flagellar biosynthesis [Shigella boydii Sb227]
 gi|332096912|gb|EGJ01901.1| flagellar biosynthetic protein FliR [Shigella boydii 3594-74]
          Length = 261

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 105/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  + V+ P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFVIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|261313959|ref|ZP_05953156.1| LOW QUALITY PROTEIN: flagellar biosynthetic protein FliR [Brucella
           pinnipedialis M163/99/10]
 gi|261302985|gb|EEY06482.1| LOW QUALITY PROTEIN: flagellar biosynthetic protein FliR [Brucella
           pinnipedialis M163/99/10]
          Length = 255

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 73/219 (33%), Positives = 128/219 (58%), Gaps = 1/219 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +    +   +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L 
Sbjct: 70  PWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLG 224
           ++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGEG 228


>gi|323975951|gb|EGB71045.1| flagellar biosynthetic protein FliR [Escherichia coli TW10509]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/235 (20%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + M+VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTMRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHM 243


>gi|254478864|ref|ZP_05092228.1| flagellar biosynthetic protein FliR [Carboxydibrachium pacificum
           DSM 12653]
 gi|214035177|gb|EEB75887.1| flagellar biosynthetic protein FliR [Carboxydibrachium pacificum
           DSM 12653]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 101/236 (42%), Gaps = 3/236 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L+  R+    +L P     ++P   ++      S+++   +   +   +  N   
Sbjct: 11  VQVFILLFVRMLGIFILAPFFGTKHVPTVFKIGLGFFTSLIVFDVMP--LVPISIDNVLT 68

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  LV+ E  +G   GL   +    +   G +I   +G  L   + I        + + I
Sbjct: 69  YFLLVISEFLVGLTIGLASMISFSAVYLAGQLIDYQLGFGLVNILDIHSEAQVPLMGNFI 128

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSS 187
            I+ +L   +++ H+ +F  L KS   IPIG+   +   +      M+   F I  R+S+
Sbjct: 129 YIMTILIFMLMNGHYLLFTFLAKSTEIIPIGKVYFDLSGMSQVLTKMVSDMFAIGFRISA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           P +   ++ ++ +G++++ +PQ+ ++ +  P  + +G   L + + + +      F
Sbjct: 189 PIILTTVLTDLILGIISRTIPQLNVFMVGMPAKVFVGIFTLIIMLPMYLTIVDFIF 244


>gi|17548594|ref|NP_521934.1| flagellar biosynthetic fliR transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|17430842|emb|CAD17524.1| probable flagellar biosynthetic flir transmembrane protein
           [Ralstonia solanacearum GMI1000]
          Length = 262

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 97/241 (40%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   +  + RV + I + P  + + IP  +++ F +  ++ L P L     +      
Sbjct: 11  GWIALYWWPLVRVLAFIAVAPPFANTEIPTSIKVAFGVVLTVALAPMLPVPAGISVGSYE 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             +  L+  ++ +G   G+ +++    +   G ++S  IGL   T +    + +   L  
Sbjct: 71  GLWITLL--QVAIGMALGVCVQMVFAAISGAGELMSIQIGLGFATLLDPQQTESSLLLGR 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            I +  + A    D H  + +AL  S+  +P+      G  + +        F + +R++
Sbjct: 129 FISLTAITAFIAGDGHLVLMHALFDSFTVLPVSAAPLAGGGWQTLAGGGAAVFALAVRIA 188

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +V N++  +L++    +  + +     + +G + + + +  +      S +  
Sbjct: 189 LPIIAIMMVVNLAFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPVVERSVMNA 248

Query: 247 F 247
            
Sbjct: 249 L 249


>gi|307636862|gb|ADN79312.1| flagellar biosynthesis protein [Helicobacter pylori 908]
 gi|325995451|gb|ADZ50856.1| Flagellar biosynthesis protein [Helicobacter pylori 2018]
 gi|325997049|gb|ADZ49257.1| Flagellar biosynthesis protein [Helicobacter pylori 2017]
          Length = 255

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNATYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKDEISLAF 248


>gi|294013057|ref|YP_003546517.1| flagellar biosynthetic protein FliR [Sphingobium japonicum UT26S]
 gi|292676387|dbj|BAI97905.1| flagellar biosynthetic protein FliR [Sphingobium japonicum UT26S]
          Length = 260

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/242 (17%), Positives = 93/242 (38%), Gaps = 1/242 (0%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E+ +    + + R G+  +  P      +P+Q+RL  ++A  +  L  +   +      +
Sbjct: 10  EVQLWIWLIAMIRPGAAFIAAPVFGAPAVPLQLRLILSLALGMAALNSVHIVLPADGVAS 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                 LV  E+  G   G  +++        G  I   +GLN    +  S   A   + 
Sbjct: 70  -FQGVMLVAGEVLAGLAIGFAVQIGYAAALVAGEAIGNTMGLNFAAMVDPSSGQATQAVG 128

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
             + I+    L  +D H  +   +V+SY  +P G  +   +     +          + +
Sbjct: 129 QFLSILSTFLLLAMDGHLMLVSFVVQSYQALPPGGAMLSNDAVWHLIEFGGALLGAGVTI 188

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P  F  ++  I +G+L +  P + ++ +  P  +  G + L ++  I+    + +   
Sbjct: 189 ALPVGFALVLVQIVMGMLARTAPALNLFSVGMPVALMAGLILLAVTAPIMGEGITAALKA 248

Query: 246 GF 247
           G 
Sbjct: 249 GL 250


>gi|192359985|ref|YP_001982206.1| flagellar biosynthetic protein FliR [Cellvibrio japonicus Ueda107]
 gi|190686150|gb|ACE83828.1| flagellar biosynthetic protein FliR [Cellvibrio japonicus Ueda107]
          Length = 261

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 92/240 (38%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +      + R+G+    +P +    +P ++RL   +    +L+P L     +      
Sbjct: 13  QFIGQYIWPMLRIGAFYFAVPVIGARTVPARIRLILMLLTVFLLVPVLPPAPVVSLLSLA 72

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L+  E+ +G   G  ++V        G  I+  +GL        S  ++ T L+ 
Sbjct: 73  G--LMLIAQEVLIGLALGFTMQVVLHVFVLAGQYIAMKMGLGFAAMNDPSSGVSVTVLSQ 130

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              ++  L     + H  V   ++ S+   PIG +    + +   V M    F   L ++
Sbjct: 131 FYLLLSTLLFLSTNGHLVVLQLMIDSFRFFPIGGDGISTSAYMVIVQMGSWMFSAALLIA 190

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P     ++ N+S G++++  PQ+ ++ +  P  +  G   +  S+   +  +      G
Sbjct: 191 LPLFTSLMIVNMSFGVMSRAAPQMNVFTVGFPITLVFGLALMYFSLGNFLPLYMELMEEG 250


>gi|162147443|ref|YP_001601904.1| flagellar biosynthetic protein fliR [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786020|emb|CAP55602.1| putative flagellar biosynthetic protein fliR [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 270

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/238 (21%), Positives = 107/238 (44%), Gaps = 3/238 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD---TIDLQNF 63
           ++     +++CRV + +M  PGL  +  PM+VR   A++ ++ +LP + D    +     
Sbjct: 14  VLATMFLVVLCRVSALVMAAPGLGETTSPMRVRAGIAVSATVAILPVVQDRLVEVSGTAL 73

Query: 64  VNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETP 123
              +    +V+ EL  G   G L R+ T+ +     V++   GL            + T 
Sbjct: 74  RMPSVAIAVVVGELLCGVFIGWLARLVTMAISIAMQVVAVFTGLASVLQPDSELGASSTA 133

Query: 124 LNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIML 183
           ++ +  ++  +       +     A+  SY   P G     G++  S       TF + L
Sbjct: 134 ISHMASMLIPVIFLSTGLYALPLAAITGSYSLFPPGHMPMVGDMARSVTEATSQTFALAL 193

Query: 184 RLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           +L++PF+    ++   +G+LN+L+P I +Y I+ P  +  G + L + I+++   +  
Sbjct: 194 QLAAPFVLIGTLWPAMLGVLNRLLPSIQVYSIAMPAQLLGGVILLAMLIQVMTGVWQE 251


>gi|300940405|ref|ZP_07154990.1| flagellar biosynthetic protein FliR [Escherichia coli MS 21-1]
 gi|306814227|ref|ZP_07448393.1| flagellar biosynthesis protein FliR [Escherichia coli NC101]
 gi|331657996|ref|ZP_08358958.1| flagellar biosynthetic protein FliR [Escherichia coli TA206]
 gi|300454799|gb|EFK18292.1| flagellar biosynthetic protein FliR [Escherichia coli MS 21-1]
 gi|305852386|gb|EFM52837.1| flagellar biosynthesis protein FliR [Escherichia coli NC101]
 gi|331056244|gb|EGI28253.1| flagellar biosynthetic protein FliR [Escherichia coli TA206]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|268679050|ref|YP_003303481.1| flagellar biosynthetic protein FliR [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268617081|gb|ACZ11446.1| flagellar biosynthetic protein FliR [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 257

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
           E  ++  FL+  R+       P  S + IP+ ++        + L P L         +N
Sbjct: 10  EHHVILFFLLFARLSGVFAFFPFFSHANIPLSIKTSITFFMVVFLFPLLSPLHVTPTLLN 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
               +  ++ EL +G + GL + +    LQ  G  IS  +G  + + +    S +   L+
Sbjct: 70  ---LTLAIVSELLIGFIAGLFLTIALSILQMAGMQISFVMGFTMASVVDPQTSTSIPVLS 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            +  +IGL+ +   + HHQ+   +V S   +P+G      ++    +      F+    L
Sbjct: 127 QIFSLIGLMIVLAFNGHHQMLLFIVDSLSLLPLGTFYPEMSVVGYILKATTGMFVYGFIL 186

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           S P L F ++ ++  G+L K +PQ  +  +  P  I +  + + +++   +  F   F+ 
Sbjct: 187 SFPVLAFSLLMDVVFGMLMKTMPQFNLLVVGFPIRIAVSLVVIIVTLASTMLLFKREFME 246

Query: 246 G 246
            
Sbjct: 247 A 247


>gi|26248219|ref|NP_754259.1| flagellar biosynthesis protein FliR [Escherichia coli CFT073]
 gi|110642056|ref|YP_669786.1| flagellar biosynthesis protein FliR [Escherichia coli 536]
 gi|191173327|ref|ZP_03034857.1| flagellar biosynthetic protein FliR [Escherichia coli F11]
 gi|215487150|ref|YP_002329581.1| flagellar biosynthesis protein FliR [Escherichia coli O127:H6 str.
           E2348/69]
 gi|227885621|ref|ZP_04003426.1| flagellar biosynthesis protein FliR [Escherichia coli 83972]
 gi|237705909|ref|ZP_04536390.1| flagellar biosynthetic protein fliR [Escherichia sp. 3_2_53FAA]
 gi|300975535|ref|ZP_07173046.1| flagellar biosynthetic protein FliR [Escherichia coli MS 45-1]
 gi|300994265|ref|ZP_07180817.1| flagellar biosynthetic protein FliR [Escherichia coli MS 200-1]
 gi|301050689|ref|ZP_07197550.1| flagellar biosynthetic protein FliR [Escherichia coli MS 185-1]
 gi|312967147|ref|ZP_07781365.1| flagellar biosynthetic protein FliR [Escherichia coli 2362-75]
 gi|331647544|ref|ZP_08348636.1| flagellar biosynthetic protein FliR [Escherichia coli M605]
 gi|26108623|gb|AAN80826.1|AE016762_79 Flagellar biosynthetic protein fliR [Escherichia coli CFT073]
 gi|110343648|gb|ABG69885.1| flagellar biosynthetic protein FliR [Escherichia coli 536]
 gi|190906444|gb|EDV66053.1| flagellar biosynthetic protein FliR [Escherichia coli F11]
 gi|215265222|emb|CAS09612.1| flagellar export pore protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|222033689|emb|CAP76430.1| flagellar biosynthetic protein fliR [Escherichia coli LF82]
 gi|226900666|gb|EEH86925.1| flagellar biosynthetic protein fliR [Escherichia sp. 3_2_53FAA]
 gi|227837194|gb|EEJ47660.1| flagellar biosynthesis protein FliR [Escherichia coli 83972]
 gi|281179012|dbj|BAI55342.1| flagellar biosynthetic protein FliR [Escherichia coli SE15]
 gi|300297612|gb|EFJ53997.1| flagellar biosynthetic protein FliR [Escherichia coli MS 185-1]
 gi|300304930|gb|EFJ59450.1| flagellar biosynthetic protein FliR [Escherichia coli MS 200-1]
 gi|300410304|gb|EFJ93842.1| flagellar biosynthetic protein FliR [Escherichia coli MS 45-1]
 gi|307553963|gb|ADN46738.1| flagellar biosynthetic protein FliR [Escherichia coli ABU 83972]
 gi|312288611|gb|EFR16513.1| flagellar biosynthetic protein FliR [Escherichia coli 2362-75]
 gi|312946543|gb|ADR27370.1| flagellar biosynthesis protein FliR [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315286654|gb|EFU46087.1| flagellar biosynthetic protein FliR [Escherichia coli MS 110-3]
 gi|315290267|gb|EFU49645.1| flagellar biosynthetic protein FliR [Escherichia coli MS 153-1]
 gi|315296484|gb|EFU55781.1| flagellar biosynthetic protein FliR [Escherichia coli MS 16-3]
 gi|323186706|gb|EFZ72028.1| flagellar biosynthetic protein FliR [Escherichia coli RN587/1]
 gi|323956346|gb|EGB52089.1| flagellar biosynthetic protein FliR [Escherichia coli H263]
 gi|324005851|gb|EGB75070.1| flagellar biosynthetic protein FliR [Escherichia coli MS 57-2]
 gi|324013505|gb|EGB82724.1| flagellar biosynthetic protein FliR [Escherichia coli MS 60-1]
 gi|330911756|gb|EGH40266.1| flagellar biosynthesis protein FliR [Escherichia coli AA86]
 gi|331043268|gb|EGI15406.1| flagellar biosynthetic protein FliR [Escherichia coli M605]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +     L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPGSHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGSEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|317010452|gb|ADU84199.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           SouthAfrica7]
          Length = 255

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +       +   +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLDFSNATYTPES---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGAQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKDEISSAF 248


>gi|260466592|ref|ZP_05812780.1| flagellar biosynthetic protein FliR [Mesorhizobium opportunistum
           WSM2075]
 gi|259029598|gb|EEW30886.1| flagellar biosynthetic protein FliR [Mesorhizobium opportunistum
           WSM2075]
          Length = 250

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 85/245 (34%), Positives = 136/245 (55%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M++  + ++++ FL  CR+G+C ML+PGLS + +P+QVRL  A+A +  LL FLWD I  
Sbjct: 1   MSVLSQSVVIAAFLAFCRIGACFMLMPGLSSARVPVQVRLFVAVAATGGLLAFLWDKIFP 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
                      +++ EL +G + G + R+Y   L+F GS I+  IG        I +   
Sbjct: 61  FVDARPQILVPMIISELLVGGLIGAMTRLYMEALRFMGSAIAMLIGYGGSGGPAIEEPEP 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  L ++I    LL L+V DF H++  ALV SY   P+    N         + +  TF 
Sbjct: 121 QAALAAIISFSALLMLFVFDFDHEIIRALVTSYTVAPVNIFFNPQAALVDVADTVSDTFF 180

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           +++RL SPF+ + ++ N++IG +NKL PQIPIYFIS P++I  G +    +I  ++  F 
Sbjct: 181 LVIRLGSPFVAYALLVNLTIGFVNKLTPQIPIYFISQPFVIVGGMIIFYFAIGTMLSLFV 240

Query: 241 HSFLY 245
             F+ 
Sbjct: 241 DGFVD 245


>gi|293410306|ref|ZP_06653882.1| flagellar biosynthetic protein FliR [Escherichia coli B354]
 gi|331663446|ref|ZP_08364356.1| flagellar biosynthetic protein FliR [Escherichia coli TA143]
 gi|291470774|gb|EFF13258.1| flagellar biosynthetic protein FliR [Escherichia coli B354]
 gi|331059245|gb|EGI31222.1| flagellar biosynthetic protein FliR [Escherichia coli TA143]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|218887106|ref|YP_002436427.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758060|gb|ACL08959.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 264

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 103/237 (43%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M+S  L   RV   + LLP       P QV+    + F++ L P +      Q   + 
Sbjct: 9   ASMLSFLLTFMRVSLVLFLLPFFGGEAAPTQVKAALCLVFTLALWPHV-SLPGGQMPTHP 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L+  EL +G + G+ +     G+Q  G V++T +G  + T          +  + 
Sbjct: 68  FSLIVLLAGELIMGLMLGMTVHFLFAGIQTGGQVLATQMGFTMITLADPLTGANVSITSH 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L+  V+D H  +  A V+++  +P G  L    +    + +  + F++ ++++
Sbjct: 128 FLYMVAMLSFLVLDGHLYMLRAFVRTFELVPAGGLLLTPMLVKEVLALSGSMFVLAVKIA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           +P L    +  +++ L+ +  PQ+ +  I  P  I +G  F+ +   I+  +     
Sbjct: 188 APVLVSLFLVELALALMARAAPQMNLLMIGFPLKIAVGFFFIGMLFTIMADKIREFI 244


>gi|256017857|ref|ZP_05431722.1| flagellar biosynthesis protein FliR [Shigella sp. D9]
 gi|293446330|ref|ZP_06662752.1| flagellar biosynthetic protein FliR [Escherichia coli B088]
 gi|332278883|ref|ZP_08391296.1| flagellar biosynthetic protein FliR [Shigella sp. D9]
 gi|291323160|gb|EFE62588.1| flagellar biosynthetic protein FliR [Escherichia coli B088]
 gi|332101235|gb|EGJ04581.1| flagellar biosynthetic protein FliR [Shigella sp. D9]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLTLLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|301646789|ref|ZP_07246643.1| flagellar biosynthetic protein FliR [Escherichia coli MS 146-1]
 gi|307136836|ref|ZP_07496192.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
 gi|301075024|gb|EFK89830.1| flagellar biosynthetic protein FliR [Escherichia coli MS 146-1]
 gi|315616849|gb|EFU97466.1| flagellar biosynthetic protein FliR [Escherichia coli 3431]
          Length = 260

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|347245|gb|AAC36861.1| fliR [Escherichia coli]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLNLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLAVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|91211168|ref|YP_541154.1| flagellar biosynthesis protein FliR [Escherichia coli UTI89]
 gi|117624090|ref|YP_853003.1| flagellar biosynthesis protein FliR [Escherichia coli APEC O1]
 gi|170679575|ref|YP_001743295.1| flagellar biosynthesis protein FliR [Escherichia coli SMS-3-5]
 gi|191168278|ref|ZP_03030071.1| flagellar biosynthetic protein FliR [Escherichia coli B7A]
 gi|193066372|ref|ZP_03047420.1| flagellar biosynthetic protein FliR [Escherichia coli E22]
 gi|194439589|ref|ZP_03071662.1| flagellar biosynthetic protein FliR [Escherichia coli 101-1]
 gi|209919372|ref|YP_002293456.1| flagellar biosynthesis protein FliR [Escherichia coli SE11]
 gi|218558807|ref|YP_002391720.1| flagellar biosynthesis protein FliR [Escherichia coli S88]
 gi|218705443|ref|YP_002412962.1| flagellar biosynthesis protein FliR [Escherichia coli UMN026]
 gi|260844349|ref|YP_003222127.1| flagellar export pore protein FliR [Escherichia coli O103:H2 str.
           12009]
 gi|293405433|ref|ZP_06649425.1| flagellar biosynthetic protein fliR [Escherichia coli FVEC1412]
 gi|298381077|ref|ZP_06990676.1| flagellar biosynthetic protein FliR [Escherichia coli FVEC1302]
 gi|300899207|ref|ZP_07117483.1| flagellar biosynthetic protein FliR [Escherichia coli MS 198-1]
 gi|300923887|ref|ZP_07139902.1| flagellar biosynthetic protein FliR [Escherichia coli MS 182-1]
 gi|300931163|ref|ZP_07146510.1| flagellar biosynthetic protein FliR [Escherichia coli MS 187-1]
 gi|301327737|ref|ZP_07220942.1| flagellar biosynthetic protein FliR [Escherichia coli MS 78-1]
 gi|307312464|ref|ZP_07592098.1| flagellar biosynthetic protein FliR [Escherichia coli W]
 gi|331673463|ref|ZP_08374231.1| flagellar biosynthetic protein FliR [Escherichia coli TA280]
 gi|91072742|gb|ABE07623.1| flagellar biosynthetic protein FliR [Escherichia coli UTI89]
 gi|115513214|gb|ABJ01289.1| flagellar biosynthetic protein FliR [Escherichia coli APEC O1]
 gi|170517293|gb|ACB15471.1| flagellar biosynthetic protein FliR [Escherichia coli SMS-3-5]
 gi|190901650|gb|EDV61406.1| flagellar biosynthetic protein FliR [Escherichia coli B7A]
 gi|192925957|gb|EDV80603.1| flagellar biosynthetic protein FliR [Escherichia coli E22]
 gi|194421498|gb|EDX37512.1| flagellar biosynthetic protein FliR [Escherichia coli 101-1]
 gi|209912631|dbj|BAG77705.1| flagellar biosynthetic protein FliR [Escherichia coli SE11]
 gi|218365576|emb|CAR03303.1| flagellar export pore protein [Escherichia coli S88]
 gi|218432540|emb|CAR13433.1| flagellar export pore protein [Escherichia coli UMN026]
 gi|257759496|dbj|BAI30993.1| flagellar export pore protein FliR [Escherichia coli O103:H2 str.
           12009]
 gi|284921858|emb|CBG34933.1| flagellar biosynthesis protein FliR [Escherichia coli 042]
 gi|291427641|gb|EFF00668.1| flagellar biosynthetic protein fliR [Escherichia coli FVEC1412]
 gi|294491448|gb|ADE90204.1| flagellar biosynthetic protein FliR [Escherichia coli IHE3034]
 gi|298278519|gb|EFI20033.1| flagellar biosynthetic protein FliR [Escherichia coli FVEC1302]
 gi|300357188|gb|EFJ73058.1| flagellar biosynthetic protein FliR [Escherichia coli MS 198-1]
 gi|300419850|gb|EFK03161.1| flagellar biosynthetic protein FliR [Escherichia coli MS 182-1]
 gi|300461020|gb|EFK24513.1| flagellar biosynthetic protein FliR [Escherichia coli MS 187-1]
 gi|300845737|gb|EFK73497.1| flagellar biosynthetic protein FliR [Escherichia coli MS 78-1]
 gi|306907635|gb|EFN38138.1| flagellar biosynthetic protein FliR [Escherichia coli W]
 gi|307626574|gb|ADN70878.1| flagellar biosynthesis protein FliR [Escherichia coli UM146]
 gi|315061250|gb|ADT75577.1| flagellar export pore protein [Escherichia coli W]
 gi|320194337|gb|EFW68968.1| Flagellar biosynthesis protein FliR [Escherichia coli WV_060327]
 gi|320198641|gb|EFW73241.1| Flagellar biosynthesis protein FliR [Escherichia coli EC4100B]
 gi|323183934|gb|EFZ69321.1| flagellar biosynthetic protein FliR [Escherichia coli 1357]
 gi|323378173|gb|ADX50441.1| flagellar biosynthetic protein FliR [Escherichia coli KO11]
 gi|323948346|gb|EGB44333.1| flagellar biosynthetic protein FliR [Escherichia coli H120]
 gi|323952443|gb|EGB48316.1| flagellar biosynthetic protein FliR [Escherichia coli H252]
 gi|323961994|gb|EGB57593.1| flagellar biosynthetic protein FliR [Escherichia coli H489]
 gi|323972750|gb|EGB67950.1| flagellar biosynthetic protein FliR [Escherichia coli TA007]
 gi|324118999|gb|EGC12888.1| flagellar biosynthetic protein FliR [Escherichia coli E1167]
 gi|331069661|gb|EGI41048.1| flagellar biosynthetic protein FliR [Escherichia coli TA280]
 gi|332343676|gb|AEE57010.1| flagellar biosynthetic protein FliR [Escherichia coli UMNK88]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|300951575|ref|ZP_07165408.1| flagellar biosynthetic protein FliR [Escherichia coli MS 116-1]
 gi|300956534|ref|ZP_07168816.1| flagellar biosynthetic protein FliR [Escherichia coli MS 175-1]
 gi|300316634|gb|EFJ66418.1| flagellar biosynthetic protein FliR [Escherichia coli MS 175-1]
 gi|300449202|gb|EFK12822.1| flagellar biosynthetic protein FliR [Escherichia coli MS 116-1]
 gi|323940391|gb|EGB36582.1| flagellar biosynthetic protein FliR [Escherichia coli E482]
 gi|332093093|gb|EGI98157.1| flagellar biosynthetic protein FliR [Shigella boydii 5216-82]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGVALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|293395591|ref|ZP_06639874.1| flagellar biosynthetic protein FliR [Serratia odorifera DSM 4582]
 gi|291421910|gb|EFE95156.1| flagellar biosynthetic protein FliR [Serratia odorifera DSM 4582]
          Length = 260

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + +   F  + RV + I   P  S   I  +V++       +++ P L         +  
Sbjct: 11  VWLSQYFWPLLRVLALIASAPVFSEKQISKKVKIGLGGLIVLLVAPSLPAN---NIAIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L M ++ +G   GL ++     ++  G VI   +GL+  T    S       L  
Sbjct: 68  ASGLWLAMQQILIGVALGLTMQFAFAAVRTAGEVIGMQMGLSFATFFDPSGGPNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ ++ LL     D H  +   L  S+ T+PI  +   GN F +        F+  L L+
Sbjct: 128 LLNLLALLLFLAFDGHLWLISLLADSFHTLPIQAQPLNGNGFLALTQAGSLIFINGLMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+S+GLLN++ PQ+ ++ I  P  + +G L L L + ++     H F   
Sbjct: 188 LPLICLLLTLNLSLGLLNRVTPQLSVFVIGFPVTMTIGILTLGLMMPMLAPFCEHLFGDV 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|240137265|ref|YP_002961734.1| Flagellar biosynthesis protein FliR [Methylobacterium extorquens
           AM1]
 gi|240007231|gb|ACS38457.1| Flagellar biosynthesis protein FliR [Methylobacterium extorquens
           AM1]
          Length = 256

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 65/236 (27%), Positives = 113/236 (47%), Gaps = 1/236 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV-NRA 67
            + +FLI CR+G C++++PG S   +P QVRL  A   S+ + P L      +       
Sbjct: 14  FLGVFLIFCRIGGCLLIVPGFSSPRVPAQVRLLIAGGVSLAVTPLLLPLFQTKLLGQAPT 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
                +  E   G + GLL R++   L+   + +ST +G        +  + A   + SL
Sbjct: 74  ETLTWIASETVTGLLIGLLGRIFVFVLETVMNAVSTMVGFGSMPGTPVEGTDAIPAVESL 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I    +  ++  D H ++F  LV SYG IP G+            + +   F + LR+++
Sbjct: 134 IVFTAVALMFAADLHWELFRGLVDSYGRIPPGEGFGTQTALVRIADQIAEAFTLALRIAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           PF+ + +  N++ G +NKL P IP+YF++TP+++    L L       + QF   +
Sbjct: 194 PFIIYAVAVNLAAGFVNKLTPTIPVYFVATPFVMFGALLLLYTLSSEFMTQFLSGY 249


>gi|15802385|ref|NP_288411.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H7
           EDL933]
 gi|15831943|ref|NP_310716.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           Sakai]
 gi|168751879|ref|ZP_02776901.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758264|ref|ZP_02783271.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764424|ref|ZP_02789431.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771557|ref|ZP_02796564.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777377|ref|ZP_02802384.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783347|ref|ZP_02808354.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790290|ref|ZP_02815297.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC869]
 gi|168802297|ref|ZP_02827304.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC508]
 gi|195939256|ref|ZP_03084638.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           EC4024]
 gi|208810191|ref|ZP_03252067.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816620|ref|ZP_03257740.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820873|ref|ZP_03261193.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4042]
 gi|209399396|ref|YP_002271067.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328658|ref|ZP_03444739.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793600|ref|YP_003078437.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           TW14359]
 gi|260868543|ref|YP_003234945.1| flagellar export pore protein FliR [Escherichia coli O111:H- str.
           11128]
 gi|261227555|ref|ZP_05941836.1| flagellar export pore protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254621|ref|ZP_05947154.1| flagellar export pore protein FliR [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283127|ref|YP_003499945.1| Flagellar biosynthetic protein FliR [Escherichia coli O55:H7 str.
           CB9615]
 gi|331653362|ref|ZP_08354367.1| flagellar biosynthetic protein FliR [Escherichia coli M718]
 gi|12516057|gb|AAG56965.1|AE005417_7 flagellar biosynthesis [Escherichia coli O157:H7 str. EDL933]
 gi|13362157|dbj|BAB36112.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           Sakai]
 gi|187767391|gb|EDU31235.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014181|gb|EDU52303.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999260|gb|EDU68246.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354885|gb|EDU73304.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359734|gb|EDU78153.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365568|gb|EDU83984.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370195|gb|EDU88611.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC869]
 gi|189375691|gb|EDU94107.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC508]
 gi|208724707|gb|EDZ74414.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730963|gb|EDZ79652.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740996|gb|EDZ88678.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4042]
 gi|209160796|gb|ACI38229.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766768|gb|ACI81696.1| flagellar biosynthetic protein FliR [Escherichia coli]
 gi|209766770|gb|ACI81697.1| flagellar biosynthetic protein FliR [Escherichia coli]
 gi|209766772|gb|ACI81698.1| flagellar biosynthetic protein FliR [Escherichia coli]
 gi|209766774|gb|ACI81699.1| flagellar biosynthetic protein FliR [Escherichia coli]
 gi|209766776|gb|ACI81700.1| flagellar biosynthetic protein FliR [Escherichia coli]
 gi|217318005|gb|EEC26432.1| flagellar biosynthetic protein FliR [Escherichia coli O157:H7 str.
           TW14588]
 gi|254593000|gb|ACT72361.1| flagellar export pore protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|257764899|dbj|BAI36394.1| flagellar export pore protein FliR [Escherichia coli O111:H- str.
           11128]
 gi|290763000|gb|ADD56961.1| Flagellar biosynthetic protein FliR [Escherichia coli O55:H7 str.
           CB9615]
 gi|320191924|gb|EFW66571.1| Flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           EC1212]
 gi|320641798|gb|EFX11186.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           G5101]
 gi|320647157|gb|EFX15990.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H- str.
           493-89]
 gi|320652441|gb|EFX20739.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H- str.
           H 2687]
 gi|320658043|gb|EFX25805.1| flagellar biosynthesis protein FliR [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658615|gb|EFX26309.1| flagellar biosynthesis protein FliR [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|323174670|gb|EFZ60290.1| flagellar biosynthetic protein FliR [Escherichia coli LT-68]
 gi|323180797|gb|EFZ66337.1| flagellar biosynthetic protein FliR [Escherichia coli 1180]
 gi|326342361|gb|EGD66142.1| Flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           1044]
 gi|326344865|gb|EGD68612.1| Flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           1125]
 gi|331049460|gb|EGI21532.1| flagellar biosynthetic protein FliR [Escherichia coli M718]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|300904840|ref|ZP_07122666.1| flagellar biosynthetic protein FliR [Escherichia coli MS 84-1]
 gi|301304255|ref|ZP_07210370.1| flagellar biosynthetic protein FliR [Escherichia coli MS 124-1]
 gi|300403267|gb|EFJ86805.1| flagellar biosynthetic protein FliR [Escherichia coli MS 84-1]
 gi|300840512|gb|EFK68272.1| flagellar biosynthetic protein FliR [Escherichia coli MS 124-1]
 gi|315257218|gb|EFU37186.1| flagellar biosynthetic protein FliR [Escherichia coli MS 85-1]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   L  ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLADTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|256831233|ref|YP_003159961.1| flagellar biosynthetic protein FliR [Desulfomicrobium baculatum DSM
           4028]
 gi|256580409|gb|ACU91545.1| flagellar biosynthetic protein FliR [Desulfomicrobium baculatum DSM
           4028]
          Length = 259

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 100/239 (41%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + ++    + R+   + L+P      +P   +    +  ++ L P L   I  Q   +  
Sbjct: 10  VFLTFLFALMRISLILFLMPFFGGQTLPATAKAALCLTLTLALWPRL-PLIGAQMPSHPF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             + +   EL LG + G++IR     +Q  G +I   +G  +   +      +E      
Sbjct: 69  ALAVMFGAELLLGLILGMVIRFVFAAIQTGGQLIGFQMGFAMVNVVDPDSGASEAVTAHF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL    I+ H  +   L+KS+  +P G  L    +      +    F++ +++ +
Sbjct: 129 MYMVSLLTFLSINGHLYLLSGLMKSFDLLPPGSILISPRLTDQIFALSGQIFVLAIQIGA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           P +   ++ ++++ L+++  PQ+ +  I  P  I +G LFL +  EII           
Sbjct: 189 PVIAAILLVDLALALISRASPQMNVLIIGFPIKISVGFLFLGIIFEIISLHMEGFVSRM 247


>gi|304398867|ref|ZP_07380737.1| flagellar biosynthetic protein FliR [Pantoea sp. aB]
 gi|304353571|gb|EFM17948.1| flagellar biosynthetic protein FliR [Pantoea sp. aB]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 104/241 (43%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ +     P L+   I  +V++  A+  + +++P L     +   +  
Sbjct: 11  HWVSQFFWPLVRIMALFATAPILNERSISKRVKIGLAVMITWLVMPLLPA---VNVTLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ ++ +G   G  ++     ++  G VI   +G++  T       L    L  
Sbjct: 68  PPGFLLLIQQMLIGIALGFTMQFAFAAVRLAGEVIGLQMGISFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L     + H  +   LV S+ T+PIG E    N F + V      F+  + L+
Sbjct: 128 FLDMLAMLLFLSFNGHLWLISLLVDSFHTLPIGGEPINANAFMALVKSGGLIFLNGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+ +GLLN++ PQ+ I+ I  P  + +G L + L + ++       F   
Sbjct: 188 LPLIVLLLMVNLVLGLLNRVSPQLSIFAIGFPITLSVGILTISLLMPLLAPFCERLFGEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|293415260|ref|ZP_06657903.1| flagellar biosynthetic protein FliR [Escherichia coli B185]
 gi|291432908|gb|EFF05887.1| flagellar biosynthetic protein FliR [Escherichia coli B185]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|94986974|ref|YP_594907.1| flagellar biosynthesis pathway, component FliR [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731223|emb|CAJ54586.1| Flagellar biosynthesis pathway, component FliR [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 262

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 101/228 (44%), Gaps = 1/228 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + +S  L   R+   + +LP  S+   P  ++   A+  +IVL   L      Q   +  
Sbjct: 10  MFLSFLLTFLRISVVLFMLPFFSIDGFPNMLKASIALILTIVLWGRL-SLSGTQMPAHPF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ E+FLG V GL +  +  G+Q  G +++T +G  + T            +   
Sbjct: 69  DLVLLIISEVFLGIVLGLAVNFFFAGIQAGGEILATQMGFTMITLADPLTGNTTGFIAHF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++  L    ++ H  +  A   ++  +P G  +    + S  +NM    F+  L +++
Sbjct: 129 LYMVATLVFLALNGHLFLIKAFTYTFKMVPAGGLVVREILLSELLNMAGMIFVFALHVAA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
           P +    +  IS+GL+ +  PQI I  +  P  IG+G  F+ L   I+
Sbjct: 189 PVMSALFLVEISLGLMARAAPQIHIMEVGFPVKIGVGFFFIGLLFTIL 236


>gi|74312490|ref|YP_310909.1| flagellar biosynthesis protein FliR [Shigella sonnei Ss046]
 gi|73855967|gb|AAZ88674.1| flagellar biosynthesis [Shigella sonnei Ss046]
 gi|320184488|gb|EFW59292.1| Flagellar biosynthesis protein FliR [Shigella flexneri CDC 796-83]
 gi|323168929|gb|EFZ54609.1| flagellar biosynthetic protein FliR [Shigella sonnei 53G]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 105/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  + V+ P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFVIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|210134371|ref|YP_002300810.1| flagellar biosynthesis protein FliR [Helicobacter pylori P12]
 gi|210132339|gb|ACJ07330.1| flagellar biosynthetic protein [Helicobacter pylori P12]
          Length = 255

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +       +   +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPES---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|260866392|ref|YP_003232794.1| putative lateral flagellar export pore protein [Escherichia coli
           O111:H- str. 11128]
 gi|257762748|dbj|BAI34243.1| predicted lateral flagellar export pore protein [Escherichia coli
           O111:H- str. 11128]
          Length = 260

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   +        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L M ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTMEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|312973833|ref|ZP_07788005.1| flagellar biosynthetic protein FliR [Escherichia coli 1827-70]
 gi|310332428|gb|EFP99663.1| flagellar biosynthetic protein FliR [Escherichia coli 1827-70]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     +Q  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVQTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|332095510|gb|EGJ00526.1| flagellar biosynthetic protein FliR [Shigella dysenteriae 155-74]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + ++     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLVAPFCEHLFSEMF 248


>gi|291558214|emb|CBL35331.1| Flagellar biosynthesis pathway, component FliR [Eubacterium siraeum
           V10Sc8a]
          Length = 262

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/238 (18%), Positives = 95/238 (39%), Gaps = 2/238 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
            +   LI+CRV       P  S S  P+++R    +A +++    + D            
Sbjct: 14  FLGFLLIMCRVSGIFSFNPIFSRSNFPVRLRAGTTIALAVLFASSMGDIKY--EPTGIFM 71

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
               +M EL LG + G ++ +        G +I    GL++  +M  +  ++     ++ 
Sbjct: 72  MLFDMMKELGLGLILGFMVNLILAVTISAGELIDYQTGLSMARAMDPATGVSMPLFANVY 131

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + +L  ++ + H         SY T+PIG      ++  + V    T   + ++L++P
Sbjct: 132 YYMFILYFFLTNGHLSYIKLFHISYETLPIGFSGFTADVPWALVTYFSTVLTLAVKLAAP 191

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +    +  I +G+L K VP I I+ ++    + +G   + +  + +           
Sbjct: 192 IIAIEFITEICLGVLMKAVPSIHIFALNIQLKVLIGLAAVLIMAQPMSDFIEKLMDIM 249


>gi|238924152|ref|YP_002937668.1| flagellar biosynthesis protein FliR [Eubacterium rectale ATCC
           33656]
 gi|238875827|gb|ACR75534.1| flagellar biosynthesis protein FliR [Eubacterium rectale ATCC
           33656]
 gi|291524885|emb|CBK90472.1| flagellar biosynthetic protein FliR [Eubacterium rectale DSM 17629]
 gi|291529026|emb|CBK94612.1| flagellar biosynthetic protein FliR [Eubacterium rectale M104/1]
          Length = 259

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 101/228 (44%), Gaps = 3/228 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
             LI+ R+ S + + P    + +P +V+   +   ++ +   +       ++V+   ++ 
Sbjct: 14  FLLILVRIASFVYIAPFFGDNAVPARVKTGLSAFVALFMYNII--ERPQLSYVSAVGFAV 71

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           LV+ E   G + G    +    + F G++I   IGL++ T    S +   T   +    +
Sbjct: 72  LVVKEGITGLLIGFAANICNSIVIFAGNLIDMDIGLSMATEFNPSMNSETTVTGNFYYYV 131

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQE-LNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
            L+ L V D H  +  A+  S+  +P+G     F N+ S+    +   F+I  R+  P  
Sbjct: 132 VLVLLLVSDMHTYLIRAVCDSFSVVPLGGAQFQFDNMLSTMTKYMGDMFVIGFRIFLPVF 191

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
              ++ N  +G++ K+ PQ+ ++ +     I  G + L L + +I   
Sbjct: 192 ACMMIMNCILGIMAKVAPQMNMFSVGIQLKIIAGFIVLFLIVYLIPNI 239


>gi|254523778|ref|ZP_05135833.1| flagellar biosynthetic protein FliR [Stenotrophomonas sp. SKA14]
 gi|219721369|gb|EED39894.1| flagellar biosynthetic protein FliR [Stenotrophomonas sp. SKA14]
          Length = 263

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 88/237 (37%), Gaps = 3/237 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R+G+  M +P +    +P +VR+  A   +I L P L    +   F   
Sbjct: 16  GMIGTVLWTMLRIGAVAMAMPMVGTRAVPARVRVVLAGTLAIALAPLLPPVPEWTGFD-- 73

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G L+R+        G +I+   GL                +  
Sbjct: 74  AATVLTIARELAIGVAIGFLLRLVFEAGAMAGELIAQGTGLAFAQMSDPLRGGTSGVIGQ 133

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              ++  L  +  + H  +   +V SY  +PIG  L   + F S     L T     L L
Sbjct: 134 WFYLLFGLLFFTANGHLALISLVVDSYRALPIGAPLPDPHAFFSIAPTFLLTVLRGALTL 193

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P     +  N++ G+L +  P +    +  P  + LG   L L    +       
Sbjct: 194 AIPLTVAMLAVNLAFGVLARAAPALNPIQLGLPVSLLLGLFLLALLAGEMGPPVQRL 250


>gi|170019717|ref|YP_001724671.1| flagellar biosynthesis protein FliR [Escherichia coli ATCC 8739]
 gi|169754645|gb|ACA77344.1| flagellar biosynthetic protein FliR [Escherichia coli ATCC 8739]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F          F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLVLTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|160880829|ref|YP_001559797.1| flagellar biosynthetic protein FliR [Clostridium phytofermentans
           ISDg]
 gi|160429495|gb|ABX43058.1| flagellar biosynthetic protein FliR [Clostridium phytofermentans
           ISDg]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/244 (19%), Positives = 101/244 (41%), Gaps = 2/244 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           + P   ++  F+I+ R+ + I   P  S+  +P +V++  ++  +I+L   +        
Sbjct: 2   VIPVEQLVFFFVILVRISAFIYTGPFFSLKNVPQKVKIGLSLTLAIILNQTIPY--SELV 59

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
           +     ++ +++ E   G + G    +    L   G ++   IG ++        +   T
Sbjct: 60  YEGVIGFAIVIVGEALAGAIMGFFSNICFQILSLAGQLMDMEIGFSMVNEFDPISNAQVT 119

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
              +      +L L + + HH +  ALV SY  IP+G       I++  V  +   F+I 
Sbjct: 120 ITANFYHYAVMLFLLITNMHHYIIKALVDSYQVIPVGGAKLNPLIYTVMVQFVVDFFVIA 179

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            R+  P     ++ N+ + +L K+ PQ+ ++ I     + +G + L     +I       
Sbjct: 180 FRIILPIFASMLIVNVVLAILAKVAPQMNMFVIGLQLKVLIGFIVLLFMTLMIPSVADFI 239

Query: 243 FLYG 246
           F   
Sbjct: 240 FTEM 243


>gi|317013592|gb|ADU81028.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           Gambia94/24]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNATYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|331677832|ref|ZP_08378507.1| flagellar biosynthetic protein FliR [Escherichia coli H591]
 gi|331074292|gb|EGI45612.1| flagellar biosynthetic protein FliR [Escherichia coli H591]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLNLYFWPLLRVLTLISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|292487980|ref|YP_003530857.1| flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|292899200|ref|YP_003538569.1| flagellar biosynthetic protein FliR [Erwinia amylovora ATCC 49946]
 gi|291199048|emb|CBJ46159.1| flagellar biosynthetic protein FliR [Erwinia amylovora ATCC 49946]
 gi|291553404|emb|CBA20449.1| Flagellar biosynthetic protein FliR [Erwinia amylovora CFBP1430]
 gi|312172105|emb|CBX80362.1| Flagellar biosynthetic protein FliR [Erwinia amylovora ATCC
           BAA-2158]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +  LF  + RV + IM  P LS   I  +V++   +  + VL+P L  T      +   
Sbjct: 12  WISQLFWPLARVLALIMTAPLLSEKSISRKVKIGLGVMITWVLIPSLPPT---NVTLFSV 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   
Sbjct: 69  GGFWLLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   + +S+ T+PIG E   GN F +        F+  +RL+ 
Sbjct: 129 LDMLAMLLFLSFNGHLWLISMVAESFQTLPIGGEPLNGNAFMALTESANLIFLNGMRLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRVSPQLSVFAIGFPVTLSVGMIFIILMMPLLAPFCEHLFSEIF 248


>gi|256020207|ref|ZP_05434072.1| flagellar biosynthetic protein FliR [Shigella sp. D9]
 gi|332281369|ref|ZP_08393782.1| lateral flagellar export/assembly protein [Shigella sp. D9]
 gi|332103721|gb|EGJ07067.1| lateral flagellar export/assembly protein [Shigella sp. D9]
          Length = 260

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   +        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPVPHDLISLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYVILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|153011500|ref|YP_001372714.1| flagellar biosynthesis protein FliR [Ochrobactrum anthropi ATCC
           49188]
 gi|151563388|gb|ABS16885.1| flagellar biosynthetic protein FliR [Ochrobactrum anthropi ATCC
           49188]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 136/237 (57%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PGLS + IP+QVRL  A+A S  +LP +    + + +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGLSSARIPLQVRLYIALACSFAVLPLVLQRIVTVVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L+  E+F+G V G+L  +Y   LQF  S ++ ++G +   +  I++S  +  L 
Sbjct: 70  PWTLFRLMASEMFVGAVIGILAHIYFWALQFMASTMAVSVGYSGSPADAITESEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   ++ D H ++F AL+ SY  IP+  +         F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFITDMHLEIFRALLNSYVAIPVDGQFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YF+S P+++G G L +   +  ++  F++ 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPTIPVYFVSMPFVLGGGLLVVYFILPELLRFFTNE 246


>gi|163850131|ref|YP_001638174.1| flagellar biosynthesis protein FliR [Methylobacterium extorquens
           PA1]
 gi|218528735|ref|YP_002419551.1| flagellar biosynthesis protein FliR [Methylobacterium
           chloromethanicum CM4]
 gi|254559276|ref|YP_003066371.1| flagellar biosynthesis protein FliR [Methylobacterium extorquens
           DM4]
 gi|163661736|gb|ABY29103.1| putative flagellar biosynthetic protein [Methylobacterium
           extorquens PA1]
 gi|218521038|gb|ACK81623.1| flagellar biosynthesis protein FliR [Methylobacterium
           chloromethanicum CM4]
 gi|254266554|emb|CAX22318.1| Flagellar biosynthesis protein FliR [Methylobacterium extorquens
           DM4]
          Length = 256

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 65/236 (27%), Positives = 113/236 (47%), Gaps = 1/236 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL-QNFVNRA 67
            + +FLI CR+G C++++PG S   +P QVRL  A   S+ + P L        +     
Sbjct: 14  FLGVFLIFCRIGGCLLIVPGFSSPRVPAQVRLLIAGGVSLAVTPLLLPLFQTKLSGQAPT 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
                +  E   G + GLL R++   L+   + +ST +G        +  + A   + SL
Sbjct: 74  ETLTWIASETVTGLLIGLLGRIFVFVLETVMNAVSTMVGFGSMPGTPVEGTDAIPAVESL 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I    +  ++  D H ++F  LV SYG IP G+            + +   F + LR+++
Sbjct: 134 IVFTAVALMFAADLHWELFRGLVDSYGRIPPGEGFGTQTALVRIADQIAEAFTLALRIAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           PF+ + +  N++ G +NKL P IP+YF++TP+++    L L       + QF   +
Sbjct: 194 PFIIYAVAVNLAAGFVNKLTPTIPVYFVATPFVMFGALLLLYTLSSEFMTQFLSGY 249


>gi|46581636|ref|YP_012444.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601205|ref|YP_965605.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris DP4]
 gi|46451059|gb|AAS97704.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561434|gb|ABM27178.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris DP4]
 gi|311235278|gb|ADP88132.1| flagellar biosynthetic protein FliR [Desulfovibrio vulgaris RCH1]
          Length = 263

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 98/237 (41%), Gaps = 1/237 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           +   L   RV   + LLP      +PMQV++   +  ++ L P L     +    +    
Sbjct: 12  LGFLLTFMRVSLVMFLLPFFGGDAVPMQVKVALCLVMAMALWPRLSLAGAVM-PSHPFEL 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             ++  EL LG V G+ +     G+Q  G ++   +G  + +          +  +  + 
Sbjct: 71  VVMLASELVLGLVLGMAVHFLFAGIQTGGQLLGFQMGFTMISIADPLSGAQISITSHFLY 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++ LL    +D H  +  A  +S+  +P G  +    + +  V +    F+I +++++P 
Sbjct: 131 MVSLLTFLALDGHLFLLRAFAESFALVPAGGLVANPAVANELVRLAGGMFVIAVKIAAPV 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
           L    +  +++ L+ +  PQ+ +  I  P  I +G  F+ L   I+        +  
Sbjct: 191 LVTLFLVELALALMARAAPQMNLLMIGFPLKIAVGFFFMGLLFTILAQYIEEFIIGM 247


>gi|157156975|ref|YP_001463252.1| flagellar biosynthesis protein FliR [Escherichia coli E24377A]
 gi|218695555|ref|YP_002403222.1| flagellar biosynthesis protein FliR [Escherichia coli 55989]
 gi|256022392|ref|ZP_05436257.1| flagellar biosynthesis protein FliR [Escherichia sp. 4_1_40B]
 gi|301029407|ref|ZP_07192501.1| flagellar biosynthetic protein FliR [Escherichia coli MS 196-1]
 gi|307138617|ref|ZP_07497973.1| flagellar biosynthesis protein FliR [Escherichia coli H736]
 gi|309795943|ref|ZP_07690356.1| flagellar biosynthetic protein FliR [Escherichia coli MS 145-7]
 gi|331642571|ref|ZP_08343706.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
 gi|331668641|ref|ZP_08369489.1| flagellar biosynthetic protein FliR [Escherichia coli TA271]
 gi|331683502|ref|ZP_08384103.1| flagellar biosynthetic protein FliR [Escherichia coli H299]
 gi|157079005|gb|ABV18713.1| flagellar biosynthetic protein FliR [Escherichia coli E24377A]
 gi|218352287|emb|CAU98044.1| flagellar export pore protein [Escherichia coli 55989]
 gi|299877711|gb|EFI85922.1| flagellar biosynthetic protein FliR [Escherichia coli MS 196-1]
 gi|308120393|gb|EFO57655.1| flagellar biosynthetic protein FliR [Escherichia coli MS 145-7]
 gi|324018859|gb|EGB88078.1| flagellar biosynthetic protein FliR [Escherichia coli MS 117-3]
 gi|331039369|gb|EGI11589.1| flagellar biosynthetic protein FliR [Escherichia coli H736]
 gi|331063835|gb|EGI35746.1| flagellar biosynthetic protein FliR [Escherichia coli TA271]
 gi|331079717|gb|EGI50914.1| flagellar biosynthetic protein FliR [Escherichia coli H299]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEIF 248


>gi|188534132|ref|YP_001907929.1| flagellar biosynthesis protein FliR [Erwinia tasmaniensis Et1/99]
 gi|188029174|emb|CAO97046.1| Flagellar biosynthesis protein [Erwinia tasmaniensis Et1/99]
          Length = 263

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 108/240 (45%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +  LF  + RV + IM  P LS   I  +V++   +  + VL+P L  T      +   
Sbjct: 12  WISQLFWPLARVLALIMTAPLLSEKAISRKVKIGLGVMITWVLVPSLPPT---HVTLFSV 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   
Sbjct: 69  GGFWLLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   +  S+ T+PIG E   GN F +        F+  +RL+ 
Sbjct: 129 LDMLAMLLFLSFNGHLWLISMVADSFHTLPIGAEPLNGNAFMALTKAANLIFLNGMRLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRVSPQLSVFAIGFPVTLSIGMIFIILMMPLLAPFCEHLFSEIF 248


>gi|149908780|ref|ZP_01897440.1| putative flagellar biosynthetic protein FliR [Moritella sp. PE36]
 gi|149808054|gb|EDM67995.1| putative flagellar biosynthetic protein FliR [Moritella sp. PE36]
          Length = 260

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 105/231 (45%), Gaps = 3/231 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           ++    R+ S + LLP    + I   VR+ FA+  +I++ P +    ++  F   +    
Sbjct: 16  IWWPFFRIISALWLLPIFGDTRITPSVRILFALTLAILISPVVPVVDNINPFSLGS--II 73

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L + ++  G   GL + +    ++  G ++S  +GL++      S   +    + L+ I 
Sbjct: 74  LALEQILFGLFFGLSLTMLFTMMKLIGEILSMQMGLSMAVMNDPSSGGSSHVNSHLLTIF 133

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
             L     + H  V   LV+S+ T PIG  +   NI    + ++   FM  L L+ P + 
Sbjct: 134 ATLLFLSFNGHLIVLDILVESFVTWPIGSSIYLLNI-DIILKLVSWMFMAALMLAMPAIV 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
             ++ NI+ G++N+  P + +Y +  P  + LG + L L   +I  +F   
Sbjct: 193 AMLLVNITFGVMNRSAPSLNVYSLGFPMGMLLGIICLGLVFRVIPNRFFDF 243


>gi|197334958|ref|YP_002156666.1| flagellar biosynthetic protein FliR [Vibrio fischeri MJ11]
 gi|197316448|gb|ACH65895.1| flagellar biosynthetic protein FliR [Vibrio fischeri MJ11]
          Length = 260

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 92/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  ++RL   ++ +  ++P +         V+  
Sbjct: 11  FIATYFWPYTRISAMLMVMSVFGARFVSPRIRLYLGLSITFAVMPAIPAMPPEIQLVSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +      ++ +G   G++    T      G ++     L   + +  ++      L  L
Sbjct: 71  GFMTTA-EQIIIGVAMGMVTVFVTQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + +L     D H ++   +V S+ T+P+G        + S  + L       L +S 
Sbjct: 130 FMFLSILFFLGTDGHLKMINFVVMSFTTLPVGVGKLTSVDYQSMASWLGIMMKAGLSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     I  +   +   +L  
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFAFALLVGLLLTSYIILGLFNHYDLHWLRA 248


>gi|262273549|ref|ZP_06051363.1| flagellar biosynthesis protein FliR [Grimontia hollisae CIP 101886]
 gi|262222527|gb|EEY73838.1| flagellar biosynthesis protein FliR [Grimontia hollisae CIP 101886]
          Length = 256

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/236 (17%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
                ++    R+G+ + ++P      IP+QVR+      + +  P +    +++    +
Sbjct: 11  AWFGQIWWPFLRIGAFLTMMPIFGGMNIPVQVRIGLTWLIAAIAAPLMPPMPEVEPLSLQ 70

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A  + L   E+ +G +   ++ +        G ++ST +GL +       + ++   +  
Sbjct: 71  A--ALLSAKEILIGGIMAFVLELLFSVFMTLGQILSTQMGLGMAMMNDPVNGVSIASIGK 128

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              +  +L    +D H      +V S+    +G+         +            L LS
Sbjct: 129 FYQLFAILLFLALDGHLIALEVIVTSFDIWQVGET-MSQMALKTVFMQFSWMIGAALLLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P +   ++ NI+ G++N+  PQ+ ++ +  P  + LG   L L++  I + F++ 
Sbjct: 188 LPAMIAMLLVNIAFGVMNRAAPQLNVFALGFPMTLLLGLACLFLTMSGIPHNFANF 243


>gi|256059812|ref|ZP_05450007.1| flagellar biosynthesis protein FliR [Brucella neotomae 5K33]
 gi|261323792|ref|ZP_05962989.1| flagellar biosynthetic protein FliR [Brucella neotomae 5K33]
 gi|261299772|gb|EEY03269.1| flagellar biosynthetic protein FliR [Brucella neotomae 5K33]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 77/237 (32%), Positives = 137/237 (57%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +    +   +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L 
Sbjct: 70  PWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   +V D H ++F AL+ SY TIP+            F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFVTDMHLEIFRALLNSYVTIPVDGRFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|308182347|ref|YP_003926474.1| flagellar biosynthesis protein FliR [Helicobacter pylori PeCan4]
 gi|308064532|gb|ADO06424.1| flagellar biosynthesis protein FliR [Helicobacter pylori PeCan4]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPKLAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|188494213|ref|ZP_03001483.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
 gi|188489412|gb|EDU64515.1| flagellar biosynthetic protein FliR [Escherichia coli 53638]
          Length = 260

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLVLQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|320668513|gb|EFX35340.1| flagellar biosynthesis protein FliR [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 103/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  +  G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTFGISLMATLMPLIAPFCEHLFSEIF 248


>gi|300920169|ref|ZP_07136619.1| flagellar biosynthetic protein FliR [Escherichia coli MS 115-1]
 gi|300412826|gb|EFJ96136.1| flagellar biosynthetic protein FliR [Escherichia coli MS 115-1]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   +V ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLMVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|27381961|ref|NP_773490.1| flagellar biosynthesis protein FliR [Bradyrhizobium japonicum USDA
           110]
 gi|27355131|dbj|BAC52115.1| fliR [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 79/240 (32%), Positives = 127/240 (52%), Gaps = 1/240 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTI-D 59
           M  S    ++  F++ CR+G+C+M +PG S   +P QVRL  A+  +  L P L   +  
Sbjct: 1   MISSLADSVLVTFIVFCRIGACLMFVPGYSSVNVPAQVRLFIALVTTFALTPILIAVLKP 60

Query: 60  LQNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSL 119
           L +       + L+  E+ +G V GL  RV+ L LQ   +V+++AIGL+      I D+ 
Sbjct: 61  LTDQAAPLTLALLIGSEVLVGSVIGLGGRVFFLALQTMATVMASAIGLSNIPGTPIGDTD 120

Query: 120 AETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTF 179
               L  LI        ++ D H QV   L+ SY     G  L         V+ L   F
Sbjct: 121 PAPALVPLIMASVTTLFFMTDQHWQVLRGLMNSYDVWHPGARLGGSMALDQLVSRLSEAF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           ++ LR++SPF+ + ++ N+++GL+NKL P IP+YFIS P+++  G L L L+ + ++ QF
Sbjct: 181 VLTLRIASPFIVYSVIVNLAVGLINKLTPAIPVYFISVPFVLFGGFLLLYLTSDELLTQF 240


>gi|308187302|ref|YP_003931433.1| Flagellar biosynthetic protein fliR [Pantoea vagans C9-1]
 gi|308057812|gb|ADO09984.1| Flagellar biosynthetic protein fliR [Pantoea vagans C9-1]
          Length = 261

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 103/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ +     P L+   +  +V++  A+  + +L+P L     +   +  
Sbjct: 11  QWVSQFFWPLVRIMALFATAPILNERSVSKRVKIGLAVMITWLLMPLLPA---VNVTLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ ++ +G   G  ++     ++  G VI   +G++  T       L    L  
Sbjct: 68  PAGFWLLIQQMLIGIALGFTMQFAFAAVRLAGEVIGLQMGISFATFFDPGSRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L     + H  +   L  S+ T+PIG      N F + V      F+  + L+
Sbjct: 128 FLDMLAMLLFLTFNGHLWLISLLADSFHTLPIGGHPLNANAFMALVKSGGLIFLNGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   ++ N+ +GLLN++ PQ+ I+ I  P  + +G L + L + ++     H F   
Sbjct: 188 LPLIVLLLMVNLVLGLLNRVSPQLSIFAIGFPITLSVGILTISLLMPLLAPFCEHLFSEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|224417781|ref|ZP_03655787.1| flagellar biosynthesis protein FliR [Helicobacter canadensis MIT
           98-5491]
 gi|253827123|ref|ZP_04870008.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313141324|ref|ZP_07803517.1| flagellar biosynthesis protein FliR [Helicobacter canadensis MIT
           98-5491]
 gi|253510529|gb|EES89188.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130355|gb|EFR47972.1| flagellar biosynthesis protein FliR [Helicobacter canadensis MIT
           98-5491]
          Length = 256

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/246 (21%), Positives = 101/246 (41%), Gaps = 2/246 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           +    E  + +  L++ R    I   P      I  Q++  F    +I+ LP +      
Sbjct: 4   LAYLTEGNVTNFLLLLLRFAGIIAFFPFFENQLINTQIKGIFIFWLTILFLPLVTTMPP- 62

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
            + +    +    + E+ LG +    +++    + F G VIS A+GL +  +        
Sbjct: 63  -SNLTILEFIIAGITEIMLGFLASFALQIVFGMISFGGEVISFAMGLTIANAYDPVTGAQ 121

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
           +  +  L+ ++ L+ +  +D+HH   Y + +S   IP+G  L   N     +      F+
Sbjct: 122 KPIVGQLLTLLALMIVLALDYHHLFLYFVGESIKEIPLGGFLYSHNYIIYTIKAFSNLFL 181

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           I L +S P +   ++ +I  G++ K  PQ  +  I  P  I +    L + I  I+  F 
Sbjct: 182 IGLTMSFPIIALILLSDIIFGMIMKAHPQFNLLAIGFPVKIAVAFAVLIVIIPAIMIHFK 241

Query: 241 HSFLYG 246
             FL  
Sbjct: 242 REFLSA 247


>gi|222824090|ref|YP_002575664.1| flagellar biosynthesis protein FliR [Campylobacter lari RM2100]
 gi|222539312|gb|ACM64413.1| flagellar biosynthesis protein FliR [Campylobacter lari RM2100]
          Length = 256

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 104/239 (43%), Gaps = 4/239 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           ++   L+  R+   I+  P  S + IP+ V+   A+  ++ L P       L+N    ++
Sbjct: 12  VVIFMLLFARMSGLIVFFPFFSHNSIPLVVKTTLALFLTMFLYPLA----KLENNTPDSF 67

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +   ++ E+  G V GL++++    LQ  G  IS  +G ++ + +  +       ++ ++
Sbjct: 68  FILYLLSEVLFGMVAGLILQMIFAILQMAGEQISFTMGFSMASILDPATGANTPVISQVL 127

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++ LL     D HH +   +  S   I +G      N+       +   F++   ++ P
Sbjct: 128 NLLALLVFLAFDGHHLILLFISNSLEYISLGGFYPHENLMLYLNKAMVNIFVLGFSMAFP 187

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
            L   ++ ++  G+L K +PQ  +  +  P  I L    L   + I++  F +  L  F
Sbjct: 188 ILAISLLSDVIFGMLMKTMPQFNLLVVGYPIKIFLSFAVLIAILLIMMQYFKNLMLKSF 246


>gi|157161421|ref|YP_001458739.1| flagellar biosynthesis protein FliR [Escherichia coli HS]
 gi|157067101|gb|ABV06356.1| flagellar biosynthetic protein FliR [Escherichia coli HS]
          Length = 261

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIASFCEHLFSEIF 248


>gi|15611229|ref|NP_222880.1| flagellar biosynthesis protein FliR [Helicobacter pylori J99]
 gi|4154675|gb|AAD05742.1| FLAGELLAR BIOSYNTHESIS PROTEIN [Helicobacter pylori J99]
          Length = 255

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +  +        +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAIYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+G+ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGRFVFEPELAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|291278827|ref|YP_003495662.1| flagellar biosynthetic protein FliR [Deferribacter desulfuricans
           SSM1]
 gi|290753529|dbj|BAI79906.1| flagellar biosynthetic protein FliR [Deferribacter desulfuricans
           SSM1]
          Length = 261

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/245 (21%), Positives = 106/245 (43%), Gaps = 2/245 (0%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
           +     +++ FLIV RV   +   P      + +++RL F++  SI+++  +  +I    
Sbjct: 7   LLNTDYLLTFFLIVIRVSGILFTAPVFGSGVVDVRLRLFFSIIVSILIINNV--SIISFQ 64

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
            V+      LV+ EL +G   G+L R    G+QF G +I   +G  +   +    +   +
Sbjct: 65  NVSTLLLILLVIKELLIGIATGVLARFIFAGVQFGGQLIGFQMGFGVVNILDPQTNTQVS 124

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            +     I+ +L    I  H  V  A+  S+  +P+ +       +   V    + F+  
Sbjct: 125 IIAQFQNILMILIFLAIGGHLFVIKAISYSFTNVPLAKFTFSSEGYIFLVEKFGSIFLTA 184

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           +++ +P     ++ ++ +G++ +LVPQ+ +  +  P  I  G L L LS+      F   
Sbjct: 185 IKIIAPVFVTLLLLHVVMGIMARLVPQMNVLIVGFPVQIAFGLLVLLLSLSYFYKIFEKI 244

Query: 243 FLYGF 247
                
Sbjct: 245 LYQYL 249


>gi|330447935|ref|ZP_08311583.1| flagellar biosynthetic protein FliR [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492126|dbj|GAA06080.1| flagellar biosynthetic protein FliR [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 258

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/236 (19%), Positives = 100/236 (42%), Gaps = 3/236 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++   +    R+G+ ++ +P    + IP+ VR   A+A S +  P +            
Sbjct: 10  ALLAQFWWPFFRIGAAMLAMPFFGDALIPIWVRALLALAISFIAAPLMPAMPTTDLLSLN 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L   +   G + GL++      +   G +IS  +GL +       + ++   L  
Sbjct: 70  A--LTLAFEQAIWGILFGLILHFLFSIMTLLGQIISLQMGLGMAMMNDPVNGVSIAILGR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  +   L    +D H  V   LV+S+ + P+G  L   ++    + +    F   L ++
Sbjct: 128 MFLLFSTLLFLALDGHLLVIDILVQSFTSWPVGSGLALSSV-KQILTLFGWMFSSALAIA 186

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            P +   ++ NIS G++N+  P + +Y +  P  + LG   + +S+  +  +++  
Sbjct: 187 LPAIVSMLLANISFGVMNRAAPSLNVYALGFPMTMLLGLFSVLISVSGVPTRYAEL 242


>gi|109899340|ref|YP_662595.1| flagellar biosynthesis protein FliR [Pseudoalteromonas atlantica
           T6c]
 gi|109701621|gb|ABG41541.1| flagellar biosynthetic protein FliR [Pseudoalteromonas atlantica
           T6c]
          Length = 259

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 94/240 (39%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M  + L   R+   +  + GLS   +P  VR    +  + ++LP +     ++     
Sbjct: 10  QFMGDMLLPFMRISGMLATMVGLSAKTVPTTVRALLTLFITFIILPVIPPVPVVEILSVS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                LV+ +L +G   G +  +        G V++   GL   + +   + +    +  
Sbjct: 70  T--FVLVIQQLIIGISLGFISTMVLNTFVLAGQVVAMQTGLGFASIVDPVNGINVPAVGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
              I+  L  W +D H  +   +V S+   P+G+       F    +     F+  + LS
Sbjct: 128 FYLILATLLFWALDGHLAMIRMVVMSFTAFPVGEAWLQPEQFREIAHWAGWMFISAVTLS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   ++ N++ G++ K  PQ+ I+ +       +G + + ++++   Y F   +   
Sbjct: 188 LAPIVSLLIVNLAFGVMTKAAPQLNIFSLGFSIAQIMGLVIIWITMDNFTYHFEVQWDRA 247


>gi|317008844|gb|ADU79424.1| flagellar biosynthesis protein FliR [Helicobacter pylori India7]
          Length = 255

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSTIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCTSVFLQIVFASLVFATDSISFSMGLTMASTYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|290475716|ref|YP_003468605.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           bovienii SS-2004]
 gi|289175038|emb|CBJ81841.1| putative flagellar biosynthetic protein, regulator [Xenorhabdus
           bovienii SS-2004]
          Length = 260

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 101/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++   F  + R+ +     P  S    P++VR+  A+A + +L+P +      Q  V   
Sbjct: 12  LVSDFFWPLVRLLALFSTAPIFSEKQTPIKVRMSLALAITFLLVPNIP---SPQIPVFSV 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               +++ ++ +G   GL +++    ++  G ++   +GL+  T    +       L  +
Sbjct: 69  AGVWVMIQQVLIGVALGLTMQIAFAAIRHAGEILGLQMGLSFATFFDPTGGPNMPILARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L    +D H  +   L  ++ +IPI         F          F+  + L+ 
Sbjct: 129 LNLLMMLMFLALDGHLWLLSILAGTFDSIPIQPMQLNPKGFLLLAQSAHLIFINGMMLAM 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +V N ++G+LN++ PQ+ ++ I  P  + +G   L L   ++           F
Sbjct: 189 PLITLLLVLNFALGMLNRMTPQLSVFVIGFPLTLTVGIFTLSLLFPMLAPFTERLMAEIF 248


>gi|317012018|gb|ADU82626.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           Lithuania75]
          Length = 255

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILITSAIMGRFKEEISLAF 248


>gi|208434126|ref|YP_002265792.1| flagellar biosynthetic protein [Helicobacter pylori G27]
 gi|208432055|gb|ACI26926.1| flagellar biosynthetic protein [Helicobacter pylori G27]
          Length = 255

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSSAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPKLAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|317492420|ref|ZP_07950849.1| flagellar biosynthetic protein FliR [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919759|gb|EFV41089.1| flagellar biosynthetic protein FliR [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 261

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F    R+ + I   P LS   I  + ++  AMA + +L+P L         ++  
Sbjct: 12  WLGQYFWPFVRMLALISTAPLLSEKAISKKTKVGLAMAITFLLVPNLGSNPTPVVSISG- 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               LV  ++ +G   GL ++     ++  G VI   +GL+  T    S       L  L
Sbjct: 71  --LWLVTQQILIGAALGLTMQFAFAAVRLAGEVIGLQMGLSFATFFDPSGGPNMPILARL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   L +S+ T+PI ++   GN F          F+  L L+ 
Sbjct: 129 LNLLTMLLFLSFNGHLWMISLLAESFQTLPISEQPLNGNGFLMLAQAGSLIFVNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N ++GLLN++ PQ+ I+ +  P  + +G   L L + ++V    H F   F
Sbjct: 189 PLITLLLALNTALGLLNRMTPQLSIFVVGFPLTLTIGMFSLSLMMPMLVPFSEHLFSEVF 248


>gi|23500846|ref|NP_700286.1| flagellar biosynthesis protein FliR [Brucella suis 1330]
 gi|161621174|ref|YP_001595060.1| flagellar biosynthesis protein FliR [Brucella canis ATCC 23365]
 gi|254699255|ref|ZP_05161083.1| flagellar biosynthesis protein FliR [Brucella suis bv. 5 str. 513]
 gi|254702375|ref|ZP_05164203.1| flagellar biosynthesis protein FliR [Brucella suis bv. 3 str. 686]
 gi|254711811|ref|ZP_05173622.1| flagellar biosynthesis protein FliR [Brucella ceti M644/93/1]
 gi|254714879|ref|ZP_05176690.1| flagellar biosynthesis protein FliR [Brucella ceti M13/05/1]
 gi|256015890|ref|YP_003105899.1| flagellar biosynthesis protein FliR [Brucella microti CCM 4915]
 gi|260568722|ref|ZP_05839191.1| flagellar biosynthesis protein FliR [Brucella suis bv. 4 str. 40]
 gi|261216568|ref|ZP_05930849.1| flagellar biosynthetic protein FliR [Brucella ceti M13/05/1]
 gi|261319439|ref|ZP_05958636.1| flagellar biosynthetic protein FliR [Brucella ceti M644/93/1]
 gi|261749694|ref|ZP_05993403.1| flagellar biosynthetic protein FliR [Brucella suis bv. 5 str. 513]
 gi|261752938|ref|ZP_05996647.1| flagellar biosynthetic protein FliR [Brucella suis bv. 3 str. 686]
 gi|23464510|gb|AAN34291.1| flagellar biosynthesis protein FliR, putative [Brucella suis 1330]
 gi|161337985|gb|ABX64289.1| flagellar biosynthetic protein FliR [Brucella canis ATCC 23365]
 gi|255998550|gb|ACU50237.1| flagellar biosynthesis protein FliR [Brucella microti CCM 4915]
 gi|260155387|gb|EEW90468.1| flagellar biosynthesis protein FliR [Brucella suis bv. 4 str. 40]
 gi|260921657|gb|EEX88225.1| flagellar biosynthetic protein FliR [Brucella ceti M13/05/1]
 gi|261292129|gb|EEX95625.1| flagellar biosynthetic protein FliR [Brucella ceti M644/93/1]
 gi|261739447|gb|EEY27373.1| flagellar biosynthetic protein FliR [Brucella suis bv. 5 str. 513]
 gi|261742691|gb|EEY30617.1| flagellar biosynthetic protein FliR [Brucella suis bv. 3 str. 686]
          Length = 255

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 136/237 (57%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +    +   +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L 
Sbjct: 70  PWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|218778858|ref|YP_002430176.1| flagellar biosynthetic protein FliR [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760242|gb|ACL02708.1| Flagellar biosynthetic protein FliR [Desulfatibacillum alkenivorans
           AK-01]
          Length = 260

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 102/237 (43%), Gaps = 1/237 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           M    LI+ RV   + + P    + IP+ V+   ++  ++ L P +              
Sbjct: 11  MAVFALILIRVSVILFMFPVFGSNLIPLPVKAGLSLLLTLYLTPIVQVNPQ-SFPDTVLE 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              +++ E  +G    L++  +   +Q  G ++   +G  +            + L++  
Sbjct: 70  GGVMILCEAVMGLTLSLIVSFFFAAVQVGGQLVGYQMGFAIANVFDPVSGGQMSILSNFA 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + L+   V++ HH    A+  S+  +P+G      +I  S + +    F + L+++ P
Sbjct: 130 FWVTLVLFIVLNGHHIFIRAVAHSFEIVPVGHLYAGRSIMPSMIKLSTDMFTLSLQIAGP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
            +   ++ N + G++ K+VPQI I  ++ P  +G+G  F  +S+++I+         
Sbjct: 190 AIVALLLVNAAFGIVAKVVPQINILIVAFPINVGMGLFFFGVSLQLILASMKAHLDE 246


>gi|306845411|ref|ZP_07477985.1| flagellar biosynthetic protein FliR [Brucella sp. BO1]
 gi|306274154|gb|EFM55970.1| flagellar biosynthetic protein FliR [Brucella sp. BO1]
          Length = 255

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 135/237 (56%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +    +   +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L+  E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L 
Sbjct: 70  PWTLFRLMAGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|149908445|ref|ZP_01897108.1| flagellar biosynthesis protein [Moritella sp. PE36]
 gi|149808608|gb|EDM68543.1| flagellar biosynthesis protein [Moritella sp. PE36]
          Length = 261

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 91/240 (37%), Gaps = 2/240 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             M S      R+   +M++        P  +RL +  A ++++ P L    ++  F   
Sbjct: 10  TFMASYIWPFARLSGMVMVMIVSGAKTTPTIIRLFYCFALTVMVAPVLPPMPNVDLFSLS 69

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           ++    ++ +  +G   G +  +        G +I+    L   +    +       +  
Sbjct: 70  SFMI--ILQQSLIGIAIGFVTVMLIQTFVLAGQIIAMQTSLGFASMADPASGQMSPVIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           +  ++G L    ++ H  +   +VKS+ T+P+         +      +   F   L +S
Sbjct: 128 IYILLGTLVYLSVNGHLFMIETVVKSFETLPVSASGLVAIQYYEIAGWMSVMFAAALSMS 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
              +   +V N S G++ K  PQ+ ++ +     +  G   + LS++  V+ F   +   
Sbjct: 188 LSAVVAMLVINFSFGVMTKAAPQLNVFSLGFAVGMVAGLFIIYLSLKSFVFHFDAQWQRA 247


>gi|256833223|ref|YP_003161950.1| flagellar biosynthetic protein FliR [Jonesia denitrificans DSM
           20603]
 gi|256686754|gb|ACV09647.1| flagellar biosynthetic protein FliR [Jonesia denitrificans DSM
           20603]
          Length = 253

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 97/240 (40%), Gaps = 3/240 (1%)

Query: 3   ISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQN 62
                 + ++ L+  R  +  ++ P  S    P  V++  A+  ++ + P +   +  QN
Sbjct: 4   TLSAATIETVMLVSVRFIAFFVIAPPFSARSFPATVKMMLALGMALAVAPTITPAVPAQN 63

Query: 63  FVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAET 122
           F     Y   + +++ +G   G ++ +    ++  G +I    G  +       + +   
Sbjct: 64  F---GTYMLALGLQVVIGASLGFIVYLVFAAVESAGGMIDMTGGFAMAQGFDPLNQVNGA 120

Query: 123 PLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIM 182
            +  L  +  L  L+  + HH +    ++S+   P+   +N   +  S    L   F+  
Sbjct: 121 QMYRLFQMTALALLFASNGHHLIVGGFIRSFEFAPLAGGINMDRMGQSVATGLTDLFLAA 180

Query: 183 LRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++++ P +   ++ ++ +GLL+++ P + ++ +S P  I L    + +            
Sbjct: 181 IQIAGPLIVVLVLADVGMGLLSRVAPALNVFVLSFPLKIFLTITLVSVVYLTFPRIIEAL 240


>gi|188579933|ref|YP_001923378.1| flagellar biosynthesis protein FliR [Methylobacterium populi BJ001]
 gi|179343431|gb|ACB78843.1| putative flagellar biosynthetic protein [Methylobacterium populi
           BJ001]
          Length = 256

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 112/236 (47%), Gaps = 1/236 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFV-NRA 67
            +S+FLI CR+G C++++PG S   +P QVRL  A   S+ + P L      +       
Sbjct: 14  FLSVFLIFCRIGGCLLIVPGFSSPRVPAQVRLLIAAGVSLAVTPLLLPLFQGRLPGQAPT 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
                +  E   G + G L R++   L+   + +ST +G        +  + A   + SL
Sbjct: 74  ETLVWIASESITGLLIGFLGRIFVFVLETVMNAVSTMVGFGSMPGTPVEGTDAIPAVESL 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I    +  ++  D H ++F  LV SY  IP G+            + +   F + LR+++
Sbjct: 134 IVFTAVALMFAADLHWELFRGLVDSYARIPPGEGFGTQTALVRIADQIGEAFTLALRIAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
           PF+ + +  N++ G +NKL P IP+YFI+TP+++    + L       + QF   +
Sbjct: 194 PFIIYAVAVNLAAGFVNKLTPTIPVYFIATPFVMFGALILLYTLSSEFMTQFLSGY 249


>gi|315126007|ref|YP_004068010.1| flagellar biosynthetic protein FliR [Pseudoalteromonas sp. SM9913]
 gi|315014521|gb|ADT67859.1| putative flagellar biosynthetic protein FliR [Pseudoalteromonas sp.
           SM9913]
          Length = 259

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/235 (20%), Positives = 101/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            M +L+    R  + +  +P      +  + R+  +M  + ++ P L     +  F   A
Sbjct: 15  WMGTLWWPFVRFSALLWSMPVFDNPAVTPRSRILVSMMLAFLVAPQLPLAPAIDLFSLDA 74

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             + L   ++  G + GL +R+    +   G ++S  +GL++   M          L  L
Sbjct: 75  --AILTFEQIIFGVMMGLSLRILFEVMAMIGLILSMQMGLSMALVMDPGSGNQVALLGQL 132

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
             I+  L  + +D H      +V+S+ + PIG+ +   +I  S + +    F   L LS 
Sbjct: 133 FWIMCALLFFAVDGHLITLQVMVESFHSFPIGRSIYEFDI-QSIIMLFAWMFSSALLLSL 191

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P +   ++ N++ G+ ++  P + I+ +  P  + +G   + +++E     FS  
Sbjct: 192 PGIVAMLLVNLTFGVASRAAPSLNIFVLGFPMSLLMGFFCVFMTLEYTGSAFSRL 246


>gi|270262393|ref|ZP_06190664.1| flagellar biosynthetic protein FliR [Serratia odorifera 4Rx13]
 gi|270043077|gb|EFA16170.1| flagellar biosynthetic protein FliR [Serratia odorifera 4Rx13]
          Length = 260

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 102/241 (42%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
           + +   F  + R+ + I   P  S   I  +V++       I++ P L  +      +  
Sbjct: 11  VWLSHYFWPLLRILALISTAPVFSEKQIGKKVKIGLGGLIVILIAPGLPTS---AVPIFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A    L   ++ +G   GL ++     ++  G VI   +GL+  T    S       L  
Sbjct: 68  AAGLWLAAQQILIGVALGLTMQFAFAAIRLAGEVIGMQMGLSFATFFDPSGGPNTPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L+ ++ +L     D H  +   L  S+ T+PI      GN F +   +    F+  + L+
Sbjct: 128 LLNLLAMLLFLSFDGHLWLISLLADSFHTLPIQPAPLNGNGFLALTQVGSLIFINGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+++GLLN++ PQ+ ++ I  P  + +G + + + + ++     H F   
Sbjct: 188 LPLICLLLTLNMALGLLNRMTPQLSVFVIGFPVTMTIGIMTIGMMMPMLAPFCEHLFGEF 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|269796380|ref|YP_003315835.1| flagellar biosynthetic protein FliR [Sanguibacter keddieii DSM
           10542]
 gi|269098565|gb|ACZ23001.1| flagellar biosynthetic protein FliR [Sanguibacter keddieii DSM
           10542]
          Length = 252

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 99/234 (42%), Gaps = 4/234 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + SL L+  R+ + +++ P  S   IP  V++  A   ++ + P + + +      +   
Sbjct: 10  LESLMLVGVRMVAFLVVAPPFSHRGIPATVKVMLATGLALAVSPRVENLVP----DSTGE 65

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           Y  L++ E  +G   G L+ V    +Q  G++I    G +L         +       L 
Sbjct: 66  YVVLLVGEAIIGAGLGFLVAVVFSAVQSAGALIDLMGGFSLAQGFDPMTQVNGAQFARLY 125

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            +  ++ L+  + +  V   LV+++  +P+G  L+   +  +  + L   F+  L+++ P
Sbjct: 126 QLTAVVILFASNGYQMVIGGLVRTFDALPLGSTLDLARLGEALTSSLTGMFLATLQIAGP 185

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
            +    + ++ +GLL ++ P +  + +  P  I L      L+   +       
Sbjct: 186 LVVVLFLADVGLGLLTRVAPALNAFALGFPLKILLTLSLASLTYLAMPRIIESL 239


>gi|257866392|ref|ZP_05646045.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC30]
 gi|257873092|ref|ZP_05652745.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC10]
 gi|257800350|gb|EEV29378.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC30]
 gi|257807256|gb|EEV36078.1| flagellar biosynthetic protein fliR [Enterococcus casseliflavus
           EC10]
          Length = 249

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 105/231 (45%), Gaps = 4/231 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           + +  LI CR+ + ++L P  S    P   ++   MA +++ LP      +L  F+    
Sbjct: 4   IQATVLIFCRILAFVVLCPIFSQKNFPSLAKIVIGMALTVLCLPTTPAIPELSLFM---- 59

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
            +  V+ E+  G   G L ++   G++  G +I   +G ++  +   +  +A +      
Sbjct: 60  LTVFVIKEVLFGMAMGYLSQLVFTGVEIAGQLIDFQVGFSMAQAYDPTLQIASSQYGKTY 119

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + +   + +D HH++  AL+ S+  +P+G  +  G      V +     ++ + L++P
Sbjct: 120 YWLTIAVFFGLDLHHRLITALLLSFRIVPLGSVVIQGTTVEGIVKLFSQMMVMAVNLAAP 179

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            +   ++ ++ +G++++ +PQI I  +S      +  +   L +  ++   
Sbjct: 180 MIIALLLVDLVLGVISRSIPQINILMMSLSMKTAISFVVFLLLLPNVLSYL 230


>gi|167645348|ref|YP_001683011.1| flagellar biosynthesis protein FliR [Caulobacter sp. K31]
 gi|167347778|gb|ABZ70513.1| flagellar biosynthetic protein FliR [Caulobacter sp. K31]
          Length = 251

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 60/234 (25%), Positives = 127/234 (54%), Gaps = 1/234 (0%)

Query: 14  LIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSKLV 73
           L+  R+G+ +ML+PG+  + +P ++RL FA+  +I+L P +  +I      +    +  V
Sbjct: 15  LVFARIGAMVMLMPGVGEAVVPPRIRLSFAVLMAILLAPLVSSSITT-VPSSVGAVAGAV 73

Query: 74  MVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGIIGL 133
           + E+ +G + G++++++   L   G +IS    L+   +   + + + T + + + ++GL
Sbjct: 74  IHEVLIGLMIGMVLKLFVSSLTTAGEIISIQTTLSFAQTANPAGAPSSTAVATFLSMLGL 133

Query: 134 LALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLFFY 193
           + + V D HH    A+VKSY   P  + +   +  +  V  +  +F + ++L++P L F 
Sbjct: 134 VLIMVTDLHHLFIGAMVKSYDIFPFSRAIPVNDAATLAVRTVADSFKLGVQLAAPVLVFS 193

Query: 194 IVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           IVFN++ GL+ +++P   I+F+++P  + LG   L LS+  I   ++  +    
Sbjct: 194 IVFNLATGLVGRVMPSFQIFFVTSPLSVILGLSLLGLSLGGIAMVWTDRYRDLL 247


>gi|326791524|ref|YP_004309345.1| flagellar biosynthetic protein FliR [Clostridium lentocellum DSM
           5427]
 gi|326542288|gb|ADZ84147.1| flagellar biosynthetic protein FliR [Clostridium lentocellum DSM
           5427]
          Length = 261

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 100/227 (44%), Gaps = 1/227 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           L +I CR+ + ++ LP +  S IP        +  +I +   + D   +        Y+ 
Sbjct: 14  LLIIFCRIIAAVLFLPIIEESRIPKLATSGLCLCLAITVF-MVTDLGQIYYEPTLISYTI 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           L++ E  +G + G ++++Y    QF GS+ ST  GL +  ++     +    L     + 
Sbjct: 73  LLLKETLVGLIIGFVLKIYFQIYQFIGSLWSTQGGLGMSMALDPVGGVQTPVLGRFYNLC 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
                 +   +H     L+ ++  IPI + +   ++ +  ++ +    +I   L+ P L 
Sbjct: 133 LCAIFVLSGGYHWFIKTLIDTFTLIPINKGVFGTHLVTGIIDTVGNYLLISFELAMPVLG 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQ 238
             I+ +  +G+L + VPQ+ ++ I  P  + +    L +++ ++   
Sbjct: 193 LLILIDFGLGILARTVPQMNMFVIGIPLKVIVLFALLIVTVGLVPRF 239


>gi|260855925|ref|YP_003229816.1| flagellar export pore protein FliR [Escherichia coli O26:H11 str.
           11368]
 gi|257754574|dbj|BAI26076.1| flagellar export pore protein FliR [Escherichia coli O26:H11 str.
           11368]
 gi|323152719|gb|EFZ38991.1| flagellar biosynthetic protein FliR [Escherichia coli EPECa14]
          Length = 261

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   L  ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLADTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P ++ +G   +   + +I     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLILTVGISLMAALMPLIAPFCEHLFSEMF 248


>gi|237751819|ref|ZP_04582299.1| flagellar biosynthetic protein FliR [Helicobacter bilis ATCC 43879]
 gi|229373185|gb|EEO23576.1| flagellar biosynthetic protein FliR [Helicobacter bilis ATCC 43879]
          Length = 258

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/238 (18%), Positives = 103/238 (43%), Gaps = 3/238 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +M+  +++ R G  +   P      +P+ VR   A   ++V +P +   I   +      
Sbjct: 13  VMAFLMLLLRFGGILAFFPFFDNQILPVSVRAALAFVLAVVFMPMVTHIISYPSLTA--- 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +    + E+ LG   GL++++    + F G + S ++GL + ++        +  ++ ++
Sbjct: 70  FMIGGLFEILLGFTCGLVLQIIFSSIVFAGDLASFSMGLTMASAYDPMSGTTKPIVSQVV 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
             + +L     +FH+ +   + ++    P+G  +   NI + F        +I   ++ P
Sbjct: 130 VFLSILMALHFNFHYLLLDIIARTLNDTPLGGFMLSDNIVAYFTKSFANMILIGFSMAFP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            +   ++ +I  G++ K  PQ  +  I  P  IG+  + L + +  I+  F +    G
Sbjct: 190 IIAVLLLTDIIFGMIMKTHPQFNLLVIGFPVKIGVALVILAIIVPSIMQHFRYDLSEG 247


>gi|225628421|ref|ZP_03786455.1| flagellar biosynthetic protein FliR [Brucella ceti str. Cudo]
 gi|254711211|ref|ZP_05173022.1| flagellar biosynthesis protein FliR [Brucella pinnipedialis B2/94]
 gi|256030160|ref|ZP_05443774.1| flagellar biosynthesis protein FliR [Brucella pinnipedialis
           M292/94/1]
 gi|256158339|ref|ZP_05456243.1| flagellar biosynthesis protein FliR [Brucella ceti M490/95/1]
 gi|256252727|ref|ZP_05458263.1| flagellar biosynthesis protein FliR [Brucella ceti B1/94]
 gi|260166788|ref|ZP_05753599.1| flagellar biosynthesis protein FliR [Brucella sp. F5/99]
 gi|261219805|ref|ZP_05934086.1| flagellar biosynthetic protein FliR [Brucella ceti B1/94]
 gi|261318802|ref|ZP_05957999.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis B2/94]
 gi|261756165|ref|ZP_05999874.1| flagellar biosynthesis protein FliR [Brucella sp. F5/99]
 gi|265987191|ref|ZP_06099748.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis
           M292/94/1]
 gi|265996854|ref|ZP_06109411.1| flagellar biosynthetic protein FliR [Brucella ceti M490/95/1]
 gi|225616267|gb|EEH13315.1| flagellar biosynthetic protein FliR [Brucella ceti str. Cudo]
 gi|260918389|gb|EEX85042.1| flagellar biosynthetic protein FliR [Brucella ceti B1/94]
 gi|261298025|gb|EEY01522.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis B2/94]
 gi|261736149|gb|EEY24145.1| flagellar biosynthesis protein FliR [Brucella sp. F5/99]
 gi|262551151|gb|EEZ07312.1| flagellar biosynthetic protein FliR [Brucella ceti M490/95/1]
 gi|264659388|gb|EEZ29649.1| flagellar biosynthetic protein FliR [Brucella pinnipedialis
           M292/94/1]
          Length = 255

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 136/237 (57%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +    +   +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  I+++  +  L 
Sbjct: 70  PWTLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSITENEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|32266203|ref|NP_860235.1| flagellar biosynthesis protein FliR [Helicobacter hepaticus ATCC
           51449]
 gi|32262253|gb|AAP77301.1| flagellar biosynthetic protein FliR [Helicobacter hepaticus ATCC
           51449]
          Length = 258

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 97/240 (40%), Gaps = 3/240 (1%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +    L++ R G      P      I + +R       S+   P    T+     V    
Sbjct: 13  VAVFLLLIARFGGVFAFFPFFDNQLISIHIRAAMVFFMSVAFFPLATYTLPDMTMVE--- 69

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
           +    + E+ LG +  + +++    L F G +IS  +G  + ++        +  +  LI
Sbjct: 70  FLIAALFEIMLGFIASVCLQIVFAMLSFGGEIISFTMGFTMASAYDPVSGTQKPIIAQLI 129

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            IIGLL    +DFHH +F  +  S    P+G  +      + FV      F +   ++ P
Sbjct: 130 AIIGLLVALSLDFHHTIFLIISHSIEATPLGGFVFEPKSAAYFVKAFSNIFAVGFSMAFP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGFF 248
            L   ++ +I  G++ K  PQ  +  I  P  I +  + L L+I  I+Y F +     FF
Sbjct: 190 ILAIILLSDIIFGMIMKTHPQFNLLVIGFPVKIAIAFVVLVLTISTIMYTFKNELKNAFF 249


>gi|310767332|gb|ADP12282.1| flagellar biosynthesis protein FliR [Erwinia sp. Ejp617]
          Length = 261

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 108/240 (45%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +  LF  + RV + IM  P LS   +  +V++   +  + VL+P L  T      +   
Sbjct: 12  WISQLFWPLARVLALIMTAPLLSEKSVSRKVKIGLGVMITWVLIPSLPPT---NVTLFSV 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   
Sbjct: 69  GGFWLLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   +  S+ T+PIG E   GN F +        F+  +RL+ 
Sbjct: 129 LDMLAMLLFLSFNGHLWLISMVADSFQTLPIGGEPLNGNAFMALTKAANIIFLNGMRLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRVSPQLSVFAIGFPVTLSVGMIFIILMMPLLAPFCEHLFSEIF 248


>gi|261341517|ref|ZP_05969375.1| flagellar biosynthetic protein FliR [Enterobacter cancerogenus ATCC
           35316]
 gi|288316315|gb|EFC55253.1| flagellar biosynthetic protein FliR [Enterobacter cancerogenus ATCC
           35316]
          Length = 257

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 100/234 (42%), Gaps = 2/234 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAY 68
           +++L     R+ + +   P L       +++   A+A + ++ P L + + L   +    
Sbjct: 12  LLALVFPFFRILAFLHFCPVLDNRAFSRRIKTVLALALAAIITPMLPEKV-LITELMSMR 70

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              L+  +L  G + G+ +++  + LQ  G ++S  +GL +       +  + T ++ +I
Sbjct: 71  TVLLIGEQLLWGMLFGMAMQLVFVALQTAGHILSMNMGLGMAMMNDPVNGSSTTVISQMI 130

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
                L  +V+D H  V   L K +   PIGQ +N   +    V  L         ++ P
Sbjct: 131 YTFCGLLFFVMDGHLLVVTILYKGFVWWPIGQAINKPTLL-LIVQSLGWIMSSATLIAIP 189

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
             F  ++     GLLN++ P + ++ +  P  +  G L + + +  I   + + 
Sbjct: 190 TTFVMLIVQGGFGLLNRVSPTLNLFSLGFPISMLFGLLCISMMMTNIPDHYLNL 243


>gi|59712447|ref|YP_205223.1| flagellar biosynthesis protein FliR [Vibrio fischeri ES114]
 gi|59480548|gb|AAW86335.1| flagellar export pore protein FliR [Vibrio fischeri ES114]
          Length = 260

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 92/239 (38%), Gaps = 1/239 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            + + F    R+ + +M++      ++  ++RL   ++ +  ++P +         V+  
Sbjct: 11  FIATYFWPYTRISAMLMVMSVFGARFVSPRIRLYLGLSITFAVMPAIPAMPPGIQLVSFQ 70

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
            +      ++ +G   G++    T      G ++     L   + +  ++      L  L
Sbjct: 71  GFMTTA-EQIIIGVAMGMVTVFVTQTFVLLGQILGMQSSLGFASMVDPANGQNTPLLGQL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
              + +L     D H ++   +V S+ T+P+G        + S  + L       L +S 
Sbjct: 130 FMFLSILFFLGTDGHLKMINFVVMSFTTLPVGVGKLTSVDYQSMASWLGIMMKAGLSMSL 189

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             +   +  N+S G++ +  PQ+ I+ +   + + +G L     I  +   +   +L  
Sbjct: 190 SGIIALLTVNLSFGVMTRAAPQLNIFSLGFAFALLVGLLLTSYIILGLFNHYDLHWLRA 248


>gi|188526977|ref|YP_001909664.1| flagellar biosynthesis protein FliR [Helicobacter pylori Shi470]
 gi|188143217|gb|ACD47634.1| flagellar biosynthesis protein FliR [Helicobacter pylori Shi470]
          Length = 255

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 51/236 (21%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L I  I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIISAIMGRFKEEISLAF 248


>gi|299066524|emb|CBJ37714.1| putative flagellar biosynthetic protein fliR [Ralstonia
           solanacearum CMR15]
          Length = 282

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 96/240 (40%), Gaps = 1/240 (0%)

Query: 9   MMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLW-DTIDLQNFVNRA 67
           + ++ L+  R+G+  +  P L  + +P  VR+   +A +  L   L    +      +  
Sbjct: 14  LETVLLLSLRLGAAFLATPMLPAAGVPTVVRVLVVLALATALSFSLPGADMAQSVPGHLG 73

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
              +  + EL LG    L I +        G ++   IG  +   +  + +      +++
Sbjct: 74  SLVEAALSELALGMTLALGILLAFAAFTTAGQLLDVQIGFGMSQVLDPATNARMPIFSTV 133

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
                ++  ++++ HH +   L  S    P+ Q   F +  +     +     +   L++
Sbjct: 134 YNQAAVVVFFLVNGHHALLRGLAYSLERFPLAQPWPFASALAPITKQVVGLLGLSFALAA 193

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +F  ++  +++G++ K +PQ+ +  +  P  I +G +   L    I    +  +   +
Sbjct: 194 PVVFCLLLTEMALGVVAKNLPQMNMLTMGIPVKIVVGVIAGSLWFAGIGNMMTRVYDEIY 253


>gi|109946963|ref|YP_664191.1| flagellar biosynthesis protein FliR [Helicobacter acinonychis str.
           Sheeba]
 gi|109714184|emb|CAJ99192.1| flagellar biosynthesis protein [Helicobacter acinonychis str.
           Sheeba]
          Length = 255

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +       +   +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNATYTPES---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + +         +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASVYDPISGAQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFIIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L +  I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIVSAIMGRFKDEISLAF 248


>gi|320182733|gb|EFW57617.1| Flagellar biosynthesis protein FliR [Shigella boydii ATCC 9905]
          Length = 261

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 104/240 (43%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +   F  + RV + I   P LS   +P +V+L  AM  +  + P L         V   
Sbjct: 12  WLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPAN---DVPVFSF 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
           +   L + ++ +G   G  ++     ++  G +I   +GL+  T +  +  L    L  +
Sbjct: 69  FALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHLNMPVLARI 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   LV ++ T+PIG E    N F +        F+  L L+ 
Sbjct: 129 MDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIFLNGLMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ I  P  + +G   +   + ++     H F   F
Sbjct: 189 PLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMSLVAPFCEHLFSEMF 248


>gi|225569960|ref|ZP_03778985.1| hypothetical protein CLOHYLEM_06055 [Clostridium hylemonae DSM
           15053]
 gi|225161430|gb|EEG74049.1| hypothetical protein CLOHYLEM_06055 [Clostridium hylemonae DSM
           15053]
          Length = 257

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 103/246 (41%), Gaps = 2/246 (0%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M ++     +   L++ R+   + L P L    IP   +   A+  ++V+ P        
Sbjct: 1   MLLAGTPEFLVFTLVLMRMSGFVFLNPILGRKNIPAVFKTGLALVLALVVYP--QAEPAG 58

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
           +   +   Y+ L++ E  LG + G +++++ + + F GSVI   +GL++ T     +   
Sbjct: 59  EEVTSAVVYAVLLLKEFALGYLLGFVMQLFDMVVSFAGSVIDFQMGLSMATVYDAQNGTQ 118

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFM 180
                +++ I  LL  + +D H  +   L+ S   +P            + + +     +
Sbjct: 119 IALTGNILQIYYLLLFFAVDGHLALLKILMTSQDIVPYAALKLGTGSAQAVLQIFTECVV 178

Query: 181 IMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFS 240
           + ++L+ P + F  +  ++ GLL +++PQI ++ +S    + +G   +   I        
Sbjct: 179 LAVKLAFPIIAFEFLVEVATGLLMRIIPQINLFVMSIQLRVIIGLAMMVFLISPAGDYLK 238

Query: 241 HSFLYG 246
                 
Sbjct: 239 GIISQM 244


>gi|259908770|ref|YP_002649126.1| flagellar biosynthesis protein FliR [Erwinia pyrifoliae Ep1/96]
 gi|224964392|emb|CAX55901.1| Flagellar biosynthesis protein [Erwinia pyrifoliae Ep1/96]
 gi|283478746|emb|CAY74662.1| Flagellar biosynthetic protein FliR [Erwinia pyrifoliae DSM 12163]
          Length = 261

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 107/240 (44%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
            +  LF  + RV + IM  P LS   I  +V++   +  + VL+P L  T      +   
Sbjct: 12  WISQLFWPLARVLALIMTAPLLSEKSISRKVKIGLGVMITWVLIPSLPPT---NVTLFSV 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L++ ++ +G   G  ++     ++  G VI   +GL+  T       L    L   
Sbjct: 69  GGFWLLIQQILIGVAIGFTMQFAFAAVRTAGEVIGLQMGLSFATFFDPGSRLNMPVLARF 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ +L     + H  +   +  S+ T+PIG E   GN F +        F+  +RL+ 
Sbjct: 129 LDMLAMLLFLSFNGHLWLISMVADSFQTLPIGGEPLNGNAFMALTKAANIIFLNGMRLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+ +GLLN++ PQ+ ++ I  P  + +G +F+ L + ++     H F   F
Sbjct: 189 PLITLLLTLNLGLGLLNRVSPQLSVFAIGFPVTLSVGMIFIILMMPLLAPFCEHLFSEIF 248


>gi|297620335|ref|YP_003708472.1| putative type III secretion inner membrane protein SctT [Waddlia
           chondrophila WSU 86-1044]
 gi|297375636|gb|ADI37466.1| putative type III secretion inner membrane protein SctT [Waddlia
           chondrophila WSU 86-1044]
          Length = 281

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/246 (20%), Positives = 100/246 (40%), Gaps = 7/246 (2%)

Query: 2   TISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQ 61
              P  + + LFL + R+   I L P      +P  V+L FA++   + +P L   +   
Sbjct: 16  IEDPGAVFILLFLFLARILPIIALSPFFGARVLPHPVKLAFAISLFAIFVPHLL-VVTQS 74

Query: 62  NFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAE 121
                     L   ELF+G + G LI +    +Q  G +I    G         +     
Sbjct: 75  KLSFTPLSLALFAKELFVGYLIGFLISIPFTIVQTAGMLIDHQRGGASLMVNDPTIQNQS 134

Query: 122 TPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFG------NIFSSFVNML 175
           +PL ++  ++ +   ++ID       A+  SY  IP  +  N                +L
Sbjct: 135 SPLGTMFNMVLIYIFFMIDGPFYFIDAINTSYSAIPPDRFFNPQFFDKSSAFSEIAFQLL 194

Query: 176 QTTFMIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEII 235
               ++ ++ +SP L   ++ ++ +G+ N+L  Q+ I F+  P    LG   + +  +++
Sbjct: 195 NNAMVLAIQFASPALIAILMTDVFLGIANRLATQVQITFLGLPLKSLLGLTLITIGWKVL 254

Query: 236 VYQFSH 241
           + Q + 
Sbjct: 255 INQMAE 260


>gi|254720780|ref|ZP_05182591.1| flagellar biosynthesis protein FliR [Brucella sp. 83/13]
 gi|265985839|ref|ZP_06098574.1| flagellar biosynthetic protein FliR [Brucella sp. 83/13]
 gi|306840129|ref|ZP_07472914.1| flagellar biosynthetic protein FliR [Brucella sp. NF 2653]
 gi|264664431|gb|EEZ34692.1| flagellar biosynthetic protein FliR [Brucella sp. 83/13]
 gi|306404774|gb|EFM61068.1| flagellar biosynthetic protein FliR [Brucella sp. NF 2653]
          Length = 255

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 75/237 (31%), Positives = 136/237 (57%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PG+S + IP+QVRL  A+A S  +LP +    +   +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGISSARIPLQVRLFIALACSFAVLPLVLQRIVTAVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L++ E+F+G + G+L  +Y   LQF  ++++ A+G +   +  ++++  +  L 
Sbjct: 70  PWMLFRLMVGEMFIGALIGILAHIYFWALQFMANMMAMAVGYSGSPADSVTENEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   +V D H ++F AL+ SY  IP+            F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFVTDMHLEIFRALLNSYVAIPVDGRFRPDAAMIDFTDALSAAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YFIS P+++G G L +   +  ++  F+H 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPAIPVYFISMPFVLGGGLLVVYFILPELLRFFTHE 246


>gi|190574227|ref|YP_001972072.1| putative flagellar biosynthetic protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012149|emb|CAQ45772.1| putative flagellar biosynthetic protein [Stenotrophomonas
           maltophilia K279a]
          Length = 257

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 88/237 (37%), Gaps = 3/237 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
            ++ ++   + R+G+  M +P +    +P ++R+  A   +I L P L    D   F   
Sbjct: 10  GMIGTVLWTMLRIGAVAMAMPMVGTRAVPARIRVILAGTLAIALAPLLPPVPDWTGFD-- 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
           A     +  EL +G   G L+R+        G +I+   GL                +  
Sbjct: 68  AATVLTIARELAIGVSIGFLLRLVFEAGAMAGELIAQGTGLAFAQMSDPLRGGTSGVIGQ 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFV-NMLQTTFMIMLRL 185
              ++  L  +  + H  +   +V SY  +PIG  L   + F S     L T     L L
Sbjct: 128 WFYLLFGLLFFTANGHLALISLVVDSYRALPIGAPLPDPHAFFSIAPTFLLTVLRGALTL 187

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           + P     +  N++ G+L +  P +    +  P  + LG   L L    +       
Sbjct: 188 AIPLTVAMLAVNLAFGVLARAAPALNPIQLGLPVSLLLGLFLLALLAGEMGPPVQRL 244


>gi|283850713|ref|ZP_06368000.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. FW1012B]
 gi|283573956|gb|EFC21929.1| flagellar biosynthetic protein FliR [Desulfovibrio sp. FW1012B]
          Length = 259

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 102/238 (42%), Gaps = 1/238 (0%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++ S  L + R+   + LLP    + +P  V+    +  ++ + P L     L    N  
Sbjct: 10  LVFSFLLTLMRISVVLFLLPFFGANLLPNPVKGALCLLLTLAVFPMLSFPAALM-PANPW 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
             + + + E+ +G +  +L+      +Q  G+++  ++G +L  S+      +E+ L  L
Sbjct: 69  TLALMFLGEVIMGLLLDILVMFLFSAVQCAGAIMGFSMGFSLMNSIDPMTGASESGLGHL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           +  +  +    ++ H  +   + +S+  +P G       +    +      F++ L++++
Sbjct: 129 MNQVTTMLFLCLNGHLFLLDCMAQSFTLVPPGGLFLSPALGEHLIAFSGQIFVMALKIAA 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           P +    + ++++ L+ +  PQ+ + FI  P  I +G LF+ L    +          
Sbjct: 189 PIMASIFMVDLALALVARAAPQMNVLFIGFPLKISVGFLFMTLVFGALAVYVGQYIAE 246


>gi|167630309|ref|YP_001680808.1| flagellar biosynthetic protein flir [Heliobacterium modesticaldum
           Ice1]
 gi|167593049|gb|ABZ84797.1| flagellar biosynthetic protein flir [Heliobacterium modesticaldum
           Ice1]
          Length = 266

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 99/240 (41%), Gaps = 4/240 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
           L L++ RV   ++L P  +        ++  +   +++L   + D            Y  
Sbjct: 15  LLLMMIRVAGILVLAPVFNFPGFNNLAKIGLSFMIALILFLSMPDGALPVPPQELFGYVI 74

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +V  EL LG   G ++++    +   G +I   +G  +   +              + I+
Sbjct: 75  VVAQELLLGLAIGFILQLLFAAILTAGHLIDIQLGFGIVNIIDPLWGAQVPMTGVFLQIL 134

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNF----GNIFSSFVNMLQTTFMIMLRLSS 187
            LL   + D H  +   L  S+  +P           G+I    V ++    +I ++L+ 
Sbjct: 135 ALLIFVIFDGHLLLIQVLADSFRILPAAGSPFSLALAGSISDFIVRLVSGVLLIGVQLAM 194

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   ++ +I++GL+++ VPQ+ ++ I  P  I +G  FL +++   +   +  F   F
Sbjct: 195 PIIGIILINDIALGLVSRTVPQMNLFVIGIPLKIIVGVAFLWITLPFYIDGLNRLFTLSF 254


>gi|154175030|ref|YP_001407663.1| flagellar biosynthesis protein FliR [Campylobacter curvus 525.92]
 gi|112803591|gb|EAU00935.1| flagellar biosynthetic protein FliR [Campylobacter curvus 525.92]
          Length = 253

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 90/236 (38%), Gaps = 5/236 (2%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
           ++  L+  R+   I+  P  S + IP+  R        IV  P         NF      
Sbjct: 13  ITFMLLFARLSGLIVFFPFYSYNQIPLTARTLLVFMLCIVFFPMSHAHEHAINF-----L 67

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
              ++ E  LG   GL++ +    LQ  G  IS  +G ++ T +      +   + ++I 
Sbjct: 68  FVEILSEAMLGLCAGLMLTIVFATLQMAGEQISMVMGFSMATVLDPQTGASSPVIANMIN 127

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
            + LL   + D HH +      S   +P+G       + S  + +    FM    LS P 
Sbjct: 128 FLALLTFLMFDGHHLLLQFYAASLAHVPLGDFYPSAGVMSYALKIFANLFMFGFILSFPI 187

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           +   ++ +   G+L K +PQ  +  +  P  I +G   L   +  ++       L 
Sbjct: 188 IALSLLSDSIFGMLMKTMPQFNLLVVGYPIKITIGFAVLIAILAGMMKIVGDMLLQ 243


>gi|302387777|ref|YP_003823599.1| flagellar biosynthetic protein FliR [Clostridium saccharolyticum
           WM1]
 gi|302198405|gb|ADL05976.1| flagellar biosynthetic protein FliR [Clostridium saccharolyticum
           WM1]
          Length = 253

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 103/241 (42%), Gaps = 2/241 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             MM   LI  R+   I+L P L     P  V+    M F++++  F    +     VN 
Sbjct: 5   GQMMLFSLIFMRMSGFILLNPILGRRNTPNVVKGGMIMVFTLLVYSFSAAQVP--EPVNS 62

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
             ++ L++ E  +G   G ++ ++ + + F G +I   +GL++ T      +       S
Sbjct: 63  IEFAVLMIKEFIMGYTIGFVMDLFLMVITFAGHIIDFQMGLSMATIYDPQSNTQIAITGS 122

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
           L     +L  + +D H  +   L+KS  T+P GQ +    +  + + +     ++ ++ S
Sbjct: 123 LWNAYFMLLFFAVDGHLALIKLLIKSAETVPYGQVVIGTKVAWAMIEVFIQCIIMAIKFS 182

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +    +  I++G+L K++PQI ++ ++    + +G L L      +           
Sbjct: 183 LPIVAIEFITEIAVGILMKMIPQINVFVVNIQAKLVIGLLMLIFLFSPMSDYLGDVINQM 242

Query: 247 F 247
            
Sbjct: 243 L 243


>gi|289578416|ref|YP_003477043.1| flagellar biosynthetic protein FliR [Thermoanaerobacter italicus
           Ab9]
 gi|297544692|ref|YP_003676994.1| flagellar biosynthetic protein FliR [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289528129|gb|ADD02481.1| flagellar biosynthetic protein FliR [Thermoanaerobacter italicus
           Ab9]
 gi|296842467|gb|ADH60983.1| flagellar biosynthetic protein FliR [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 260

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/244 (18%), Positives = 101/244 (41%), Gaps = 3/244 (1%)

Query: 1   MTISPEIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDL 60
           M       +    L+  R+    +L P      +P   ++      ++++   +      
Sbjct: 3   MIQYLLQSVQVFILLFVRMLGIFILTPFFGTKNVPTIFKIGLGFFAAVIVFDTMGSV--D 60

Query: 61  QNFVNRAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLA 120
               N   Y  +V+ E  +G V GL   +    +   G +I   +G  +   + I     
Sbjct: 61  LQTNNVFDYFIVVISEFTVGLVIGLASMISFSAIHLAGQLIDYQLGFGIVNILDIHSEAQ 120

Query: 121 ETPLNSLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQ-ELNFGNIFSSFVNMLQTTF 179
              + + I I+ +L   +++ H+ +F  L KS   IPIG+   N   +      M+   F
Sbjct: 121 VPLMGNFIYILTILIFMLMNGHYILFTMLAKSVDIIPIGEVAFNLSGMSQVMTKMVSDMF 180

Query: 180 MIMLRLSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
           ++  R+S+P +   ++ ++ +G++++ +PQ+ ++ I  P  I +G   L + + + +   
Sbjct: 181 ILGFRISAPIILTTLLSDLVLGIISRTIPQLNVFMIGMPAKIFVGIFTLLIMLPMYLAII 240

Query: 240 SHSF 243
              F
Sbjct: 241 DFMF 244


>gi|317181482|dbj|BAJ59266.1| flagellar biosynthesis protein FliR [Helicobacter pylori F57]
          Length = 255

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FIV 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|170021381|ref|YP_001726335.1| flagellar biosynthetic protein FliR [Escherichia coli ATCC 8739]
 gi|169756309|gb|ACA79008.1| flagellar biosynthetic protein FliR [Escherichia coli ATCC 8739]
          Length = 260

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 99/235 (42%), Gaps = 3/235 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           + + L+    R+ + +  +P L  S + ++VR+  ++A +I++ P +   I        +
Sbjct: 12  LALGLWFPFVRIMAFLRYVPVLDNSALTVRVRIILSLALAIIITPLIPHPIPHDLLSLNS 71

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++  G + GL+ +   L LQ  G ++S  +G+++      S   + T L  L
Sbjct: 72  --LILTVEQILWGMLFGLMFQFLFLALQLAGQILSFNMGMSMAVMNDPSSGASTTVLAEL 129

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           I +  +L  + +D H  +   L K +   PIG  L+      +              L+ 
Sbjct: 130 INVYAILLFFAMDGHLLLVSVLFKGFTYWPIGNALHPQ-TLRTIALAFSWVLASASLLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           P  F  ++     GLLN++ P + ++ +  P  +  G +     +  +   + H 
Sbjct: 189 PTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINMLAGLVCFATLLYNLPDHYLHL 243


>gi|238752377|ref|ZP_04613855.1| Type III secretion protein SpaR/YscT/HrcT [Yersinia rohdei ATCC
           43380]
 gi|238709418|gb|EEQ01658.1| Type III secretion protein SpaR/YscT/HrcT [Yersinia rohdei ATCC
           43380]
          Length = 267

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 96/235 (40%), Gaps = 3/235 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYI-PMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             + +L L + R    +++LP  +   +    +R     A ++ + P    T  +     
Sbjct: 6   HWLGALGLAMMRPYGMLLILPLFTARSLGSSLLRNGLVFAIALPVTPLFSPTSLVAQDTL 65

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A++  L M EL +G + G +  +    +   G +I T  G  + T    S  +  +   
Sbjct: 66  TAWFWVLCM-ELLIGVMIGFVAAIPFWAIDMAGFMIDTLRGATMSTLFNPSMGMESSIFG 124

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQEL-NFGNIFSSFVNMLQTTFMIMLR 184
            L   +  +   +    + V  AL  SY  +P G  +     +     N  Q  + + L 
Sbjct: 125 VLFTQLLTVLFLISGGFNLVLSALYSSYDILPAGTIIQPSSAMLQFLQNEWQLMYELCLS 184

Query: 185 LSSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQF 239
            + P L   ++ ++S+GL+N+   Q+ ++F++ P    L    L +S+   ++ +
Sbjct: 185 FALPALLVMVLADLSLGLINRSSQQLNVFFLAMPIKSALALFLLVISLPYALHHY 239


>gi|209545553|ref|YP_002277782.1| putative flagellar biosynthetic protein FliR [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533230|gb|ACI53167.1| putative flagellar biosynthetic protein FliR [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 253

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 52/233 (22%), Positives = 105/233 (45%), Gaps = 3/233 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD---TIDLQNFVNRAY 68
             +++CRV + +M  PGL  +  PM+VR   A++ ++ +LP + D    +        + 
Sbjct: 2   FLVVLCRVSALVMAAPGLGETTSPMRVRAGIAVSATVAILPVVQDRLVEVSGTALRMPSV 61

Query: 69  YSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLI 128
              +V+ EL  G   G L R+ T+ +     V++   GL            + T ++ + 
Sbjct: 62  AIAVVVGELLCGVFIGWLARLVTMAISIAMQVVAVFTGLASVLQPDSELGASSTAISHMA 121

Query: 129 GIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSP 188
            ++  +       +     A+  SY   P G     G++  S       TF + L+L++P
Sbjct: 122 SMLIPVIFLSTGLYALPLAAITGSYSLFPPGHMPMVGDMARSVTEATSQTFALALQLAAP 181

Query: 189 FLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSH 241
           F+    ++   +G+LN+L+P I +Y I+ P  +  G + L + I+++   +  
Sbjct: 182 FVLIGTLWPAMLGVLNRLLPSIQVYSIAMPAQLLGGVILLAMLIQVMTGVWQE 234


>gi|15644802|ref|NP_206972.1| flagellar biosynthesis protein FliR [Helicobacter pylori 26695]
 gi|2313256|gb|AAD07238.1| flagellar biosynthetic protein (fliR) [Helicobacter pylori 26695]
          Length = 255

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|254778887|ref|YP_003056992.1| flagellar biosynthesis protein FliR [Helicobacter pylori B38]
 gi|254000798|emb|CAX28722.1| Flagellar biosynthetic protein FliR; putative membrane protein
           [Helicobacter pylori B38]
          Length = 255

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|207092537|ref|ZP_03240324.1| flagellar biosynthesis protein FliR [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 255

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|239834419|ref|ZP_04682747.1| flagellar biosynthetic protein FliR [Ochrobactrum intermedium LMG
           3301]
 gi|239822482|gb|EEQ94051.1| flagellar biosynthetic protein FliR [Ochrobactrum intermedium LMG
           3301]
          Length = 255

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 78/237 (32%), Positives = 137/237 (57%), Gaps = 1/237 (0%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWD-TIDLQNFVN 65
            I+++  L  CR+G+C+ML+PGLS + IP+QVRL  A+A S  +LP +    I + +   
Sbjct: 10  EIILAAVLAFCRIGACLMLMPGLSSARIPLQVRLFIALACSFAVLPLVLQRIITVVDAGQ 69

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
                +L+  E+F+G V G+L  +Y   LQF  S ++ +IG +   +  I++S  +  L 
Sbjct: 70  PLTLFRLMASEIFIGAVIGILAHIYFWALQFMASTMAVSIGYSGSPADAITESEPQATLA 129

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
           +++    L   ++ D H ++F AL+ SY  IP+  +     +   F + L   F+  LR+
Sbjct: 130 TIVTFSALFLFFITDMHLEIFRALLNSYVAIPVDGQFRPDAVMIDFTDALSGAFLATLRI 189

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHS 242
           ++PF+ F I+ N +IGL+NKL P IP+YF+S P+++G G L +   +  ++  F++ 
Sbjct: 190 AAPFIVFAILVNFAIGLVNKLTPTIPVYFVSMPFVLGGGLLVVYFILPELLRFFTNE 246


>gi|229827382|ref|ZP_04453451.1| hypothetical protein GCWU000182_02770 [Abiotrophia defectiva ATCC
           49176]
 gi|229788320|gb|EEP24434.1| hypothetical protein GCWU000182_02770 [Abiotrophia defectiva ATCC
           49176]
          Length = 260

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 54/235 (22%), Positives = 99/235 (42%), Gaps = 2/235 (0%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
              IV RV + +   P  +   IP Q+++ F + FS +L   L  T     +     ++ 
Sbjct: 15  FLFIVTRVSAFVFTSPFFNFGSIPRQLKVAFTLIFSALLYLTLPYT--EVRYPGIIGFTF 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
           +VM E   G + G    +    L FTG +I   IG  + T       +  +   +L    
Sbjct: 73  MVMSEALAGGMLGYFTNIVMTILNFTGRLIDMEIGFAMVTMFDPVFKVDTSVSGNLYNYF 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L + +FHH    A V +Y  IPIG+ +   N  +   + L   F+I +RL  P   
Sbjct: 133 TILLLLIGNFHHYFLAAFVDAYKVIPIGRAMVNANTVNVIADFLGNYFLIAMRLMLPIYA 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
             ++ N  +G++ K+ PQ+ ++ +     + +G   + L   ++     +     
Sbjct: 193 TMLLVNAVLGVMAKVAPQMNMFVVGIQLKLLVGLAVMVLMTSMLPGVADYLTKEM 247


>gi|308183969|ref|YP_003928102.1| flagellar biosynthesis protein FliR [Helicobacter pylori SJM180]
 gi|308059889|gb|ADO01785.1| flagellar biosynthesis protein FliR [Helicobacter pylori SJM180]
          Length = 255

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L I  I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGVILIISAIMGRFKEEISLAF 248


>gi|317179432|dbj|BAJ57220.1| flagellar biosynthesis protein FliR [Helicobacter pylori F30]
          Length = 255

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNATYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIIGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|154253016|ref|YP_001413840.1| flagellar biosynthesis protein FliR [Parvibaculum lavamentivorans
           DS-1]
 gi|154156966|gb|ABS64183.1| flagellar biosynthetic protein FliR [Parvibaculum lavamentivorans
           DS-1]
          Length = 253

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 118/236 (50%), Gaps = 1/236 (0%)

Query: 10  MSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYY 69
            +  L+  R+ + IML+P L  + IP QVRL  A+  S V++P +  +            
Sbjct: 12  FTFMLVFSRLAAMIMLMPALGEASIPAQVRLMLALLLSFVMMPLVAGSYGAI-PATVPGL 70

Query: 70  SKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIG 129
             +V  E+ +G   G   R+    L   G++I+  + L+   ++  S       + + + 
Sbjct: 71  VFIVCSEIAVGLFIGTAARLIMSALHVAGNIIAAQMSLSFAMNVDPSQGQQGVLIANFLS 130

Query: 130 IIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPF 189
           ++G+  ++  +  H +  A+  SY     G+ +  G+  +  V M+  +F + L+L++PF
Sbjct: 131 LLGVTLIFATNLDHVLIAAMRDSYELFKPGEPIPVGDFLAMAVKMVSGSFRLGLQLAAPF 190

Query: 190 LFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           L F ++F + IG+L++L+PQI I+FI+ P  I LG + L L +  ++  F   F  
Sbjct: 191 LVFGLIFYLGIGILSRLMPQIQIFFIAMPANIALGFILLLLLLGALMTWFLQGFEQ 246


>gi|308063034|gb|ADO04921.1| flagellar biosynthesis protein FliR [Helicobacter pylori Sat464]
          Length = 255

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 98/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + +      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIIKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L I  I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIISAIMGRFKEEISLAF 248


>gi|217031933|ref|ZP_03437435.1| hypothetical protein HPB128_3g52 [Helicobacter pylori B128]
 gi|298736884|ref|YP_003729414.1| flagellar biosynthetic protein FliR [Helicobacter pylori B8]
 gi|216946402|gb|EEC25007.1| hypothetical protein HPB128_3g52 [Helicobacter pylori B128]
 gi|298356078|emb|CBI66950.1| flagellar biosynthetic protein FliR [Helicobacter pylori B8]
          Length = 255

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|312884813|ref|ZP_07744505.1| putative flagellar biosynthetic protein FliR [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309367465|gb|EFP95025.1| putative flagellar biosynthetic protein FliR [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 258

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 103/242 (42%), Gaps = 3/242 (1%)

Query: 6   EIIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVN 65
             ++  L+    R+G+ ++ +P    S IP+ VR  FA+A  +V    +     +     
Sbjct: 9   SQMLGQLWWPFFRIGTALISMPFFGDSLIPVWVRSLFALAIVVVSASLMPAMPKVDLISF 68

Query: 66  RAYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLN 125
            A    L + ++  G   GL++          G ++S  +GL +       + L+   L 
Sbjct: 69  SA--IALALEQVLWGLFFGLILHFLFAVFTTLGQIVSMQMGLGMAIMNDPVNGLSVPILG 126

Query: 126 SLIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRL 185
            L  I   L    ++ H  +   LV+S+   P+G  L      ++ V+++   F   + L
Sbjct: 127 RLFLIFCTLLFLSLEGHLIIIDVLVQSFVIWPVGSGL-SALSLTNLVHLMTWMFASSVAL 185

Query: 186 SSPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLY 245
           + P +   ++ NIS G++N+  P + +Y +  P  + LG   + +SI  +  +++     
Sbjct: 186 ALPAIIAMLLANISFGVMNRAAPALNVYALGFPMTMLLGLFSILISISGVPDKYAELVND 245

Query: 246 GF 247
             
Sbjct: 246 TL 247


>gi|294636882|ref|ZP_06715212.1| flagellar biosynthetic protein FliR [Edwardsiella tarda ATCC 23685]
 gi|291089912|gb|EFE22473.1| flagellar biosynthetic protein FliR [Edwardsiella tarda ATCC 23685]
          Length = 261

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 102/240 (42%), Gaps = 3/240 (1%)

Query: 8   IMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRA 67
           ++   F    R+ +     P L    IP +VR+  A   + ++ P L  T      +   
Sbjct: 12  LLGQFFWPFVRLLALYSTAPLLGEKAIPRKVRIALAALTAFLIAPQLPPTT---ITLASG 68

Query: 68  YYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSL 127
               L + ++ +GC  GL +++    ++  G VI   +GL+  T    S       L  L
Sbjct: 69  GALWLAIQQILIGCAIGLTMQLAFAAVRLAGEVIGMQMGLSFATFFDPSGGPNMPVLARL 128

Query: 128 IGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSS 187
           + ++ LL     + H  +   L  S+ T+P+      GN F +        F+  + L+ 
Sbjct: 129 LNLLMLLLFLCFNGHLWIISLLADSFHTLPLSTAPLAGNGFLALAQSGHLIFLNGMMLAL 188

Query: 188 PFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
           P +   +  N+++GLLN++ PQ+ I+ +  P  + +G L L + I ++     H     F
Sbjct: 189 PLITLLLTLNMALGLLNRMTPQLSIFVVGFPLTLTIGMLTLGMLIPMLAPFTEHMLQTLF 248


>gi|291617860|ref|YP_003520602.1| FliR [Pantoea ananatis LMG 20103]
 gi|291152890|gb|ADD77474.1| FliR [Pantoea ananatis LMG 20103]
          Length = 261

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 101/241 (41%), Gaps = 3/241 (1%)

Query: 7   IIMMSLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNR 66
             +   F  + R+ + +   P LS   +  +V++  A   + +L+P L     +   +  
Sbjct: 11  HWVSQFFWPLVRILALLATAPVLSEKAVSKRVKIGLAAMITWILIPNLP---PVNVTLFS 67

Query: 67  AYYSKLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNS 126
                L++ ++ +G   G  ++     ++  G +I   +GL+  T    +  L    L  
Sbjct: 68  PAGFMLLIQQMLIGIAIGFTMQFAFAAVRTAGELIGLQMGLSFATFFDPASRLNMPVLAR 127

Query: 127 LIGIIGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLS 186
            + ++ +L ++        ++  V  +  +   +  + G     F  + Q  F+  + L+
Sbjct: 128 FLDMLAMLFIFDFQRSPVAYFPAVGQFSYVAYRRRASSGKCLYGFGEIRQHDFLNGMMLA 187

Query: 187 SPFLFFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYG 246
            P +   +  N+ +GLLN+L PQ+ I+ I  P  + +G L + L + ++     H F   
Sbjct: 188 LPLIVLLLTINMVLGLLNRLSPQLSIFAIGFPITLSVGILTISLLMPLLAPFCEHLFGEI 247

Query: 247 F 247
           F
Sbjct: 248 F 248


>gi|108562594|ref|YP_626910.1| flagellar biosynthesis protein FliR [Helicobacter pylori HPAG1]
 gi|107836367|gb|ABF84236.1| flagellar biosynthetic protein [Helicobacter pylori HPAG1]
          Length = 255

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASVFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIVGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLRAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|317179977|dbj|BAJ57763.1| flagellar biosynthesis protein FliR [Helicobacter pylori F32]
          Length = 255

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 3/236 (1%)

Query: 12  LFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYSK 71
            FL+  RV   +   P      +P+ VR   ++  S +  P L  +           +  
Sbjct: 16  FFLLFLRVSGVLSFFPFFENHLVPLSVRGALSLYVSAIFYPTLEFSNAAYTPEG---FII 72

Query: 72  LVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGII 131
             + ELFLG    + +++    L F    IS ++GL + ++        +  +   + ++
Sbjct: 73  ACLCELFLGVCASIFLQIVFASLVFATDSISFSMGLTMASAYDPISGSQKPIIGQALLLL 132

Query: 132 GLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFLF 191
            +L L  + FHHQ+   +  S   +P+GQ +    +  + V      F+I   ++ P L 
Sbjct: 133 AILILLDLSFHHQIILFVDHSLKAVPLGQFVFEPALAKNIVKAFSHLFVIGFSMAFPILC 192

Query: 192 FYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSFLYGF 247
             ++ +I  G++ K  PQ  +  I  P  I +G + + L    I+ +F       F
Sbjct: 193 LVLLSDIIFGMIMKTHPQFNLLAIGFPVKIAIGFVGIILIASAIMGRFKEEISLAF 248


>gi|304316891|ref|YP_003852036.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778393|gb|ADL68952.1| flagellar biosynthetic protein FliR [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 260

 Score =  105 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 10