RPSBLAST alignment for GI: 254780511 and conserved domain: COG1684

>gnl|CDD|31870 COG1684, FliR, Flagellar biosynthesis pathway, component FliR [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 258
 Score =  112 bits (283), Expect = 6e-26
 Identities = 71/233 (30%), Positives = 111/233 (47%), Gaps = 3/233 (1%)

Query: 11  SLFLIVCRVGSCIMLLPGLSMSYIPMQVRLCFAMAFSIVLLPFLWDTIDLQNFVNRAYYS 70
           + FL   RV + +M +P  S   IP +VRL  A+A S  +LP L         +    + 
Sbjct: 14  AFFLPFVRVLAFLMTMPFFSERSIPARVRLGLALALSFAVLPLLPAVPAPLFSL---EFL 70

Query: 71  KLVMVELFLGCVHGLLIRVYTLGLQFTGSVISTAIGLNLQTSMGISDSLAETPLNSLIGI 130
            L + E+ +G   G   ++    LQF G +IS  +GL+  T +  S       L   +  
Sbjct: 71  LLALSEILIGLALGFFAQLLFAALQFAGEIISMQMGLSFATMVDPSSGEQSPLLGQFLNF 130

Query: 131 IGLLALWVIDFHHQVFYALVKSYGTIPIGQELNFGNIFSSFVNMLQTTFMIMLRLSSPFL 190
           + LL    +D H  +   LV S+  +P+G      N F      L   F+I LRL+ P +
Sbjct: 131 LALLLFLSLDGHLLLILGLVDSFKALPVGGFFLNDNAFLLLAKALSAIFLIGLRLALPII 190

Query: 191 FFYIVFNISIGLLNKLVPQIPIYFISTPYLIGLGSLFLCLSIEIIVYQFSHSF 243
              ++ N+++GLLN+L PQ+ ++FI  P  I +G L L L + +I   F H F
Sbjct: 191 ALLLLVNLALGLLNRLAPQLNVFFIGFPLKIAVGLLLLYLILPLIAPVFKHLF 243