BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780513|ref|YP_003064926.1| hypothetical protein
CLIBASIA_02000 [Candidatus Liberibacter asiaticus str. psy62]
         (66 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780513|ref|YP_003064926.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040190|gb|ACT56986.1| hypothetical protein CLIBASIA_02000 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 66

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN 60
          MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN
Sbjct: 1  MDKLDELNTKEFKCFLKNSRKKHITPSKDVVAKSIKKYEDRIRSSIDKKTFLTLSVYFEN 60

Query: 61 HLIRIF 66
          HLIRIF
Sbjct: 61 HLIRIF 66


>gi|126700355|ref|YP_001089252.1| putative histidyl-tRNA synthetase [Clostridium difficile 630]
 gi|254976335|ref|ZP_05272807.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-66c26]
 gi|255093720|ref|ZP_05323198.1| putative histidyl-tRNA synthetase [Clostridium difficile CIP
           107932]
 gi|255101911|ref|ZP_05330888.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-63q42]
 gi|255307780|ref|ZP_05351951.1| putative histidyl-tRNA synthetase [Clostridium difficile ATCC
           43255]
 gi|255315472|ref|ZP_05357055.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-76w55]
 gi|255518135|ref|ZP_05385811.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-97b34]
 gi|255651251|ref|ZP_05398153.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-37x79]
 gi|255656727|ref|ZP_05402136.1| putative histidyl-tRNA synthetase [Clostridium difficile QCD-23m63]
 gi|260684315|ref|YP_003215600.1| putative histidyl-tRNA synthetase [Clostridium difficile CD196]
 gi|260687974|ref|YP_003219108.1| putative histidyl-tRNA synthetase [Clostridium difficile R20291]
 gi|296452446|ref|ZP_06894147.1| histidine--tRNA ligase [Clostridium difficile NAP08]
 gi|296877795|ref|ZP_06901821.1| histidine--tRNA ligase [Clostridium difficile NAP07]
 gi|306521095|ref|ZP_07407442.1| histidyl-tRNA synthetase [Clostridium difficile QCD-32g58]
 gi|122973671|sp|Q183H5|SYH_CLOD6 RecName: Full=Histidyl-tRNA synthetase; AltName:
           Full=Histidine--tRNA ligase; Short=HisRS
 gi|115251792|emb|CAJ69627.1| Histidyl-tRNA synthetase (Histidine--tRNA ligase) (HisRS)
           [Clostridium difficile]
 gi|260210478|emb|CBA64951.1| putative histidyl-tRNA synthetase [Clostridium difficile CD196]
 gi|260213991|emb|CBE06103.1| putative histidyl-tRNA synthetase [Clostridium difficile R20291]
 gi|296258776|gb|EFH05670.1| histidine--tRNA ligase [Clostridium difficile NAP08]
 gi|296431246|gb|EFH17067.1| histidine--tRNA ligase [Clostridium difficile NAP07]
          Length = 420

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 5   DELNTKEFKCFLKNSRKKHITPSKDVVAKSIK---KYEDRIRS 44
           +E NT+ FK  LK+ R+ HI+  KD + +S+K   KY D+I S
Sbjct: 337 EEANTRSFK-LLKDLRQNHISADKDHIERSVKAQFKYSDKINS 378


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.321    0.136    0.377 

Lambda     K      H
   0.267   0.0450    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 720,052,954
Number of Sequences: 14124377
Number of extensions: 26061352
Number of successful extensions: 75363
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 75362
Number of HSP's gapped (non-prelim): 2
length of query: 66
length of database: 4,842,793,630
effective HSP length: 38
effective length of query: 28
effective length of database: 4,306,067,304
effective search space: 120569884512
effective search space used: 120569884512
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 76 (33.7 bits)