RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >gnl|CDD|151046 pfam10483, Hap2_elong, Histone acetylation protein 2. Hap2 is one of three histone acetyltransferases proteins that, in yeasts, are found associated with elongating forms of RNA polymerase II (Elongator). The Haps can be isolated in two forms, as a six-subunit complex with Elongator and as a complex of the three proteins on their own. The role of the Hap complex in transcription is still speculative, being possibly to keep the HAT activity of free Elongator in check, allowing histone acetylation only in the presence of a transcribing polymerase, or the interaction with Haps might render Elongator susceptible to modifications thereby altering its activity. Length = 286 Score = 28.5 bits (64), Expect = 0.34 Identities = 9/36 (25%), Positives = 16/36 (44%) Query: 71 RSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALS 106 R E + + N V L +++KSG+ L+ Sbjct: 169 LDRSLSEPVFPLEEGLNGVGIVLELENRRKSGRGLT 204 >gnl|CDD|163018 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the alphaproteobacteria (as modeled here) and the Firmicutes, while the partner AddB proteins show no strong homology across the two groups of species. Length = 1141 Score = 28.1 bits (63), Expect = 0.48 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Query: 54 KITPY-LYEWVLSNTQSRR---SRDGQEFEYII 82 ITP+ Y +L RR +R G E E I+ Sbjct: 701 FITPFEFYARLLGGDGGRRKLLARLGAEAEDIL 733 >gnl|CDD|148092 pfam06277, EutA, Ethanolamine utilisation protein EutA. This family consists of several bacterial EutA ethanolamine utilisation proteins. The EutA protein is thought to protect the lyase (EutBC) from inhibition by CNB12. Length = 473 Score = 28.3 bits (64), Expect = 0.49 Identities = 6/22 (27%), Positives = 15/22 (68%) Query: 3 FNEIILKNISNNYEVPKMLITE 24 F+ + L+N ++ + VP++ I + Sbjct: 19 FSRLTLENRASVFSVPRIEIVD 40 >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional. Length = 365 Score = 27.2 bits (60), Expect = 0.84 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Query: 10 NISNNYEVPKMLIT---ELSTELFNLKTANQNFFH 41 + N EVPK L + EL E F++K ++++FH Sbjct: 331 LVRINVEVPKRLTSKQKELIREFFDIKENHKSWFH 365 >gnl|CDD|178785 PRK00002, aroB, 3-dehydroquinate synthase; Reviewed. Length = 358 Score = 27.4 bits (62), Expect = 0.85 Identities = 8/27 (29%), Positives = 14/27 (51%) Query: 57 PYLYEWVLSNTQSRRSRDGQEFEYIIY 83 P +EW+ +N + + DG+ E I Sbjct: 191 PEFFEWLEANVDALLALDGEALEEAIA 217 >gnl|CDD|149925 pfam09019, EcoRII-C, EcoRII C terminal. The C-terminal catalytic domain of the Restriction Endonuclease EcoRII has a restriction endonuclease-like fold with a central five-stranded mixed beta-sheet surrounded on both sides by alpha-helices. It cleaves DNA specifically at single 5' CCWGG sites. Length = 164 Score = 26.9 bits (60), Expect = 1.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Query: 64 LSNTQSRRSRDGQEFEYII 82 LS R+SR G+ E + Sbjct: 28 LSVQNRRKSRAGKSLENHL 46 >gnl|CDD|161848 TIGR00381, cdhD, CO dehydrogenase/acetyl-CoA synthase, delta subunit. This is the small subunit of a heterodimer which catalyzes the reaction CO + H2O + Acceptor = CO2 + Reduced acceptor and is involved in the synthesis of acetyl-CoA from CO2 and H2. Length = 389 Score = 25.3 bits (55), Expect = 3.4 Identities = 8/22 (36%), Positives = 10/22 (45%), Gaps = 3/22 (13%) Query: 42 NTLTKKFGDYMSKITPYLYEWV 63 NTLT G +S EW+ Sbjct: 371 NTLT---GPKVSGGVADPGEWI 389 >gnl|CDD|180899 PRK07233, PRK07233, hypothetical protein; Provisional. Length = 434 Score = 24.8 bits (55), Expect = 4.9 Identities = 15/64 (23%), Positives = 24/64 (37%), Gaps = 12/64 (18%) Query: 22 ITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLYEWVLSN----TQSRRSRDGQE 77 + S E + F+ L KFGDY ++ W+ S R S G++ Sbjct: 138 LRRWSGE-----GVYEVFWEPLLESKFGDYADDVS---AAWLWSRIKRRGNRRYSLFGEK 189 Query: 78 FEYI 81 Y+ Sbjct: 190 LGYL 193 >gnl|CDD|114900 pfam06208, BDV_G, Borna disease virus G protein. This family consists of Borna disease virus G glycoprotein sequences. Borna disease virus (BDV) infection produces a variety of clinical diseases, from behavioural illnesses to classical fatal encephalitis. G protein is important for viral entry into the host cell. Length = 503 Score = 24.3 bits (52), Expect = 6.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 70 RRSRDGQEFEYIIYSL 85 RR RD Q+ EY+I+ L Sbjct: 246 RRRRDTQQIEYLIHKL 261 >gnl|CDD|182674 PRK10719, eutA, reactivating factor for ethanolamine ammonia lyase; Provisional. Length = 475 Score = 24.1 bits (53), Expect = 7.5 Identities = 6/22 (27%), Positives = 16/22 (72%) Query: 3 FNEIILKNISNNYEVPKMLITE 24 F+ + L+N ++ ++VP++ I + Sbjct: 22 FSRLELENRASVFQVPRIEIID 43 >gnl|CDD|115538 pfam06888, Put_Phosphatase, Putative Phosphatase. This family contains a number of putative eukaryotic acid phosphatases. Some family members represent the products of the PSI14 phosphatase family in Lycopersicon esculentum (Tomato). Length = 234 Score = 23.9 bits (52), Expect = 9.4 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 63 VLSNTQSRRSRDGQEFEYIIY 83 VL + ++R+G +E +IY Sbjct: 154 VLDEIVASQAREGVRYERVIY 174 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.132 0.375 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,644,433 Number of extensions: 85362 Number of successful extensions: 161 Number of sequences better than 10.0: 1 Number of HSP's gapped: 160 Number of HSP's successfully gapped: 24 Length of query: 110 Length of database: 5,994,473 Length adjustment: 76 Effective length of query: 34 Effective length of database: 4,352,265 Effective search space: 147977010 Effective search space used: 147977010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)