RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >2gb7_A R.ECL18KI; ECL18KI-DNA complex, type II restriction endonuclease, nucleotide flipping, base extrusion, hydrolase/DNA complex; HET: DNA; 1.70A {Enterobacter cloacae} PDB: 2fqz_A* (A:1-137) Length = 137 Score = 45.0 bits (106), Expect = 4e-06 Identities = 19/59 (32%), Positives = 31/59 (52%) Query: 24 ELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYII 82 E +T + + + + D+ + ++Y+ LSNTQSRRSR G+EFE I+ Sbjct: 70 EFTTRMLSYLIDEERIKDMSPYDAIRDFTMEYPTHIYDLALSNTQSRRSRAGKEFESIL 128 >3he1_A Major exported HCP3 protein; structural genomics, APC22128, HCPC, secretion, virulence, PSI-2, protein structure initiative; 2.10A {Pseudomonas aeruginosa} (A:) Length = 195 Score = 26.1 bits (57), Expect = 1.8 Identities = 11/53 (20%), Positives = 17/53 (32%), Gaps = 12/53 (22%) Query: 43 TLTKKFGDYMSKITPYLYEWVLSNTQ--------SRRSRDGQEFEYIIYSLYN 87 +TK K +P L + S + R S G + Y L + Sbjct: 91 VITK----VFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLED 139 >1u7i_A Hypothetical protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Pseudomonas aeruginosa PAO1} (A:1-75) Length = 75 Score = 23.9 bits (52), Expect = 7.2 Identities = 3/11 (27%), Positives = 7/11 (63%) Query: 49 GDYMSKITPYL 59 G +++ P+L Sbjct: 1 GHXSARVRPFL 11 >1u69_A Hypothetical protein; structural genomics, MSCG, protein structure initiative (PSI), midwest center for structural genomics, MCSG; 1.60A {Pseudomonas aeruginosa PAO1} (A:1-73) Length = 73 Score = 23.9 bits (52), Expect = 8.9 Identities = 5/11 (45%), Positives = 5/11 (45%) Query: 49 GDYMSKITPYL 59 G SK T L Sbjct: 1 GHXNSKNTICL 11 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.132 0.375 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 749,665 Number of extensions: 28042 Number of successful extensions: 78 Number of sequences better than 10.0: 1 Number of HSP's gapped: 78 Number of HSP's successfully gapped: 12 Length of query: 110 Length of database: 4,956,049 Length adjustment: 65 Effective length of query: 45 Effective length of database: 2,758,724 Effective search space: 124142580 Effective search space used: 124142580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.4 bits)