RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 220 Score = 33.7 bits (77), Expect = 0.005 Identities = 7/24 (29%), Positives = 12/24 (50%) Query: 64 LSNTQSRRSRDGQEFEYIIYSLYN 87 S + R+SR G+ E + L+ Sbjct: 78 NSVSNRRKSRAGKSLELHLEHLFI 101 >d2ghfa2 g.37.1.1 (A:9-44) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Score = 26.2 bits (57), Expect = 0.68 Identities = 8/30 (26%), Positives = 16/30 (53%) Query: 66 NTQSRRSRDGQEFEYIIYSLYNINTFVTHL 95 N Q+++ G E +Y + ++N F H+ Sbjct: 1 NQQNKKVEGGYECKYCTFQTPDLNMFTFHV 30 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.132 0.375 Gapped Lambda K H 0.267 0.0515 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 378,346 Number of extensions: 14775 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 6 Length of query: 110 Length of database: 2,407,596 Length adjustment: 69 Effective length of query: 41 Effective length of database: 1,460,226 Effective search space: 59869266 Effective search space used: 59869266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.4 bits)