BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] (110 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780514|ref|YP_003064927.1| type II restriction endonuclease [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 224 bits (572), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 110/110 (100%), Positives = 110/110 (100%) Query: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY Sbjct: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 Query: 61 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM 110 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM Sbjct: 61 EWVLSNTQSRRSRDGQEFEYIIYSLYNINTFVTHLMHKKKSGKALSLSIM 110 >gi|254780611|ref|YP_003065024.1| RNA polymerase factor sigma-32 [Candidatus Liberibacter asiaticus str. psy62] Length = 302 Score = 22.7 bits (47), Expect = 1.6, Method: Compositional matrix adjust. Identities = 8/30 (26%), Positives = 18/30 (60%) Query: 1 MQFNEIILKNISNNYEVPKMLITELSTELF 30 +Q N + L+N+S+ +EV + + ++ F Sbjct: 248 LQENPVTLENLSSEFEVSRERVRQIEARAF 277 >gi|254781019|ref|YP_003065432.1| hydroxymethylglutaryl-coenzyme A synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 20.4 bits (41), Expect = 8.4, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 49 GDYMSKITPYLYEWVLSNTQSRRSRDGQEFEYIIY 83 G Y +KI E V + Q + D +F+Y Y Sbjct: 198 GKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCY 232 >gi|254780306|ref|YP_003064719.1| DNA topoisomerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 837 Score = 20.4 bits (41), Expect = 9.3, Method: Compositional matrix adjust. Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 9/77 (11%) Query: 1 MQFNEIILKNISNNYEVPKMLITELSTELFNLKTANQNFFHNTLTKKFGDYMSKITPYLY 60 M+ + + + I N E+ LIT + T+ ++ ++T +GD+ P +Y Sbjct: 281 MRIAQKLYEGIDVNGEI-VGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIY 339 Query: 61 EWVLSNTQSRRSRDGQE 77 S +S++ QE Sbjct: 340 --------SSKSKNAQE 348 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.132 0.375 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,067 Number of Sequences: 1233 Number of extensions: 2473 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 110 length of database: 328,796 effective HSP length: 63 effective length of query: 47 effective length of database: 251,117 effective search space: 11802499 effective search space used: 11802499 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 32 (16.9 bits)