BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780515|ref|YP_003064928.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] (42 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780515|ref|YP_003064928.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] gi|254040192|gb|ACT56988.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] Length = 42 Score = 81.3 bits (199), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE Sbjct: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 >gi|319407457|emb|CBI81107.1| putative type II restriction endonuclease [Bartonella sp. 1-1C] Length = 302 Score = 53.5 bits (127), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 24/36 (66%), Positives = 32/36 (88%) Query: 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37 P IHLLTVDS+I+ NK E+++KHNI+LVVLD +KK+ Sbjct: 237 PNIHLLTVDSDISVNKIEQMNKHNIVLVVLDTIKKQ 272 >gi|261400949|ref|ZP_05987074.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] gi|269209192|gb|EEZ75647.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] Length = 132 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/42 (52%), Positives = 33/42 (78%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 +P I+LLTVD +I+ENK +++ HNI+LVV +KK+ HLK+ Sbjct: 67 VPNIYLLTVDDDISENKVIQMNNHNIVLVVPQNIKKQPHLKD 108 >gi|313667523|ref|YP_004047807.1| restriction endonuclease [Neisseria lactamica ST-640] gi|309378246|emb|CBX23131.1| putative Type II restriction endonuclease R.NlaX [Neisseria lactamica Y92-1009] gi|313004985|emb|CBN86413.1| putative restriction endonuclease [Neisseria lactamica 020-06] Length = 132 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/42 (47%), Positives = 31/42 (73%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 +P I+LLTVD +I+ENK +++ HNI+ VV +K + HLK+ Sbjct: 67 VPNIYLLTVDDDISENKVIQMNNHNIVPVVPQSIKNQPHLKD 108 >gi|150026186|ref|YP_001297012.1| type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] gi|149772727|emb|CAL44210.1| Probable type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] Length = 298 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 25/41 (60%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLK 41 +P IHLLT D I ++KA+ + HNII+V + V LK Sbjct: 231 IPEIHLLTADESIPKSKAQEMANHNIIVVTYEWVANSVALK 271 Searching..................................................done Results from round 2 >gi|261400949|ref|ZP_05987074.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] gi|269209192|gb|EEZ75647.1| type II restriction enzyme SsoII [Neisseria lactamica ATCC 23970] Length = 132 Score = 65.4 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 33/42 (78%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 +P I+LLTVD +I+ENK +++ HNI+LVV +KK+ HLK+ Sbjct: 67 VPNIYLLTVDDDISENKVIQMNNHNIVLVVPQNIKKQPHLKD 108 >gi|313667523|ref|YP_004047807.1| restriction endonuclease [Neisseria lactamica ST-640] gi|309378246|emb|CBX23131.1| putative Type II restriction endonuclease R.NlaX [Neisseria lactamica Y92-1009] gi|313004985|emb|CBN86413.1| putative restriction endonuclease [Neisseria lactamica 020-06] Length = 132 Score = 61.1 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 31/42 (73%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 +P I+LLTVD +I+ENK +++ HNI+ VV +K + HLK+ Sbjct: 67 VPNIYLLTVDDDISENKVIQMNNHNIVPVVPQSIKNQPHLKD 108 >gi|319407457|emb|CBI81107.1| putative type II restriction endonuclease [Bartonella sp. 1-1C] Length = 302 Score = 60.7 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 24/36 (66%), Positives = 32/36 (88%) Query: 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37 P IHLLTVDS+I+ NK E+++KHNI+LVVLD +KK+ Sbjct: 237 PNIHLLTVDSDISVNKIEQMNKHNIVLVVLDTIKKQ 272 >gi|254780515|ref|YP_003064928.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] gi|254040192|gb|ACT56988.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] Length = 42 Score = 48.4 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE Sbjct: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLKE 42 >gi|150026186|ref|YP_001297012.1| type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] gi|149772727|emb|CAL44210.1| Probable type II restriction endonuclease [Flavobacterium psychrophilum JIP02/86] Length = 298 Score = 34.9 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 25/41 (60%) Query: 1 MPTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKEKHLK 41 +P IHLLT D I ++KA+ + HNII+V + V LK Sbjct: 231 IPEIHLLTADESIPKSKAQEMANHNIIVVTYEWVANSVALK 271 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.319 0.144 0.379 Lambda K H 0.267 0.0438 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 726,049,633 Number of Sequences: 14124377 Number of extensions: 16624999 Number of successful extensions: 32513 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 32503 Number of HSP's gapped (non-prelim): 10 length of query: 42 length of database: 4,842,793,630 effective HSP length: 16 effective length of query: 26 effective length of database: 4,616,803,598 effective search space: 120036893548 effective search space used: 120036893548 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.1 bits) S2: 76 (33.8 bits)