RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780515|ref|YP_003064928.1| hypothetical protein CLIBASIA_02010 [Candidatus Liberibacter asiaticus str. psy62] (42 letters) >d1na6a2 c.52.1.22 (A:179-398) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 220 Score = 36.0 bits (83), Expect = 0.001 Identities = 7/36 (19%), Positives = 17/36 (47%) Query: 2 PTIHLLTVDSEIAENKAERIDKHNIILVVLDKVKKE 37 +HL T+ ++ + + + + LVV + K+ Sbjct: 164 HQVHLFTLQEGVSLAQYREMRESGVRLVVPSSLHKK 199 >d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Score = 24.9 bits (54), Expect = 2.1 Identities = 4/21 (19%), Positives = 9/21 (42%) Query: 5 HLLTVDSEIAENKAERIDKHN 25 + V + + +DK+N Sbjct: 477 NFTEVHPDYGSHIQALLDKYN 497 >d2g6ta1 c.147.1.1 (A:1-305) Hypothetical protein CAC2185 {Clostridium acetobutylicum [TaxId: 1488]} Length = 305 Score = 23.3 bits (50), Expect = 6.4 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Query: 3 TIHLLTVDS-EIAENK----AERIDKHNIILVVLDKVKKEKHLKE 42 ++ S A+N RI+K N+ + +L K EK +K Sbjct: 187 ILNFNHQASFAEAKNDWDERKTRINKKNLFVKMLIKDDNEKLVKR 231 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.133 0.350 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 144,674 Number of extensions: 3745 Number of successful extensions: 13 Number of sequences better than 10.0: 1 Number of HSP's gapped: 13 Number of HSP's successfully gapped: 3 Length of query: 42 Length of database: 2,407,596 Length adjustment: 15 Effective length of query: 27 Effective length of database: 2,201,646 Effective search space: 59444442 Effective search space used: 59444442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.1 bits)