>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. This family consists of (Uracil-5-)-methyltransferases EC:2.1.1.35 from bacteria, archaea and eukaryotes. A 5-methyluridine (m(5)U) residue at position 54 is a conserved feature of bacterial and eukaryotic tRNAs. The methylation of U54 is catalysed by the tRNA(m5U54)methyltransferase, which in Saccharomyces cerevisiae is encoded by the nonessential TRM2 gene. It is thought that tRNA modification enzymes might have a role in tRNA maturation not necessarily linked to their known catalytic activity.

Probab=96.63 E-value=0.0028 Score=36.90 Aligned_cols=41 Identities=32% Similarity=0.528 Sum_probs=33.7 Q ss_pred EEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCC Q ss_conf 6964107947889999872220895699998069555112220012 Q gi|254780516|r 3 KITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFP 48 (83) Q Consensus 3 ~v~~LFsG~GG~~~gl~~a~~~~~~~~v~a~e~d~~a~~~y~~n~~ 48 (83) T Consensus 200 ~vlDlYcG~Gtfsl~lA~~-----~~~V~GvE~~~~AV~~A~~Na~ 240 (353) T pfam05958 200 DLLELYCGNGNFSLALAQN-----FRRVLATEIAKPSVNAAQYNIA 240 (353) T ss_pred CEEEEECCCCHHHHHHHHH-----CCEEEEEECCHHHHHHHHHHHH T ss_conf 5899846888888999864-----7879999625999999999899

HHsearch alignment for GI: 254780516 and conserved domain: pfam05958