RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780516|ref|YP_003064929.1| type II modification methyltransferase [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >gnl|CDD|161991 TIGR00675, dcm, DNA-methyltransferase (dcm). All proteins in this family for which functions are known are DNA-cytosine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 315 Score = 122 bits (308), Expect = 2e-29 Identities = 48/80 (60%), Positives = 55/80 (68%), Gaps = 4/80 (5%) Query: 4 ITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANFPNTLIFGDIAKIKTQD 63 DLF GIGGIRL EQ +C F+SEI+ Y+ KTY+ANF N + FGDI KI D Sbjct: 1 FIDLFAGIGGIRLGFEQAG----FKCVFASEIDKYAQKTYEANFGNKVPFGDITKISPSD 56 Query: 64 IPDHDVLLAGFPCQPFSQAG 83 IPD D+LL GFPCQPFS AG Sbjct: 57 IPDFDILLGGFPCQPFSIAG 76 >gnl|CDD|182476 PRK10458, PRK10458, DNA cytosine methylase; Provisional. Length = 467 Score = 87.4 bits (217), Expect = 7e-19 Identities = 46/98 (46%), Positives = 53/98 (54%), Gaps = 24/98 (24%) Query: 6 DLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQANF---PNTLIFG-DIAKIK- 60 DLF GIGGIR E +C F+SE N ++V+TY+AN+ P T F DI I Sbjct: 93 DLFAGIGGIRRGFEAIGG----QCVFTSEWNKHAVRTYKANWYCDPATHRFNEDIRDITL 148 Query: 61 ---------------TQDIPDHDVLLAGFPCQPFSQAG 83 Q IPDHDVLLAGFPCQPFS AG Sbjct: 149 SHKEGVSDEEAAEHIRQHIPDHDVLLAGFPCQPFSLAG 186 >gnl|CDD|132636 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli. Length = 360 Score = 28.4 bits (64), Expect = 0.46 Identities = 12/32 (37%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Query: 29 CFFSSEINPYSVKTYQANFPNTLIFGDIAKIK 60 EI P KTYQ N TL G +A+ Sbjct: 232 ITPKKEIKP---KTYQLNPNQTLFLGGLARFD 260 >gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase. Length = 468 Score = 27.3 bits (60), Expect = 0.82 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 32 SSEINPYSVKTY--QANFPNTLIFGDIAKIKTQDIPDHDV 69 S +I PYSV + + N+P+ G I +K Q P+ D+ Sbjct: 220 SFDIEPYSVNHFLDEQNYPSVYAVGPIFDLKAQPHPEQDL 259 >gnl|CDD|162723 TIGR02137, HSK-PSP, phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein. This enzyme is a member of the haloacid dehalogenase (HAD) superfamily, specifically part of subfamily IB by virtue of the presence of an alpha helical domain in between motifs I and II of the HAD domain . The closest homologs to this family are monofunctional phosphoserine phosphatases (TIGR00338). Length = 203 Score = 26.8 bits (59), Expect = 1.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 55 DIAKIKTQDIPDHDVLLAG 73 D K T+DIPD+DVL+ Sbjct: 27 DALKATTRDIPDYDVLMKQ 45 >gnl|CDD|184332 PRK13796, PRK13796, GTPase YqeH; Provisional. Length = 365 Score = 25.6 bits (57), Expect = 2.9 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Query: 34 EINPYSVKTYQANFPNTLIFGDIAKI 59 EI P KTYQ N TL G +A+ Sbjct: 243 EIKP---KTYQLNEEQTLFLGGLARF 265 >gnl|CDD|129571 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase RumA. This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family. The member from E. coli has now been shown to act as the 23S RNA methyltransferase for the conserved U1939. The gene is now designated rumA and was previously designated ygcA. Length = 431 Score = 25.2 bits (55), Expect = 3.5 Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Query: 3 KITDLFCGIGGIRLDLEQTFNHRNVECFFSSEINPYSVKTYQAN 46 + D +CG+G L L + + E+ P SV+ Q N Sbjct: 295 LVVDAYCGVGTFTLPLA-----KQAKSVVGIEVVPESVEKAQQN 333 >gnl|CDD|179588 PRK03522, rumB, 23S rRNA methyluridine methyltransferase; Reviewed. Length = 315 Score = 25.2 bits (56), Expect = 3.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 6 DLFCGIGG 13 DLFCG+GG Sbjct: 179 DLFCGVGG 186 >gnl|CDD|140299 PTZ00273, PTZ00273, oxidase reductase; Provisional. Length = 320 Score = 24.7 bits (54), Expect = 5.0 Identities = 7/34 (20%), Positives = 18/34 (52%) Query: 14 IRLDLEQTFNHRNVECFFSSEINPYSVKTYQANF 47 +++D+ ++ HR F + +++P Y+ F Sbjct: 70 LKIDIRKSRLHRGYGAFGAEQLDPSKPYDYKETF 103 >gnl|CDD|183875 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransferase; Reviewed. Length = 443 Score = 24.7 bits (55), Expect = 5.8 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 6 DLFCGIG 12 DLFCG+G Sbjct: 303 DLFCGLG 309 >gnl|CDD|180850 PRK07116, PRK07116, flavodoxin; Provisional. Length = 160 Score = 24.6 bits (54), Expect = 5.9 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Query: 56 IAKIKTQDIPDHDVLLAGFP 75 IAK K ++I ++DV+ GFP Sbjct: 67 IAK-KIENIAEYDVIFLGFP 85 >gnl|CDD|131140 TIGR02085, meth_trns_rumB, 23S rRNA (uracil-5-)-methyltransferase RumB. This family consists of RNA methyltransferases designated RumB, formerly YbjF. Members act on 23S rRNA U747 and the equivalent position in other proteobacterial species. This family is homologous to the other 23S rRNA methyltransferase RumA and to the tRNA methyltransferase TrmA. Length = 374 Score = 24.0 bits (52), Expect = 8.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 6 DLFCGIGGIRL 16 DLFCG+GG L Sbjct: 239 DLFCGVGGFGL 249 >gnl|CDD|184163 PRK13582, thrH, phosphoserine phosphatase; Provisional. Length = 205 Score = 24.1 bits (53), Expect = 8.7 Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 58 KIKTQDIPDHDVLL 71 + T+DIPD+DVL+ Sbjct: 30 RATTRDIPDYDVLM 43 >gnl|CDD|181740 PRK09267, PRK09267, flavodoxin FldA; Validated. Length = 169 Score = 24.0 bits (53), Expect = 9.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 55 DIAKIKTQDIPDHDVLLAGFP 75 DIAK +D +D+L+ G P Sbjct: 35 DIAKASKEDFEAYDLLILGIP 55 >gnl|CDD|183085 PRK11316, PRK11316, bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional. Length = 473 Score = 24.0 bits (53), Expect = 9.3 Identities = 6/11 (54%), Positives = 7/11 (63%) Query: 14 IRLDLEQTFNH 24 IRLD E+ F Sbjct: 117 IRLDFEEGFEG 127 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.143 0.447 Gapped Lambda K H 0.267 0.0768 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,335,066 Number of extensions: 65513 Number of successful extensions: 141 Number of sequences better than 10.0: 1 Number of HSP's gapped: 138 Number of HSP's successfully gapped: 20 Length of query: 83 Length of database: 5,994,473 Length adjustment: 52 Effective length of query: 31 Effective length of database: 4,870,857 Effective search space: 150996567 Effective search space used: 150996567 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.0 bits)