HHsearch alignment for GI: 254780519 and conserved domain: COG1987

>COG1987 FliQ Flagellar biosynthesis pathway, component FliQ [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=100.00  E-value=2.6e-39  Score=212.15  Aligned_cols=88  Identities=47%  Similarity=0.792  Sum_probs=86.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98799999999999999999999999999999999999999884653698899999999999999999999999999999
Q gi|254780519|r    1 MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV   80 (88)
Q Consensus         1 M~~~~vi~l~~~al~~~l~ls~P~Ll~alvvGl~Isi~QA~TQIQEqTLsFvPKliav~~~l~~~~pwm~~~l~~f~~~i   80 (88)
T Consensus         1 Mt~~~~l~i~~~ai~~~L~l~~P~ll~alvvGLvIsifQA~TQIqEqTLsFiPKIiai~~~l~~~gpWm~~~l~dft~~i   80 (89)
T COG1987           1 MTEEDVLDIGQEAIWLVLMLSAPVLLVALVVGLVISIFQAATQIQEQTLSFIPKIIAVFLVLILLGPWMLNQLLDFTVTI   80 (89)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98889999999999999999998999999999999999999999999998599899999999997589999999999999


Q ss_pred             HHHHHHCC
Q ss_conf             99934409
Q gi|254780519|r   81 LSRIQSSL   88 (88)
Q Consensus        81 f~~ip~~i   88 (88)
T Consensus        81 f~~i~~~i   88 (89)
T COG1987          81 FSNIPQII   88 (89)
T ss_pred             HHHHHHHC
T ss_conf             99887661