HHsearch alignment for GI: 254780519 and conserved domain: PRK12781

>PRK12781 fliQ flagellar biosynthesis protein FliQ; Reviewed.
Probab=100.00  E-value=5.6e-40  Score=215.40  Aligned_cols=87  Identities=55%  Similarity=0.896  Sum_probs=85.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98799999999999999999999999999999999999999884653698899999999999999999999999999999
Q gi|254780519|r    1 MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV   80 (88)
Q Consensus         1 M~~~~vi~l~~~al~~~l~ls~P~Ll~alvvGl~Isi~QA~TQIQEqTLsFvPKliav~~~l~~~~pwm~~~l~~f~~~i   80 (88)
T Consensus         1 M~~~~vi~l~r~al~~~l~~s~PiL~~aL~VGl~IsifQA~TQIQE~TLsFVPKi~av~~~l~l~g~wm~~~l~~ft~~l   80 (88)
T PRK12781          1 MNERDALELVRAAIWTIIVASGPAVGAAMLVGIAIALLQALTQIQEVTLTFVPKIVVILIVMAVTGSFVGAQIYAFTEMV   80 (88)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98889999999999999999774999999999999999999999999998599899999999998779999999999999


Q ss_pred             HHHHHHC
Q ss_conf             9993440
Q gi|254780519|r   81 LSRIQSS   87 (88)
Q Consensus        81 f~~ip~~   87 (88)
T Consensus        81 f~~I~~g   87 (88)
T PRK12781         81 YGRIESG   87 (88)
T ss_pred             HHHHCCC
T ss_conf             9861225