Query         gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 88
No_of_seqs    112 out of 591
Neff          4.8 
Searched_HMMs 13730
Date          Wed Jun  1 09:52:41 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780519.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1v54m_ f.23.7.1 (M:) Mitochon   9.9      50  0.0036   12.4   3.3   24   55-78     19-42  (43)
  2 d2e74e1 f.23.24.1 (E:1-32) Pet   5.8      79  0.0058   11.4   3.1   22   24-45      9-30  (32)
  3 d1nekb2 d.15.4.2 (B:1-106) Suc   5.8      64  0.0046   11.9   0.2   15   37-51     35-51  (106)
  4 d1x4ta1 a.2.15.1 (A:7-86) Pre-   3.0 1.4E+02    0.01   10.2   0.3   15   36-50     30-44  (80)
  5 d1tzyb_ a.22.1.1 (B:) Histone    2.8 1.5E+02   0.011   10.1   2.7   17   70-86     27-43  (92)
  6 d2vv5a3 f.34.1.1 (A:27-112) Me   2.4 1.7E+02   0.012    9.7   4.2   17   42-58     33-49  (86)
  7 d1rsoa_ a.194.1.1 (A:) Presyna   2.3 1.8E+02   0.013    9.6   1.4   12   36-47     41-52  (60)
  8 d3dhwa1 f.58.1.1 (A:6-208) D-m   2.1   2E+02   0.015    9.4   5.3   34    8-41      2-35  (203)
  9 d1m56d_ f.23.8.1 (D:) Bacteria   2.1   2E+02   0.015    9.4   3.4   23   43-65     10-36  (42)
 10 d2z3ba1 d.153.1.4 (A:1-180) Hs   2.1 2.1E+02   0.015    9.3   0.7   17    1-17    147-163 (180)

No 1  
>d1v54m_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
Probab=9.90  E-value=50  Score=12.40  Aligned_cols=24  Identities=8%  Similarity=0.396  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999
Q gi|254780519|r   55 IIAVFITLIISAPFIGGQISSFVT   78 (88)
Q Consensus        55 liav~~~l~~~~pwm~~~l~~f~~   78 (88)
                      +-..+.+++.-.+|.++.+-+|-+
T Consensus        19 Lt~~f~~~L~PaGwVLshLe~YKk   42 (43)
T d1v54m_          19 LSVTFLSFLLPAGWVLYHLDNYKK   42 (43)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHHT
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHCC
T ss_conf             999999997008999999998513


No 2  
>d2e74e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
Probab=5.82  E-value=79  Score=11.39  Aligned_cols=22  Identities=32%  Similarity=0.750  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999998846
Q gi|254780519|r   24 VLFSAMFLGILIAFLQALTQIQ   45 (88)
Q Consensus        24 ~Ll~alvvGl~Isi~QA~TQIQ   45 (88)
                      +...|+.-|..+++.-|..+|.
T Consensus         9 ivfialffgiavgiifaiksik   30 (32)
T d2e74e1           9 IVFIALFFGIAVGIIFAIKSIK   30 (32)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHEEEEEEEE
T ss_conf             9999999978863214578776


No 3  
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=5.79  E-value=64  Score=11.86  Aligned_cols=15  Identities=47%  Similarity=0.791  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHH--HHHH
Q ss_conf             99999884653--6988
Q gi|254780519|r   37 FLQALTQIQEV--TLTF   51 (88)
Q Consensus        37 i~QA~TQIQEq--TLsF   51 (88)
                      ++.++.+|||+  ||+|
T Consensus        35 vl~~L~~i~e~D~sLsf   51 (106)
T d1nekb2          35 LLDALIQLKEKDPSLSF   51 (106)
T ss_dssp             HHHHHHHHHHHCTTCCC
T ss_pred             HHHHHHHHHCCCCCEEE
T ss_conf             99999998641987799


No 4  
>d1x4ta1 a.2.15.1 (A:7-86) Pre-mRNA-splicing factor ISY1 homolog {Mouse (Mus musculus) [TaxId: 10090]}
Probab=2.97  E-value=1.4e+02  Score=10.19  Aligned_cols=15  Identities=27%  Similarity=0.326  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999884653698
Q gi|254780519|r   36 AFLQALTQIQEVTLT   50 (88)
Q Consensus        36 si~QA~TQIQEqTLs   50 (88)
                      -|-+-+++||+.+|+
T Consensus        30 EI~~kvs~Iqn~~L~   44 (80)
T d1x4ta1          30 EISKKVAQIQNAGLG   44 (80)
T ss_dssp             HHHHHHHHHHHCCSC
T ss_pred             HHHHHHHHHCCCCCC
T ss_conf             999999985089987


No 5  
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
Probab=2.77  E-value=1.5e+02  Score=10.07  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999344
Q gi|254780519|r   70 GGQISSFVTLVLSRIQS   86 (88)
Q Consensus        70 ~~~l~~f~~~if~~ip~   86 (88)
                      .+.|.+|..++|++|..
T Consensus        27 m~imnsfvndiferIa~   43 (92)
T d1tzyb_          27 MGIMNSFVNDIFERIAG   43 (92)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 6  
>d2vv5a3 f.34.1.1 (A:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}
Probab=2.41  E-value=1.7e+02  Score=9.74  Aligned_cols=17  Identities=12%  Similarity=0.354  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             88465369889999999
Q gi|254780519|r   42 TQIQEVTLTFVPKIIAV   58 (88)
Q Consensus        42 TQIQEqTLsFvPKliav   58 (88)
                      ++..|..-.+.-|++-.
T Consensus        33 ~~~~~~~~~~i~~~~~~   49 (86)
T d2vv5a3          33 RKIDATVADFLSALVRY   49 (86)
T ss_dssp             HCSCHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             68885899999999999


No 7  
>d1rsoa_ a.194.1.1 (A:) Presynaptic protein sap97 {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=2.28  E-value=1.8e+02  Score=9.59  Aligned_cols=12  Identities=50%  Similarity=0.653  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999884653
Q gi|254780519|r   36 AFLQALTQIQEV   47 (88)
Q Consensus        36 si~QA~TQIQEq   47 (88)
                      .+|||.--|||.
T Consensus        41 ~LF~aLlDIqe~   52 (60)
T d1rsoa_          41 NLFQALIDIQEF   52 (60)
T ss_dssp             HHHHHHHHHTTS
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 8  
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]}
Probab=2.13  E-value=2e+02  Score=9.42  Aligned_cols=34  Identities=15%  Similarity=0.276  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999
Q gi|254780519|r    8 EIARAAMWTILSSSAPVLFSAMFLGILIAFLQAL   41 (88)
Q Consensus         8 ~l~~~al~~~l~ls~P~Ll~alvvGl~Isi~QA~   41 (88)
                      .+..+++|..+.++.-....+.+.|+.+|++=+.
T Consensus         2 ~lll~~~~~tl~is~~~~~i~~ilg~~lg~~~~~   35 (203)
T d3dhwa1           2 WLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYV   35 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGG
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8899999999999999999999999999999999


No 9  
>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
Probab=2.09  E-value=2e+02  Score=9.37  Aligned_cols=23  Identities=26%  Similarity=0.263  Sum_probs=11.0

Q ss_pred             HHHHHHH----HHHHHHHHHHHHHHHH
Q ss_conf             8465369----8899999999999999
Q gi|254780519|r   43 QIQEVTL----TFVPKIIAVFITLIIS   65 (88)
Q Consensus        43 QIQEqTL----sFvPKliav~~~l~~~   65 (88)
                      ..||.|.    .|+-+...+.++++++
T Consensus        10 ~vQEKTF~gFik~~t~~~i~~i~~lif   36 (42)
T d1m56d_          10 TQQEKTFAGFVRMVTWAAVVIVAALIF   36 (42)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             988999999999999999999999999


No 10 
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]}
Probab=2.07  E-value=2.1e+02  Score=9.35  Aligned_cols=17  Identities=41%  Similarity=0.298  Sum_probs=0.0

Q ss_pred             CCHHHHHHHHHHHHHHH
Q ss_conf             98799999999999999
Q gi|254780519|r    1 MNEADVLEIARAAMWTI   17 (88)
Q Consensus         1 M~~~~vi~l~~~al~~~   17 (88)
                      |++++..++.++|+..+
T Consensus       147 ~s~~eA~~l~~~Al~~A  163 (180)
T d2z3ba1         147 GESMSASEIARAALETA  163 (180)
T ss_dssp             GGGCCHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHH
T ss_conf             98247999999999998


Done!