BLAST/PSIBLAST alignment of GI: 254780519 and GI: 163758038 at iteration 1
>gi|163758038|ref|ZP_02165126.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43] Length = 88
>gi|162284327|gb|EDQ34610.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43] Length = 88
 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +S P +  AMF+G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQTAIWTVLVASGPAVGVAMFIGVGIAFVQALTQVQEMTLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ +SAPF+G QIS+F  +V  RI+S  
Sbjct: 61 TVAVSAPFVGAQISTFTNIVFQRIESGF 88