BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein
FliQ [Candidatus Liberibacter asiaticus str. psy62]
         (88 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040196|gb|ACT56992.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 88

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI
Sbjct: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TLIISAPFIGGQISSFVTLVLSRIQSSL
Sbjct: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88


>gi|315122290|ref|YP_004062779.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495692|gb|ADR52291.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 88

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/87 (90%), Positives = 85/87 (97%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADVLEIARAA+WTILS+SAPVL +AMF G+L+AFLQALTQIQEVTLTFVPKIIAVFI
Sbjct: 1  MNEADVLEIARAAIWTILSASAPVLLAAMFFGVLVAFLQALTQIQEVTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          TLIISAPFIGGQIS+FVTLVLSRIQSS
Sbjct: 61 TLIISAPFIGGQISAFVTLVLSRIQSS 87


>gi|117395330|gb|ABK34502.1| putative export protein [Gossypium hirsutum]
          Length = 88

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 72/87 (82%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADVL+I +AA+WT+L++S P + SAM +GI++A LQALTQ+QE+TLTFVPKI+AV  
Sbjct: 1  MNEADVLDIVQAAIWTVLAASGPAVLSAMVVGIVVALLQALTQVQEITLTFVPKILAVLA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + ISAPFIG QIS F T++ SR+QS 
Sbjct: 61 AVAISAPFIGSQISIFTTMIFSRVQSG 87


>gi|222147595|ref|YP_002548552.1| flagellar biosynthesis protein FliQ [Agrobacterium vitis S4]
 gi|221734583|gb|ACM35546.1| flagellar biosynthetic protein [Agrobacterium vitis S4]
          Length = 88

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/87 (60%), Positives = 71/87 (81%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I RAA+WT+L +S P + +AM +G+++A +QALTQIQE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIMRAAVWTVLIASGPAVLAAMIVGVVVALIQALTQIQEMTLTFVPKIVAIMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T+ ISAPF+G QIS F  LV SR+QS 
Sbjct: 61 TIGISAPFVGSQISIFANLVFSRVQSG 87


>gi|227820881|ref|YP_002824851.1| flagellar biosynthesis protein FliQ [Sinorhizobium fredii NGR234]
 gi|227339880|gb|ACP24098.1| flagellar biosynthetic protein FliQ [Sinorhizobium fredii NGR234]
          Length = 88

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/87 (59%), Positives = 71/87 (81%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT++ +S P + +AM +G++IAF+QALTQ+QE+TLTFVPKI+AV +
Sbjct: 1  MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVVIAFIQALTQVQEMTLTFVPKILAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T  ISAPF+G QIS F  ++ SRIQS 
Sbjct: 61 TAAISAPFVGAQISIFTDIIFSRIQSG 87


>gi|163758038|ref|ZP_02165126.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43]
 gi|162284327|gb|EDQ34610.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43]
          Length = 88

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +S P +  AMF+G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQTAIWTVLVASGPAVGVAMFIGVGIAFVQALTQVQEMTLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ +SAPF+G QIS+F  +V  RI+S  
Sbjct: 61 TVAVSAPFVGAQISTFTNIVFQRIESGF 88


>gi|15964438|ref|NP_384791.1| flagellar biosynthesis protein FliQ [Sinorhizobium meliloti 1021]
 gi|150395509|ref|YP_001325976.1| flagellar biosynthesis protein FliQ [Sinorhizobium medicae
          WSM419]
 gi|307311580|ref|ZP_07591221.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti
          BL225C]
 gi|307318935|ref|ZP_07598366.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti AK83]
 gi|15073615|emb|CAC45257.1| Putative flagellar biosynthetic transmembrane protein
          [Sinorhizobium meliloti 1021]
 gi|150027024|gb|ABR59141.1| flagellar biosynthetic protein FliQ [Sinorhizobium medicae
          WSM419]
 gi|306895349|gb|EFN26104.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti AK83]
 gi|306899597|gb|EFN30226.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti
          BL225C]
          Length = 88

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT++ +S P + +AM +G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVGIAFIQALTQVQEMTLTFVPKILAVMI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T  ISAPF+G QIS F  +V SRIQS 
Sbjct: 61 TAAISAPFVGAQISIFTDIVFSRIQSG 87


>gi|222084891|ref|YP_002543420.1| flagellar biosynthesis transmembrane protein [Agrobacterium
          radiobacter K84]
 gi|221722339|gb|ACM25495.1| flagellar biosynthesis transmembrane protein [Agrobacterium
          radiobacter K84]
          Length = 88

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT+L +S P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV +
Sbjct: 1  MNEADALDIFQAAIWTVLVASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T+ ISAPF+G QIS F  LV SRIQS 
Sbjct: 61 TVGISAPFVGSQISIFTNLVFSRIQSG 87


>gi|10998534|gb|AAG25964.1|AF300968_6 FliQ [Sinorhizobium meliloti]
          Length = 88

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/87 (60%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT++ +S P + +AM +G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVGIAFIQALTQVQEMTLTFVPKILAVMI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T  +SAPF+G QIS F  +V SRIQS 
Sbjct: 61 TAAVSAPFVGAQISIFTDIVFSRIQSG 87


>gi|118589960|ref|ZP_01547364.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614]
 gi|118437457|gb|EAV44094.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614]
          Length = 88

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L++ R A+WTIL  SAP +  AM +GI+IA LQALTQ+QE+TLTF+PKI+A+ +
Sbjct: 1  MNEVDALDLVRTAIWTILVGSAPAIVPAMIVGIVIALLQALTQVQEITLTFIPKIVAILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++++ PFIGGQI S  TL+ +RI++ 
Sbjct: 61 MIVVAGPFIGGQIYSLTTLIYNRIETG 87


>gi|13472598|ref|NP_104165.1| flagellar biosynthesis protein FliQ [Mesorhizobium loti
          MAFF303099]
 gi|14023344|dbj|BAB49951.1| flagellar biosynthesis protein; FliQ [Mesorhizobium loti
          MAFF303099]
          Length = 88

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L++SAPV+  AM +GI IA +QALTQIQE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQIQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + ++ PFIGGQIS+F  ++  RIQ+ 
Sbjct: 61 VVALTGPFIGGQISAFTNVIFQRIQNG 87


>gi|319407000|emb|CBI80637.1| Flagellar biosynthetic protein fliQ [Bartonella sp. 1-1C]
          Length = 88

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL++S P +F+AM +GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILTASGPAVFAAMSVGIIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|260466597|ref|ZP_05812785.1| flagellar biosynthetic protein FliQ [Mesorhizobium opportunistum
          WSM2075]
 gi|259029603|gb|EEW30891.1| flagellar biosynthetic protein FliQ [Mesorhizobium opportunistum
          WSM2075]
          Length = 88

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L++SAPV+  AM +GI IA +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQVQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + ++ PFIGGQIS+F  ++  RIQ+ 
Sbjct: 61 VVALTGPFIGGQISAFTNVIFERIQNG 87


>gi|319403984|emb|CBI77572.1| Flagellar biosynthetic protein FliQ [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 88

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 69/88 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL++S P +F+AM  GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILTASGPAVFAAMSAGIIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|319405427|emb|CBI79046.1| Flagellar biosynthetic protein FliQ [Bartonella sp. AR 15-3]
          Length = 88

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/88 (55%), Positives = 69/88 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WT+L++S P +F+AM  GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTVLTASGPAVFAAMSTGIIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|116250506|ref|YP_766344.1| flagellar biosynthesis protein FliQ [Rhizobium leguminosarum bv.
          viciae 3841]
 gi|218461406|ref|ZP_03501497.1| flagellar biosynthesis protein FliQ [Rhizobium etli Kim 5]
 gi|218662877|ref|ZP_03518807.1| flagellar biosynthesis protein FliQ [Rhizobium etli IE4771]
 gi|218671389|ref|ZP_03521059.1| flagellar biosynthesis protein FliQ [Rhizobium etli GR56]
 gi|241203130|ref|YP_002974226.1| flagellar biosynthesis protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM1325]
 gi|115255154|emb|CAK06228.1| flagellar biosynthetic protein FliQ [Rhizobium leguminosarum bv.
          viciae 3841]
 gi|240857020|gb|ACS54687.1| flagellar biosynthetic protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM1325]
          Length = 88

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/87 (58%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T+ ++APF+G QIS F  LV SRIQS 
Sbjct: 61 TVGVTAPFVGSQISIFTNLVFSRIQSG 87


>gi|190890388|ref|YP_001976930.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
          652]
 gi|190695667|gb|ACE89752.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
          652]
 gi|327193066|gb|EGE59978.1| flagellar biosynthesis transmembrane protein [Rhizobium etli
          CNPAF512]
          Length = 88

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/87 (59%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQEATLTFVPKILAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T+ ++APFIG QIS F  LV SRIQS 
Sbjct: 61 TVGVTAPFIGSQISIFTNLVFSRIQSG 87


>gi|325291968|ref|YP_004277832.1| flagellar biosynthesis protein FliQ [Agrobacterium sp. H13-3]
 gi|325059821|gb|ADY63512.1| flagellar biosynthesis protein FliQ [Agrobacterium sp. H13-3]
          Length = 88

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 69/87 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT+L ++ P + +AM +G+ IAF+QALTQ+QE+TLTFVPKI+ + I
Sbjct: 1  MNEADALDIMQAAVWTVLVAAGPAVLAAMIVGVAIAFIQALTQVQEMTLTFVPKIVTIMI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L ++APF+G QI+ F  LV SR+QS 
Sbjct: 61 VLGVAAPFVGAQIALFSNLVFSRVQSG 87


>gi|209547952|ref|YP_002279869.1| flagellar biosynthesis protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209533708|gb|ACI53643.1| flagellar biosynthetic protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 88

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 70/87 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLIIALIQALTQVQEATLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T+ ++APF+G Q+S F  LV SRIQS 
Sbjct: 61 TVGVTAPFVGSQVSIFTNLVFSRIQSG 87


>gi|86356336|ref|YP_468228.1| flagellar biosynthesis protein FliQ [Rhizobium etli CFN 42]
 gi|86280438|gb|ABC89501.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
          42]
          Length = 88

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/87 (58%), Positives = 69/87 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L +S P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV +
Sbjct: 1  MNEADALDLFQAAIWTVLIASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + I+APF+G QIS F  LV SRIQS 
Sbjct: 61 VVGITAPFVGSQISIFTNLVFSRIQSG 87


>gi|254500261|ref|ZP_05112412.1| flagellar biosynthetic protein FliQ [Labrenzia alexandrii DFL-11]
 gi|222436332|gb|EEE43011.1| flagellar biosynthetic protein FliQ [Labrenzia alexandrii DFL-11]
          Length = 88

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 67/87 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L++ R A+WTIL  SAP +  AM +GI IA LQALTQ+QE+TLTF+PKI+A+ +
Sbjct: 1  MNEVDALDLVRTAIWTILIGSAPAIIPAMIVGIGIALLQALTQVQEITLTFIPKIVAILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++I+ PFIGGQ+ +  T++ SRI++ 
Sbjct: 61 MIVIAGPFIGGQMYALTTVIYSRIENG 87


>gi|15887925|ref|NP_353606.1| flagellar biosynthesis protein FliQ [Agrobacterium tumefaciens
          str. C58]
 gi|15155521|gb|AAK86391.1| flagellar biosynthetic protein [Agrobacterium tumefaciens str.
          C58]
          Length = 88

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT+L ++ P + +AM +G+ IAF+QALTQ+QE+TLTFVPKI+ + I
Sbjct: 1  MNEADALDIMQAAVWTVLVAAGPAVLAAMIVGVAIAFIQALTQVQEMTLTFVPKIVTIMI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L ++APF+G QI  F  LV SRIQS 
Sbjct: 61 VLGVAAPFVGAQIVLFSNLVFSRIQSG 87


>gi|17988509|ref|NP_541142.1| flagellar biosynthesis protein FliQ [Brucella melitensis bv. 1
          str. 16M]
 gi|23500848|ref|NP_700288.1| flagellar biosynthesis protein FliQ [Brucella suis 1330]
 gi|62317951|ref|YP_223804.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 1 str.
          9-941]
 gi|83269928|ref|YP_419219.1| flagellar biosynthesis protein FliQ [Brucella melitensis biovar
          Abortus 2308]
 gi|148558765|ref|YP_001257998.1| flagellar biosynthesis protein FliQ [Brucella ovis ATCC 25840]
 gi|161621176|ref|YP_001595062.1| flagellar biosynthesis protein FliQ [Brucella canis ATCC 23365]
 gi|163845451|ref|YP_001623106.1| flagellar biosynthesis protein FliQ [Brucella suis ATCC 23445]
 gi|225628423|ref|ZP_03786457.1| flagellar biosynthetic protein FliQ [Brucella ceti str. Cudo]
 gi|225686879|ref|YP_002734851.1| flagellar biosynthesis protein FliQ [Brucella melitensis ATCC
          23457]
 gi|237817496|ref|ZP_04596487.1| flagellar biosynthetic protein FliQ [Brucella abortus str. 2308
          A]
 gi|254691617|ref|ZP_05154871.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 6 str.
          870]
 gi|254695087|ref|ZP_05156915.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 3 str.
          Tulya]
 gi|254698183|ref|ZP_05160011.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254699257|ref|ZP_05161085.1| flagellar biosynthesis protein FliQ [Brucella suis bv. 5 str.
          513]
 gi|254702377|ref|ZP_05164205.1| flagellar biosynthesis protein FliQ [Brucella suis bv. 3 str.
          686]
 gi|254711213|ref|ZP_05173024.1| flagellar biosynthesis protein FliQ [Brucella pinnipedialis
          B2/94]
 gi|254711812|ref|ZP_05173623.1| flagellar biosynthesis protein FliQ [Brucella ceti M644/93/1]
 gi|254714881|ref|ZP_05176692.1| flagellar biosynthesis protein FliQ [Brucella ceti M13/05/1]
 gi|254720779|ref|ZP_05182590.1| flagellar biosynthesis protein FliQ [Brucella sp. 83/13]
 gi|254731628|ref|ZP_05190206.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 4 str.
          292]
 gi|256015892|ref|YP_003105901.1| flagellar biosynthesis protein FliQ [Brucella microti CCM 4915]
 gi|256030158|ref|ZP_05443772.1| flagellar biosynthesis protein FliQ [Brucella pinnipedialis
          M292/94/1]
 gi|256042860|ref|ZP_05445806.1| flagellar biosynthesis protein FliQ [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256059810|ref|ZP_05450005.1| flagellar biosynthesis protein FliQ [Brucella neotomae 5K33]
 gi|256112182|ref|ZP_05453103.1| flagellar biosynthesis protein FliQ [Brucella melitensis bv. 3
          str. Ether]
 gi|256158337|ref|ZP_05456241.1| flagellar biosynthesis protein FliQ [Brucella ceti M490/95/1]
 gi|256252729|ref|ZP_05458265.1| flagellar biosynthesis protein FliQ [Brucella ceti B1/94]
 gi|256256804|ref|ZP_05462340.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 9 str.
          C68]
 gi|256261984|ref|ZP_05464516.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 2
          str. 63/9]
 gi|260166790|ref|ZP_05753601.1| flagellar biosynthesis protein FliQ [Brucella sp. F5/99]
 gi|260544136|ref|ZP_05819957.1| flagellar biosynthetic protein FliQ [Brucella abortus NCTC 8038]
 gi|260564097|ref|ZP_05834582.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. 16M]
 gi|260568720|ref|ZP_05839189.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 4 str. 40]
 gi|260757248|ref|ZP_05869596.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 6 str.
          870]
 gi|260759387|ref|ZP_05871735.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 4 str.
          292]
 gi|260762630|ref|ZP_05874962.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260883052|ref|ZP_05894666.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 9 str.
          C68]
 gi|261215438|ref|ZP_05929719.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 3 str.
          Tulya]
 gi|261216571|ref|ZP_05930852.1| flagellar biosynthetic protein FliQ [Brucella ceti M13/05/1]
 gi|261219807|ref|ZP_05934088.1| flagellar biosynthetic protein FliQ [Brucella ceti B1/94]
 gi|261318804|ref|ZP_05958001.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          B2/94]
 gi|261319441|ref|ZP_05958638.1| flagellar biosynthetic protein FliQ [Brucella ceti M644/93/1]
 gi|261323790|ref|ZP_05962987.1| flagellar biosynthetic protein FliQ [Brucella neotomae 5K33]
 gi|261749696|ref|ZP_05993405.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 5 str.
          513]
 gi|261752940|ref|ZP_05996649.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 3 str.
          686]
 gi|261756167|ref|ZP_05999876.1| flagellar biosynthetic protein FliQ [Brucella sp. F5/99]
 gi|265985837|ref|ZP_06098572.1| flagellar biosynthetic protein FliQ [Brucella sp. 83/13]
 gi|265987189|ref|ZP_06099746.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M292/94/1]
 gi|265989295|ref|ZP_06101852.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. Rev.1]
 gi|265993609|ref|ZP_06106166.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 3
          str. Ether]
 gi|265996852|ref|ZP_06109409.1| flagellar biosynthetic protein FliQ [Brucella ceti M490/95/1]
 gi|294852962|ref|ZP_06793634.1| flagellar biosynthetic protein FliQ [Brucella sp. NVSL 07-0026]
 gi|297250157|ref|ZP_06933858.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 5 str.
          B3196]
 gi|306845413|ref|ZP_07477987.1| flagellar biosynthetic protein FliQ [Brucella sp. BO1]
 gi|17984301|gb|AAL53406.1| flagellar biosynthetic protein fliq [Brucella melitensis bv. 1
          str. 16M]
 gi|23464512|gb|AAN34293.1| flagellar biosynthesis protein FliQ [Brucella suis 1330]
 gi|62198144|gb|AAX76443.1| FliQ, flagellar biosynthesis protein [Brucella abortus bv. 1 str.
          9-941]
 gi|82940202|emb|CAJ13258.1| Bacterial export protein FliQ, family 3:Flagellar biosynthesis
          protein FliQ [Brucella melitensis biovar Abortus 2308]
 gi|148370050|gb|ABQ62922.1| flagellar biosynthetic protein FliQ [Brucella ovis ATCC 25840]
 gi|161337987|gb|ABX64291.1| flagellar biosynthetic protein FliQ [Brucella canis ATCC 23365]
 gi|163676174|gb|ABY40284.1| flagellar biosynthetic protein FliQ [Brucella suis ATCC 23445]
 gi|225616269|gb|EEH13317.1| flagellar biosynthetic protein FliQ [Brucella ceti str. Cudo]
 gi|225642984|gb|ACO02897.1| flagellar biosynthetic protein FliQ [Brucella melitensis ATCC
          23457]
 gi|237787331|gb|EEP61548.1| flagellar biosynthetic protein FliQ [Brucella abortus str. 2308
          A]
 gi|255998552|gb|ACU50239.1| flagellar biosynthesis protein FliQ [Brucella microti CCM 4915]
 gi|260097407|gb|EEW81281.1| flagellar biosynthetic protein FliQ [Brucella abortus NCTC 8038]
 gi|260151740|gb|EEW86833.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. 16M]
 gi|260155385|gb|EEW90466.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 4 str. 40]
 gi|260669705|gb|EEX56645.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 4 str.
          292]
 gi|260673051|gb|EEX59872.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260677356|gb|EEX64177.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 6 str.
          870]
 gi|260872580|gb|EEX79649.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 9 str.
          C68]
 gi|260917045|gb|EEX83906.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 3 str.
          Tulya]
 gi|260918391|gb|EEX85044.1| flagellar biosynthetic protein FliQ [Brucella ceti B1/94]
 gi|260921660|gb|EEX88228.1| flagellar biosynthetic protein FliQ [Brucella ceti M13/05/1]
 gi|261292131|gb|EEX95627.1| flagellar biosynthetic protein FliQ [Brucella ceti M644/93/1]
 gi|261298027|gb|EEY01524.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          B2/94]
 gi|261299770|gb|EEY03267.1| flagellar biosynthetic protein FliQ [Brucella neotomae 5K33]
 gi|261736151|gb|EEY24147.1| flagellar biosynthetic protein FliQ [Brucella sp. F5/99]
 gi|261739449|gb|EEY27375.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 5 str.
          513]
 gi|261742693|gb|EEY30619.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 3 str.
          686]
 gi|262551149|gb|EEZ07310.1| flagellar biosynthetic protein FliQ [Brucella ceti M490/95/1]
 gi|262764479|gb|EEZ10511.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 3
          str. Ether]
 gi|262999964|gb|EEZ12654.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. Rev.1]
 gi|263091468|gb|EEZ16004.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 2
          str. 63/9]
 gi|264659386|gb|EEZ29647.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M292/94/1]
 gi|264664429|gb|EEZ34690.1| flagellar biosynthetic protein FliQ [Brucella sp. 83/13]
 gi|294818617|gb|EFG35617.1| flagellar biosynthetic protein FliQ [Brucella sp. NVSL 07-0026]
 gi|297174026|gb|EFH33390.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 5 str.
          B3196]
 gi|306274156|gb|EFM55972.1| flagellar biosynthetic protein FliQ [Brucella sp. BO1]
 gi|326411297|gb|ADZ68361.1| flagellar biosynthesis protein FliQ [Brucella melitensis M28]
 gi|326554586|gb|ADZ89225.1| flagellar biosynthesis protein FliQ [Brucella melitensis M5-90]
          Length = 88

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I  +A+WT+L++S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+
Sbjct: 1  MNEADALDIVNSAIWTVLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L ++APF+G QI++F  L  SRI+  
Sbjct: 61 VLALTAPFVGAQINAFTLLAYSRIEKG 87


>gi|153011502|ref|YP_001372716.1| flagellar biosynthesis protein FliQ [Ochrobactrum anthropi ATCC
          49188]
 gi|239834421|ref|ZP_04682749.1| flagellar biosynthetic protein FliQ [Ochrobactrum intermedium LMG
          3301]
 gi|151563390|gb|ABS16887.1| flagellar biosynthetic protein FliQ [Ochrobactrum anthropi ATCC
          49188]
 gi|239822484|gb|EEQ94053.1| flagellar biosynthetic protein FliQ [Ochrobactrum intermedium LMG
          3301]
          Length = 88

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (74%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I  +A+WT+L +S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+
Sbjct: 1  MNEADALDIVNSAIWTVLMASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L ++APF+G QI+SF  L  SRI+  
Sbjct: 61 VLALTAPFVGAQINSFTLLAYSRIEKG 87


>gi|319409163|emb|CBI82807.1| Flagellar biosynthetic protein FliQ [Bartonella schoenbuchensis
          R1]
          Length = 88

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL +S P + +AM +GI IA  QALTQ+QE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILIASGPAVLAAMSIGICIALFQALTQVQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L ++APFIGGQI +F  LV +RI++ 
Sbjct: 61 VLALTAPFIGGQIYAFTQLVYNRIETG 87


>gi|319898662|ref|YP_004158755.1| flagellar biosynthetic protein FliQ [Bartonella clarridgeiae 73]
 gi|319402626|emb|CBI76171.1| Flagellar biosynthetic protein FliQ [Bartonella clarridgeiae 73]
          Length = 88

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL++S P + +AM  G++IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILTASGPAVLAAMSAGVIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L  +APF+GGQI +F  LV +RI++ 
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETG 87


>gi|328545485|ref|YP_004305594.1| flagellar biosynthesis transmembrane protein [polymorphum gilvum
          SL003B-26A1]
 gi|326415226|gb|ADZ72289.1| Flagellar biosynthesis transmembrane protein [Polymorphum gilvum
          SL003B-26A1]
          Length = 88

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ R+A+WTI+  SAP +  AM +GI IA +QALTQ+QEVTLTF+PKI+A+ +
Sbjct: 1  MNEADALDLVRSAIWTIIVGSAPAIVPAMVVGIGIALMQALTQVQEVTLTFIPKIVAILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++I+ PFIG QI +   LV  RI++ 
Sbjct: 61 MIVIAGPFIGAQIYALTALVYGRIETG 87


>gi|319781659|ref|YP_004141135.1| flagellar biosynthetic protein FliQ [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317167547|gb|ADV11085.1| flagellar biosynthetic protein FliQ [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 88

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +SAPV+  AM +GI IA +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAVWTVLVASAPVVLVAMVVGIGIALIQALTQVQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + ++ PFIG QIS+F  ++  RIQ+ 
Sbjct: 61 VVALTGPFIGSQISAFTNVIFERIQNG 87


>gi|121602368|ref|YP_989377.1| flagellar biosynthesis protein FliQ [Bartonella bacilliformis
          KC583]
 gi|120614545|gb|ABM45146.1| flagellar biosynthetic protein FliQ [Bartonella bacilliformis
          KC583]
          Length = 88

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WT+L +S P + +AM +GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTVLIASGPAVLAAMSVGIIIALFQALTQIQEMTLTFIPKIIVIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L  +APF+GGQI +F  LV +RI++ 
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIEAG 87


>gi|254706502|ref|ZP_05168330.1| flagellar biosynthesis protein FliQ [Brucella pinnipedialis
          M163/99/10]
 gi|261313956|ref|ZP_05953153.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M163/99/10]
 gi|261302982|gb|EEY06479.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M163/99/10]
          Length = 88

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 65/87 (74%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+I  +A+WT+L++S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+
Sbjct: 1  MNEVDALDIVNSAIWTVLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L ++APF+G QI++F  L  SRI+  
Sbjct: 61 VLALTAPFVGAQINAFTLLAYSRIEKG 87


>gi|296445190|ref|ZP_06887150.1| flagellar biosynthetic protein FliQ [Methylosinus trichosporium
          OB3b]
 gi|296257364|gb|EFH04431.1| flagellar biosynthetic protein FliQ [Methylosinus trichosporium
          OB3b]
          Length = 88

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD LEI + A++T+L  S PV+ +AM +G++IA LQALTQ+QE+TLTFVPKIIA+F+
Sbjct: 1  MNEADALEIMQRAIFTVLVVSGPVVGAAMLVGVVIALLQALTQVQEMTLTFVPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L +SAPFIG QIS+F     ++I+  
Sbjct: 61 ALGLSAPFIGSQISAFTDYAYAKIEKG 87


>gi|217976246|ref|YP_002360393.1| flagellar biosynthesis protein FliQ [Methylocella silvestris BL2]
 gi|217501622|gb|ACK49031.1| flagellar biosynthetic protein FliQ [Methylocella silvestris BL2]
          Length = 88

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD LE+ R+A+WTI+  S P + +AMF+G++IA LQALTQIQE TLTFVPKI+ +F+
Sbjct: 1  MNEADALELIRSAIWTIIVGSGPPVAAAMFVGLIIALLQALTQIQETTLTFVPKIVVIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L    PFIG QI +F   V  RI+  
Sbjct: 61 VLSFGGPFIGAQIFAFTEHVYGRIEKG 87


>gi|254473481|ref|ZP_05086878.1| flagellar biosynthetic protein FliQ [Pseudovibrio sp. JE062]
 gi|211957597|gb|EEA92800.1| flagellar biosynthetic protein FliQ [Pseudovibrio sp. JE062]
          Length = 88

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 65/87 (74%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I R A+WT+++++ P +  AMF+G++IA  QALTQIQE+TLTF+PKI+ +FI
Sbjct: 1  MNEADALDIVRTAIWTVITATGPAVAGAMFVGLIIALFQALTQIQEMTLTFIPKIVVIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + ++ PFIG QI S   +V  RI+  
Sbjct: 61 LIAMTGPFIGSQIFSLTEMVYGRIEHG 87


>gi|110632634|ref|YP_672842.1| flagellar biosynthesis protein FliQ [Mesorhizobium sp. BNC1]
 gi|110283618|gb|ABG61677.1| flagellar biosynthetic protein FliQ [Chelativorans sp. BNC1]
          Length = 88

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 66/87 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +S P +  AM +G+ IA +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAIWTVLLASGPAVIVAMVVGVGIALVQALTQVQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + +S PF+G QISSF  ++  RI++ 
Sbjct: 61 AIALSGPFVGTQISSFTNVIFQRIENG 87


>gi|218680427|ref|ZP_03528324.1| flagellar biosynthesis protein FliQ [Rhizobium etli CIAT 894]
          Length = 88

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 69/87 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L +S P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV +
Sbjct: 1  MNEADALDLFQAAIWTVLIASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + ++APF+G Q+S F  LV SRIQS 
Sbjct: 61 VVGVTAPFVGSQVSIFTNLVFSRIQSG 87


>gi|188579931|ref|YP_001923376.1| flagellar biosynthesis protein FliQ [Methylobacterium populi
          BJ001]
 gi|179343429|gb|ACB78841.1| flagellar biosynthetic protein FliQ [Methylobacterium populi
          BJ001]
          Length = 88

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 64/87 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D LE+ R+A+WT+L ++ P + +AM +GI +A LQALTQ+QEVTLTFVPKI+A+ +
Sbjct: 1  MNEVDALELVRSAIWTVLVAAGPSVGAAMLVGIAVALLQALTQVQEVTLTFVPKIVAILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++++  F+G QI +F  +   RI + 
Sbjct: 61 VMLVTGTFVGSQIYAFAEMTYGRIATG 87


>gi|163850129|ref|YP_001638172.1| flagellar biosynthesis protein FliQ [Methylobacterium extorquens
          PA1]
 gi|218528733|ref|YP_002419549.1| flagellar biosynthesis protein FliQ [Methylobacterium
          chloromethanicum CM4]
 gi|240137263|ref|YP_002961732.1| putative outer proteins translocation protein S [Methylobacterium
          extorquens AM1]
 gi|254559274|ref|YP_003066369.1| outer proteins translocation protein S [Methylobacterium
          extorquens DM4]
 gi|163661734|gb|ABY29101.1| flagellar biosynthetic protein FliQ [Methylobacterium extorquens
          PA1]
 gi|218521036|gb|ACK81621.1| flagellar biosynthetic protein FliQ [Methylobacterium
          chloromethanicum CM4]
 gi|240007229|gb|ACS38455.1| Putative outer proteins translocation protein S [Methylobacterium
          extorquens AM1]
 gi|254266552|emb|CAX22316.1| Putative outer proteins translocation protein S [Methylobacterium
          extorquens DM4]
          Length = 88

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 64/87 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D LE+ R+A+WT++ ++ P + +AM +GI +A LQALTQIQEVTLTFVPKI+A+ +
Sbjct: 1  MNEVDALELVRSAIWTVIVAAGPSVGAAMLVGIAVALLQALTQIQEVTLTFVPKIVAILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++++  F+G QI +F  +   RI + 
Sbjct: 61 VMLVTGTFVGAQIYAFAEMTYGRIATG 87


>gi|115523199|ref|YP_780110.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisA53]
 gi|115517146|gb|ABJ05130.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          BisA53]
          Length = 88

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 64/87 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+IA+ A+WTI+ +S P + +AMF+GI IA LQALTQ+QE+TLTF+PKI+ + I
Sbjct: 1  MNERDALDIAQQAVWTIIVASGPAVAAAMFVGIAIALLQALTQVQEMTLTFIPKIVVMLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + +S  F+G  I +F  L+ SRI+  
Sbjct: 61 VVAVSGSFMGAHIYAFTELLYSRIEHG 87


>gi|170748119|ref|YP_001754379.1| flagellar biosynthesis protein FliQ [Methylobacterium
          radiotolerans JCM 2831]
 gi|170654641|gb|ACB23696.1| flagellar biosynthetic protein FliQ [Methylobacterium
          radiotolerans JCM 2831]
          Length = 88

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (74%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D LE+ R+A+WTI+ +S P + +AM +GILIA  QALTQIQEVTLTFVPKI+ V I
Sbjct: 1  MNEIDALELVRSAIWTIIVASGPAVGAAMVVGILIALFQALTQIQEVTLTFVPKIVVVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           +I++  F+GGQI +F  +V  RI S 
Sbjct: 61 VMIVTGSFVGGQIYAFTEMVYGRIVSG 87


>gi|304392487|ref|ZP_07374427.1| flagellar biosynthetic protein FliQ [Ahrensia sp. R2A130]
 gi|303295117|gb|EFL89477.1| flagellar biosynthetic protein FliQ [Ahrensia sp. R2A130]
          Length = 88

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 63/87 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ + A+W I+ +SAP + +AM +GI IA LQALTQ+QEVTLTFVPKI+A+ +
Sbjct: 1  MNEADALQLVQQAIWAIIVASAPAVTAAMVVGIAIALLQALTQVQEVTLTFVPKIMAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L++ A F+G Q+ S  T +   I+  
Sbjct: 61 ALLLGATFMGAQLGSLTTTIFDSIERG 87


>gi|182680451|ref|YP_001834597.1| flagellar biosynthesis protein FliQ [Beijerinckia indica subsp.
          indica ATCC 9039]
 gi|182636334|gb|ACB97108.1| flagellar biosynthetic protein FliQ [Beijerinckia indica subsp.
          indica ATCC 9039]
          Length = 88

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 67/85 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD LE+ R+A+WT+L  + P + +AM +G++IA  QALTQIQE+TLTFVPKI+ +F+
Sbjct: 1  MNEADALELIRSAIWTMLVVAGPAVAAAMAIGLIIALFQALTQIQEMTLTFVPKIVVMFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           L+++APF+G QI SF   + +RIQ
Sbjct: 61 ILMLAAPFMGSQIYSFTERIYARIQ 85


>gi|323136995|ref|ZP_08072075.1| export protein FliQ family 3 [Methylocystis sp. ATCC 49242]
 gi|322397756|gb|EFY00278.1| export protein FliQ family 3 [Methylocystis sp. ATCC 49242]
          Length = 88

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 63/87 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD LEI    + TIL  S P++ +AM +G+++A +QALTQ+QE+TLTFVPKI+A+  
Sbjct: 1  MNEADALEIVHRTIVTILLVSGPLVGAAMVVGVIVALVQALTQVQEMTLTFVPKIVAMLA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L +SAPFIG +I +    V SRI++ 
Sbjct: 61 VLSLSAPFIGSKIYALAQFVYSRIETG 87


>gi|218506520|ref|ZP_03504398.1| flagellar biosynthesis protein FliQ [Rhizobium etli Brasil 5]
          Length = 70

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 59/70 (84%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + SAM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVISAMVVGLVIALIQALTQVQEATLTFVPKILAVLI 60

Query: 61 TLIISAPFIG 70
          T+ ++APFIG
Sbjct: 61 TVGVTAPFIG 70


>gi|90422630|ref|YP_531000.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisB18]
 gi|90104644|gb|ABD86681.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          BisB18]
          Length = 88

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 61/87 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+I + A+WTI+  S P + +AM +G+ IA LQALTQ+QE+TLTF+PKI+ + I
Sbjct: 1  MNERDALDIVQQAIWTIIVVSGPAVGAAMAVGVAIALLQALTQVQEMTLTFIPKIVVMLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + +S  F+G  I +F  L+ SRI+  
Sbjct: 61 VVAVSGSFMGAHIYAFTELLYSRIEHG 87


>gi|27381963|ref|NP_773492.1| flagellar biosynthesis protein FliQ [Bradyrhizobium japonicum
          USDA 110]
 gi|27355133|dbj|BAC52117.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA
          110]
          Length = 88

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 63/87 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+I +AA+WTI+ +S P + +AM +G +IA +QALTQIQEVTLTFVPKII + +
Sbjct: 1  MNERDALDIVQAAIWTIIVASGPAVGAAMLVGTIIALIQALTQIQEVTLTFVPKIIVILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           + IS  FIG  +S+F  +V S I+  
Sbjct: 61 VVAISGSFIGAHLSTFTEMVYSHIERG 87


>gi|209963541|ref|YP_002296456.1| flagellar biosynthesis protein FliQ [Rhodospirillum centenum SW]
 gi|209957007|gb|ACI97643.1| flagellar biosynthesis protein FliQ [Rhodospirillum centenum SW]
          Length = 88

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 64/87 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADV E+ RA +W  + ++ PVL  A+ +G  I+ LQALTQ+QE TL+FVPKI+A+ +
Sbjct: 1  MNEADVFELVRAGIWAAVWAAGPVLAVALLVGFGISLLQALTQLQEATLSFVPKIVAMLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T++++ PF+ G +++F   V++RI  +
Sbjct: 61 TIVLALPFMYGVLATFTEQVVARIGGA 87


>gi|158422277|ref|YP_001523569.1| flagellar biosynthesis protein FliQ [Azorhizobium caulinodans ORS
          571]
 gi|158329166|dbj|BAF86651.1| flagellar biosynthesis protein [Azorhizobium caulinodans ORS 571]
          Length = 88

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 61/87 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ R A+WTIL ++ P + +AM +GI IA +QALTQIQE TLTFVPKIIAV +
Sbjct: 1  MNEADALDVVRNAIWTILLAAGPAVAAAMLVGIFIALIQALTQIQEATLTFVPKIIAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
             ++  F+G QI +F   +  RI S 
Sbjct: 61 VCALTGSFMGSQIMAFTEEIYGRIASG 87


>gi|114706622|ref|ZP_01439523.1| flagellar biosynthesis protein Q [Fulvimarina pelagi HTCC2506]
 gi|114538014|gb|EAU41137.1| flagellar biosynthesis protein Q [Fulvimarina pelagi HTCC2506]
          Length = 92

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 65/88 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+AD ++I + A+WTI+++ AP + +AM +GI+IA  QALTQIQE+TLTFVPKI+A+F+
Sbjct: 1  MNQADAIDIVQEAIWTIITACAPAVAAAMIVGIVIALFQALTQIQEMTLTFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + I+A F G Q+ +F      RI++  
Sbjct: 61 VIAITASFTGAQVYAFTQEAYGRIETGF 88


>gi|307945652|ref|ZP_07660988.1| flagellar biosynthetic protein FliQ [Roseibium sp. TrichSKD4]
 gi|307771525|gb|EFO30750.1| flagellar biosynthetic protein FliQ [Roseibium sp. TrichSKD4]
          Length = 88

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 59/76 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL++AR  +WT++  SAPV+   + +G++IA  QALTQIQE+TL FVPKI+A+F+
Sbjct: 1  MTGGEVLDLAREGVWTMIFISAPVMIIGLLVGVVIALFQALTQIQEMTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSF 76
          TL++S PF+G  ++SF
Sbjct: 61 TLLLSLPFMGQLLASF 76


>gi|154253015|ref|YP_001413839.1| flagellar biosynthetic protein FliQ [Parvibaculum lavamentivorans
          DS-1]
 gi|154156965|gb|ABS64182.1| flagellar biosynthetic protein FliQ [Parvibaculum lavamentivorans
          DS-1]
          Length = 87

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 64/84 (76%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  +VL++AR A++  L  SAP++  A+ +G+ IA LQALTQ+QE+TL FVPKI+A+F+
Sbjct: 1  MSGPEVLDLARQAIYVQLIVSAPMMAVALLVGLAIALLQALTQVQEMTLVFVPKIVAIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T++IS PF+   +S F+TLV  +I
Sbjct: 61 TMLISLPFMAQALSGFMTLVAQKI 84


>gi|197104396|ref|YP_002129773.1| flagellar biosynthesis protein FliQ [Phenylobacterium zucineum
          HLK1]
 gi|196477816|gb|ACG77344.1| flagellar biosynthesis protein FliQ [Phenylobacterium zucineum
          HLK1]
          Length = 87

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 59/86 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+VL++ R A+W  +  SAPVL   + +G+ I  LQALTQIQE TL + PKI+A+FI
Sbjct: 1  MNGAEVLDVGRDAIWLTIQLSAPVLIVGLIVGVGIGLLQALTQIQEATLVYAPKIVAIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I  P +G  +S F+  + +RI +
Sbjct: 61 SLLIFLPLMGALMSGFMRHIAARIAA 86


>gi|209884538|ref|YP_002288395.1| flagellar biosynthetic protein FliQ [Oligotropha carboxidovorans
          OM5]
 gi|209872734|gb|ACI92530.1| flagellar biosynthetic protein FliQ [Oligotropha carboxidovorans
          OM5]
          Length = 87

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN  +VLE+AR A+WT++  +APVL   + +G+ I+ +QALTQIQE TL FVPKI+AVF+
Sbjct: 1  MNGLEVLEVARDAIWTMVLVAAPVLLVGLIVGVAISLVQALTQIQEQTLVFVPKILAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+I+ PF+   +   +  + SRI
Sbjct: 61 TLLIALPFMADAMHGQMMRISSRI 84


>gi|114570482|ref|YP_757162.1| flagellar biosynthesis protein FliQ [Maricaulis maris MCS10]
 gi|114340944|gb|ABI66224.1| flagellar biosynthetic protein FliQ [Maricaulis maris MCS10]
          Length = 87

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 61/87 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL+ AR A+W +L+ +AP++   + +G+ IA  QALTQ+QE+TL FVPKIIA+F+
Sbjct: 1  MTGPEVLDFAREAIWLMLAMAAPIMLVGLAVGVTIALFQALTQVQEMTLVFVPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L++  P +GG ++ F+ ++  RI + 
Sbjct: 61 ALLLFLPLMGGLMAGFMAMIFDRIANP 87


>gi|306841282|ref|ZP_07473993.1| flagellar biosynthesis protein FliQ [Brucella sp. BO2]
 gi|306288684|gb|EFM60015.1| flagellar biosynthesis protein FliQ [Brucella sp. BO2]
          Length = 72

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 53/71 (74%)

Query: 17 ILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          +L++S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+ L ++APF+G QI++F
Sbjct: 1  MLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFVVLALTAPFVGAQINAF 60

Query: 77 VTLVLSRIQSS 87
            L  SRI+  
Sbjct: 61 TLLAYSRIEKG 71


>gi|254292630|ref|YP_003058653.1| flagellar biosynthesis protein FliQ [Hirschia baltica ATCC 49814]
 gi|254041161|gb|ACT57956.1| flagellar biosynthetic protein FliQ [Hirschia baltica ATCC 49814]
          Length = 87

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 61/86 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL++ R A+W  ++ + PV+ + + +G++IA +QALTQ+QE+TL FVPKI+A+F+
Sbjct: 1  MTGAEVLDLGRDALWATVAMATPVMVAGLVVGVVIALMQALTQVQEMTLVFVPKILAIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL++  P +G  ++ F   + +RI  
Sbjct: 61 TLLLFLPMMGATLAGFSDSIFARIAG 86


>gi|312115274|ref|YP_004012870.1| flagellar biosynthetic protein FliQ [Rhodomicrobium vannielii
          ATCC 17100]
 gi|311220403|gb|ADP71771.1| flagellar biosynthetic protein FliQ [Rhodomicrobium vannielii
          ATCC 17100]
          Length = 88

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 60/87 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+AD +++ ++A+W ++ +S P++ +AM +GI I+  QALTQIQE TLTF+PKI+ VF+
Sbjct: 1  MNQADAMDLVKSAIWVVILASGPMIGAAMAVGIAISLFQALTQIQEATLTFIPKIVTVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
            +++A FIG  +        SRI+  
Sbjct: 61 VAMLTASFIGSVLLGISEQAYSRIEHG 87


>gi|254470264|ref|ZP_05083668.1| flagellar biosynthetic protein FliQ [Pseudovibrio sp. JE062]
 gi|211960575|gb|EEA95771.1| flagellar biosynthetic protein FliQ [Pseudovibrio sp. JE062]
          Length = 88

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 57/76 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL+IA   +WT++  SAPV+   + +G+++A  QALTQIQE TL FVPKI+++FI
Sbjct: 1  MTGAEVLDIASEGIWTLILVSAPVMLIGLLVGVIVALFQALTQIQEQTLVFVPKILSIFI 60

Query: 61 TLIISAPFIGGQISSF 76
           L+++ PF+G  ++SF
Sbjct: 61 ALLVTLPFMGELMNSF 76


>gi|118588698|ref|ZP_01546106.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614]
 gi|118438684|gb|EAV45317.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614]
          Length = 88

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 62/87 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL++AR  +WT++  + PV+   + +G++IA  QALTQIQE+TL FVPKI+A+F+
Sbjct: 1  MTGGEVLDLAREGVWTMILVAGPVMIVGLLVGVVIALFQALTQIQEMTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          T++IS PF+   + +F++ V   I ++
Sbjct: 61 TILISLPFMSQVLEAFMSRVAEMILTT 87


>gi|92116948|ref|YP_576677.1| flagellar biosynthesis protein FliQ [Nitrobacter hamburgensis
          X14]
 gi|91799842|gb|ABE62217.1| flagellar biosynthetic protein FliQ [Nitrobacter hamburgensis
          X14]
          Length = 87

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 61/84 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L++AR A+WTI+  S P+L   + +G++I+ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGAETLDVARDAIWTIVLVSGPLLGVGLIVGVVISLVQALTQIQEQTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+   + + +  + SRI
Sbjct: 61 TLVLALPFMADALHAEMMRISSRI 84


>gi|83858792|ref|ZP_00952314.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853615|gb|EAP91467.1| flagellar biosynthesis protein [Oceanicaulis alexandrii HTCC2633]
          Length = 87

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 57/87 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL+I   A+W +L  +APV+   + +G+LIA  QALTQ+QE+TL FVPKII +F+
Sbjct: 1  MTAGEVLDIGAEAIWVMLGMAAPVMLIGLAVGVLIALFQALTQVQEMTLVFVPKIIVIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L+I  P +G  ++ F+  +  RI + 
Sbjct: 61 ALLIFLPMMGALLNGFMQTIADRIVAG 87


>gi|75675328|ref|YP_317749.1| flagellar biosynthesis protein FliQ [Nitrobacter winogradskyi
          Nb-255]
 gi|74420198|gb|ABA04397.1| Flagellar biosynthesis protein FliQ [Nitrobacter winogradskyi
          Nb-255]
          Length = 87

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 60/84 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L++AR A+WTI+  S P+L   + +G+ I+ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGAETLDVARDAIWTIVLVSGPLLGVGLIVGVAISLVQALTQIQEQTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+   + + +  + SRI
Sbjct: 61 TLVLALPFMADALHAEMLRISSRI 84


>gi|85716545|ref|ZP_01047515.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696546|gb|EAQ34434.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 105

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           M  A+ L++AR A+WTI+  S P+L   + +G+ I+ +QALTQIQE TL FVPKI+A+F+
Sbjct: 19  MTGAETLDVARDAIWTIVLVSGPLLGVGLIVGVAISLVQALTQIQEQTLVFVPKILAIFV 78

Query: 61  TLIISAPFIGGQISSFVTLVLSRI 84
           T++++ PF+   + + +  + SRI
Sbjct: 79  TMVLALPFMADALHAEMIRISSRI 102


>gi|163744321|ref|ZP_02151681.1| flagellar biosynthesis protein Q [Oceanibulbus indolifex HEL-45]
 gi|161381139|gb|EDQ05548.1| flagellar biosynthesis protein Q [Oceanibulbus indolifex HEL-45]
          Length = 89

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 57/87 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E    +I    +W +L +S PVL  A+ +G++IAF QALTQIQE+TLTFVPKI+ +F+
Sbjct: 1  MTETQTYDIISDTVWAVLLASGPVLGVALGIGLVIAFFQALTQIQEMTLTFVPKIVMIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          TL+++ PF+   + +    V   +Q+ 
Sbjct: 61 TLLVATPFMYATLKNLSDTVFDLVQNG 87


>gi|163794131|ref|ZP_02188104.1| Flagellar biosynthesis protein FliQ [alpha proteobacterium
          BAL199]
 gi|159180745|gb|EDP65264.1| Flagellar biosynthesis protein FliQ [alpha proteobacterium
          BAL199]
          Length = 88

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 58/84 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E D L IAR A+ T+L+ S P++  A+ +G+ IA  QALTQ+QE+TL FVPKI+ VF 
Sbjct: 1  MTEEDALSIARDAVLTLLTMSGPIMAVALTVGLTIALFQALTQLQEMTLVFVPKIMVVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L++  PF+  QIS+F   +  +I
Sbjct: 61 SLMLLLPFMLAQISAFFEGIADKI 84


>gi|328543168|ref|YP_004303277.1| flagellar biosynthesis protein Q [polymorphum gilvum SL003B-26A1]
 gi|326412914|gb|ADZ69977.1| Flagellar biosynthesis protein Q [Polymorphum gilvum SL003B-26A1]
          Length = 88

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 60/77 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL++AR  +WT++  SAP++   + +G++IA  QALTQIQE+TL FVPKI+A+F+
Sbjct: 1  MTGPEVLDVAREGVWTLILVSAPIMVVGLVVGVVIALFQALTQIQEMTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFV 77
          T+I++ PF+G  +++F+
Sbjct: 61 TMIVTLPFMGQLLAAFM 77


>gi|84502403|ref|ZP_01000539.1| hypothetical protein OB2597_20346 [Oceanicola batsensis HTCC2597]
 gi|84389215|gb|EAQ02012.1| hypothetical protein OB2597_20346 [Oceanicola batsensis HTCC2597]
          Length = 89

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E D  EI      T+L +S+P+L  A+ +G++IAF QALTQIQE+TLTFVPKI A+F+
Sbjct: 1  MTETDAYEILSDTFLTVLIASSPILGVALVVGLVIAFFQALTQIQEMTLTFVPKIAAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+++ P I   + S    V   I S
Sbjct: 61 VLLVATPLIYATVKSLSDQVFDLISS 86


>gi|299131773|ref|ZP_07024968.1| flagellar biosynthetic protein FliQ [Afipia sp. 1NLS2]
 gi|298591910|gb|EFI52110.1| flagellar biosynthetic protein FliQ [Afipia sp. 1NLS2]
          Length = 87

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VLE+AR ++WTI+  SAPVL   + +G+ I+ +QALTQIQE TL FVPKI+AVFI
Sbjct: 1  MTGPEVLEVARDSIWTIVLVSAPVLLVGLVVGVAISLVQALTQIQEQTLVFVPKILAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+   + S +  + SRI
Sbjct: 61 TLLVALPFMADAMHSHMMRISSRI 84


>gi|254504458|ref|ZP_05116609.1| flagellar biosynthetic protein FliQ [Labrenzia alexandrii DFL-11]
 gi|222440529|gb|EEE47208.1| flagellar biosynthetic protein FliQ [Labrenzia alexandrii DFL-11]
          Length = 90

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 56/77 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL++AR+A+W ++  + P +   + +G++IA  QALTQIQE+TL FVPKI+A+F+
Sbjct: 1  MTGPEVLDLARSAVWAMILIAGPTMVIGLLVGVIIALFQALTQIQEMTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFV 77
          TL++S PF+   +  F+
Sbjct: 61 TLLLSLPFMSQVLEGFM 77


>gi|167645347|ref|YP_001683010.1| flagellar biosynthesis protein FliQ [Caulobacter sp. K31]
 gi|167347777|gb|ABZ70512.1| flagellar biosynthetic protein FliQ [Caulobacter sp. K31]
          Length = 87

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL++ R A+W  L   AP+L   + +G+ I   QALTQIQE TL + PKI+A+F+
Sbjct: 1  MTGAEVLDVGRDAIWLTLQLCAPILLVGLVVGVAIGLFQALTQIQEATLVYAPKIVAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L++  P +G  +S F+  +  +I  
Sbjct: 61 ALLLFLPLMGALMSGFMKEIAGKIAG 86


>gi|225375340|ref|ZP_03752561.1| hypothetical protein ROSEINA2194_00965 [Roseburia inulinivorans
          DSM 16841]
 gi|225212829|gb|EEG95183.1| hypothetical protein ROSEINA2194_00965 [Roseburia inulinivorans
          DSM 16841]
          Length = 90

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 58/83 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + E  VL+IA+ A++ I+  SAPVL  ++ +G++I+  Q +T IQE TLTFVPKI+AVFI
Sbjct: 2  ITEGQVLDIAKDAIYYIIICSAPVLIISLVVGLIISIFQTVTSIQEQTLTFVPKIVAVFI 61

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           L++   +I  Q+S FVT + S 
Sbjct: 62 GLMVCGSWILNQLSEFVTTLWSN 84


>gi|83944177|ref|ZP_00956633.1| flagellar biosynthesis protein [Sulfitobacter sp. EE-36]
 gi|83955122|ref|ZP_00963778.1| flagellar biosynthesis protein [Sulfitobacter sp. NAS-14.1]
 gi|83840451|gb|EAP79624.1| flagellar biosynthesis protein [Sulfitobacter sp. NAS-14.1]
 gi|83845044|gb|EAP82925.1| flagellar biosynthesis protein [Sulfitobacter sp. EE-36]
          Length = 89

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   + EI R  +   L  SAPVL  A+ +G+ IAF QALTQIQE+TLTFVPKI A+F+
Sbjct: 1  MDSVTIYEIIRQTLTVTLIGSAPVLVVALGVGLAIAFFQALTQIQEMTLTFVPKIAAIFV 60

Query: 61 TLIISAPFI 69
          TL IS PFI
Sbjct: 61 TLAISIPFI 69


>gi|288962709|ref|YP_003453003.1| FliQ protein [Azospirillum sp. B510]
 gi|288914975|dbj|BAI76459.1| FliQ protein [Azospirillum sp. B510]
          Length = 88

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 58/76 (76%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+ADVLE+ R  +WT L  +AP L  A+ +G+ I+ +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNQADVLEVLRGGIWTTLLVAAPPLIVAVVVGVGISLVQALTQVQEMTLTFVPKIVAILV 60

Query: 61 TLIISAPFIGGQISSF 76
            +++ PF+ G ++++
Sbjct: 61 VTVLALPFMYGALATY 76


>gi|320354333|ref|YP_004195672.1| flagellar biosynthetic protein FliQ [Desulfobulbus propionicus
          DSM 2032]
 gi|320122835|gb|ADW18381.1| flagellar biosynthetic protein FliQ [Desulfobulbus propionicus
          DSM 2032]
          Length = 89

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 62/86 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ I R A+ TIL +SAP+L +AM +G++I+  QA TQI E T+TF+PKI+AVFI
Sbjct: 1  MSPEAVIHIGRKAVETILLTSAPMLIAAMVIGLIISIFQAATQINEQTMTFIPKIVAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+I  P+I   + +F T ++++I +
Sbjct: 61 TLLIFGPWIMELLITFTTGIINQIAT 86


>gi|170744549|ref|YP_001773204.1| flagellar biosynthesis protein FliQ [Methylobacterium sp. 4-46]
 gi|168198823|gb|ACA20770.1| export protein FliQ family 3 [Methylobacterium sp. 4-46]
          Length = 88

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 60/87 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D LE+ RAA+WTIL  + P + +AM +GI +A LQALTQIQEVTLTFVPKI+ + +
Sbjct: 1  MNEVDALELVRAAIWTILIGAGPAVAAAMAVGIAVALLQALTQIQEVTLTFVPKIVVILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++++  F+G Q+  F      RI S 
Sbjct: 61 VMLMTGSFVGTQLYMFTENAYGRITSG 87


>gi|218133680|ref|ZP_03462484.1| hypothetical protein BACPEC_01549 [Bacteroides pectinophilus ATCC
          43243]
 gi|217991055|gb|EEC57061.1| hypothetical protein BACPEC_01549 [Bacteroides pectinophilus ATCC
          43243]
          Length = 93

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 56/78 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E D++ IAR  +W I+ +S PVL  +M +G++I+ +Q +T IQE TLTFVPK++++FI
Sbjct: 5  MTEQDIITIARQTIWIIVQTSMPVLVISMIVGLVISLIQTITSIQEQTLTFVPKMLSIFI 64

Query: 61 TLIISAPFIGGQISSFVT 78
          TL+I   ++  +I  F+T
Sbjct: 65 TLMILGSWMINRIVEFIT 82


>gi|148256777|ref|YP_001241362.1| flagellar biosynthesis protein FliQ [Bradyrhizobium sp. BTAi1]
 gi|146408950|gb|ABQ37456.1| Flagellar biosynthetic protein fliQ [Bradyrhizobium sp. BTAi1]
          Length = 87

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 61/84 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L++AR A+WTI+  S+P++   + +G++++  QALTQIQE TL FVPKIIA+F+
Sbjct: 1  MTGAETLDVARDAIWTIVLVSSPLMVVGLVVGVVVSLFQALTQIQEQTLVFVPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+   + S +  + SRI
Sbjct: 61 TLLLALPFMADALHSHMMRISSRI 84


>gi|300024582|ref|YP_003757193.1| flagellar biosynthetic protein FliQ [Hyphomicrobium denitrificans
          ATCC 51888]
 gi|299526403|gb|ADJ24872.1| flagellar biosynthetic protein FliQ [Hyphomicrobium denitrificans
          ATCC 51888]
          Length = 89

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 56/87 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E D L I + A+W  +  + PV+ SAM +G+ +AF QALTQ+QE+TLTFVPKIIA F+
Sbjct: 1  MTEGDALGIVQQAIWLTIILAGPVIASAMIIGVSVAFFQALTQVQEMTLTFVPKIIAGFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           ++++  + G  +  F   +  RI + 
Sbjct: 61 IILMTGSYSGSLLKVFTEQLYLRIATG 87


>gi|115523573|ref|YP_780484.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisA53]
 gi|115517520|gb|ABJ05504.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          BisA53]
          Length = 87

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 61/84 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL+IAR A+WTI+  SAP++   + +G+ ++ +QALTQIQE TL FVPKI+++F+
Sbjct: 1  MTGMEVLDIARDAVWTIVLVSAPLMVVGLVVGVAVSLVQALTQIQEQTLVFVPKILSIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T +++ PF+   + S++  + SRI
Sbjct: 61 TFVLALPFMADAMHSYMMRISSRI 84


>gi|90423031|ref|YP_531401.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisB18]
 gi|90105045|gb|ABD87082.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          BisB18]
          Length = 87

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 60/84 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   + L++AR A+WTI+  S+P++   + +G+ ++ +QALTQIQE TL FVPKIIA+F+
Sbjct: 1  MTGMETLDVARDAIWTIVIVSSPLMVVGLVVGVAVSLVQALTQIQEQTLVFVPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TLI++ PF+   + S +  + SRI
Sbjct: 61 TLILALPFMADAMHSHMMRISSRI 84


>gi|86750883|ref|YP_487379.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          HaA2]
 gi|86573911|gb|ABD08468.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          HaA2]
          Length = 87

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 62/84 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L+IAR A+WTI+  SAP++   + +G+ ++ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGAETLDIAREAVWTIVIVSAPLMVVGLVVGVAVSLVQALTQIQEQTLVFVPKILAMFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+  ++ + +  + SRI
Sbjct: 61 TLVLTLPFMADRLHAEMLRISSRI 84


>gi|329888175|ref|ZP_08266773.1| flagellar biosynthetic protein FliQ [Brevundimonas diminuta ATCC
          11568]
 gi|328846731|gb|EGF96293.1| flagellar biosynthetic protein FliQ [Brevundimonas diminuta ATCC
          11568]
          Length = 87

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A+VL++ R A+W  +    P L  A+ +G+ I   QALTQIQE TL + PKIIA+F+
Sbjct: 1  MSGAEVLDVGRDALWLTIQLCLPALIVALVVGVAIGLFQALTQIQEQTLVYAPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L++  P +G  +  F+  + +RI
Sbjct: 61 SLLLFLPLMGALLGGFMREIAARI 84


>gi|220925378|ref|YP_002500680.1| flagellar biosynthetic protein FliQ [Methylobacterium nodulans
          ORS 2060]
 gi|219949985|gb|ACL60377.1| flagellar biosynthetic protein FliQ [Methylobacterium nodulans
          ORS 2060]
          Length = 88

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 57/87 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L+IAR  + T L    P++  A+ +G+ ++ LQALTQIQE TL +VPKI+AVF 
Sbjct: 1  MTGLAILDIARDGIVTFLKVGGPLMVVALIVGLAVSLLQALTQIQEQTLIYVPKIVAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           +++  PF+G  ++ ++T + +RI + 
Sbjct: 61 AMLLMLPFMGDAMAGYMTRIAARIAAG 87


>gi|240145487|ref|ZP_04744088.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          L1-82]
 gi|257202302|gb|EEV00587.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          L1-82]
 gi|291536020|emb|CBL09132.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          M50/1]
 gi|291538512|emb|CBL11623.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          XB6B4]
          Length = 89

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 58/83 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  VL++A+ A++TI+  SAP+L  ++ +G++++  Q +T IQE TLTFVPKIIAVF+
Sbjct: 1  MTEGQVLDVAKEAIYTIIICSAPMLIISLVVGLIVSIFQTVTSIQEQTLTFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           L+I   +I   ++ FVT + S 
Sbjct: 61 GLMIFGSWILTNLTEFVTTLWSN 83


>gi|146341892|ref|YP_001206940.1| flagellar biosynthesis protein FliQ [Bradyrhizobium sp. ORS278]
 gi|146194698|emb|CAL78723.1| Flagellar biosynthetic protein fliQ [Bradyrhizobium sp. ORS278]
          Length = 87

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 59/84 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L++AR A+WTI+  S+P++   + +G++++  QALTQIQE TL FVPKIIA+F+
Sbjct: 1  MTGAETLDVARDAIWTIVIVSSPLMVVGLVVGVVVSLFQALTQIQEQTLVFVPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++  PF+   +   +  + SRI
Sbjct: 61 TLLLGLPFMADALHQHMMRISSRI 84


>gi|39936946|ref|NP_949222.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          CGA009]
 gi|192292774|ref|YP_001993379.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          TIE-1]
 gi|39650803|emb|CAE29326.1| putative flagellar biosynthesis protein fliQ [Rhodopseudomonas
          palustris CGA009]
 gi|192286523|gb|ACF02904.1| export protein FliQ family 3 [Rhodopseudomonas palustris TIE-1]
          Length = 87

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   + L++AR A+WTI+  SAP++   + +G+ ++ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGPETLDVARDAIWTIVVVSAPLMVVGLVVGVAVSLVQALTQIQEQTLVFVPKILAMFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+   + S +  + SRI
Sbjct: 61 TLVLALPFMADALHSQMMRISSRI 84


>gi|229918643|ref|YP_002887289.1| flagellar biosynthetic protein FliQ [Exiguobacterium sp. AT1b]
 gi|229470072|gb|ACQ71844.1| flagellar biosynthetic protein FliQ [Exiguobacterium sp. AT1b]
          Length = 90

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +A  ++WT+L  S P+L  ++ +G++I+ LQA TQIQE TL+FVPKII+VFI
Sbjct: 1  MTQEMVIYLATESVWTLLKISMPLLLISLIVGLVISILQATTQIQEQTLSFVPKIISVFI 60

Query: 61 TLIISAPFIGGQISSFVTLV 80
           L+I  P++  QI  F  L+
Sbjct: 61 GLVIFGPWMLQQIEGFTRLI 80


>gi|145301464|ref|YP_001144303.1| AscS protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|38201230|emb|CAD56765.1| ascS protein [Aeromonas salmonicida subsp. salmonicida]
 gi|66947957|emb|CAE83094.1| AscS protein [Aeromonas salmonicida subsp. salmonicida]
 gi|142856346|gb|ABO92555.1| AscS protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 88

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L     A+W +L  S P +  A  +G L++ LQALTQIQE TL FV K+IAV I
Sbjct: 1  MSHADILHFTSQALWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLIAVVI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +  ++G ++ SF  +VL ++
Sbjct: 61 TLFATTAWLGNELYSFANMVLFKV 84


>gi|144900466|emb|CAM77330.1| Bacterial export protein FliQ, family 3 [Magnetospirillum
          gryphiswaldense MSR-1]
          Length = 89

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 61/84 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M EA++++IAR  + T++  +AP L + + +G++I+ LQ +TQIQE+TLTFVPK++ VF 
Sbjct: 1  MTEAELIDIARDGISTLIFVAAPPLLTGLAVGLVISILQTITQIQEMTLTFVPKVLLVFG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          ++I+  PF+ G ++ F   +L R+
Sbjct: 61 SIILFLPFMLGLLTDFWKAMLDRV 84


>gi|83309716|ref|YP_419980.1| flagellar biosynthesis pathway [Magnetospirillum magneticum
          AMB-1]
 gi|82944557|dbj|BAE49421.1| Flagellar biosynthesis pathway [Magnetospirillum magneticum
          AMB-1]
          Length = 89

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E ++++IAR  +  +L  +AP L + + +G++I+  Q LTQIQE TLTFVPK++ VF 
Sbjct: 1  MTEPELIDIARETIMVMLKVAAPTLLTGLVVGLVISIFQTLTQIQEQTLTFVPKMLLVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          ++I+  PF+   ++ F  LV+ R+
Sbjct: 61 SMILFLPFMLHSLTEFWRLVMDRV 84


>gi|145284337|gb|ABP51918.1| AscS [Aeromonas veronii bv. sobria]
          Length = 88

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L     A+W +L  S P +  A  +G L++ LQALTQIQE TL FV K+IAV I
Sbjct: 1  MSHADILHFTSQALWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLIAVVI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +  ++G ++ SF  +VL ++
Sbjct: 61 TLFATTAWLGNELYSFADMVLFKV 84


>gi|170748650|ref|YP_001754910.1| flagellar biosynthetic protein FliQ [Methylobacterium
          radiotolerans JCM 2831]
 gi|170655172|gb|ACB24227.1| flagellar biosynthetic protein FliQ [Methylobacterium
          radiotolerans JCM 2831]
          Length = 88

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 58/87 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L+IAR  ++  L  + P++  A+ +G+ ++ +QALTQIQE TL +VPK++AVF 
Sbjct: 1  MTGLAILDIARDGIFVFLKVAGPLMLVALAVGLAVSLVQALTQIQEQTLIYVPKVVAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L++  PF+G  ++ ++T + +RI + 
Sbjct: 61 ALLLMLPFMGDAMAGYMTRIAARIAAG 87


>gi|316932836|ref|YP_004107818.1| export protein FliQ family 3 [Rhodopseudomonas palustris DX-1]
 gi|315600550|gb|ADU43085.1| export protein FliQ family 3 [Rhodopseudomonas palustris DX-1]
          Length = 87

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   + L++AR A+WTI+  SAP++   + +G+ ++ +QALTQIQE TL FVPKI+A+FI
Sbjct: 1  MTGPETLDVARDAIWTIVVVSAPLMVVGLVVGVAVSLVQALTQIQEQTLVFVPKILAMFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+++ PF+   + + +  + SRI
Sbjct: 61 TLVLALPFMADALHAQMLRISSRI 84


>gi|23016625|ref|ZP_00056379.1| COG1987: Flagellar biosynthesis pathway, component FliQ
          [Magnetospirillum magnetotacticum MS-1]
          Length = 89

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E +++++AR  +  +L  +AP L + + +G++I+  Q LTQIQE TLTFVPK++ VF 
Sbjct: 1  MTEPELIDVARETIMVMLKVAAPTLLTGLVVGLIISIFQTLTQIQEQTLTFVPKMLLVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          ++I+  PF+   ++ F  LV+ R+
Sbjct: 61 SMILFLPFMLHSLTEFWRLVMDRV 84


>gi|170743256|ref|YP_001771911.1| flagellar biosynthetic protein FliQ [Methylobacterium sp. 4-46]
 gi|168197530|gb|ACA19477.1| flagellar biosynthetic protein FliQ [Methylobacterium sp. 4-46]
          Length = 88

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 57/87 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L+IAR  + T L  + P++  A+ +G+ ++ LQALTQIQE TL +VPKI+AVF 
Sbjct: 1  MTGLAILDIARDGIVTFLKVAGPLMMIALVVGLAVSLLQALTQIQEQTLIYVPKIVAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           +++  PF+G  ++ ++  + +RI + 
Sbjct: 61 AMLLMLPFMGDALAGYMGRIAARIAAG 87


>gi|114777579|ref|ZP_01452560.1| flagellar biosynthetic protein FliQ [Mariprofundus ferrooxydans
          PV-1]
 gi|114552050|gb|EAU54567.1| flagellar biosynthetic protein FliQ [Mariprofundus ferrooxydans
          PV-1]
          Length = 89

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I   A+  +L  S P+L  A+ +GI I+  QA+TQIQE+TLTFVPKIIAVF+
Sbjct: 1  MTPDSVIQIGSEALKVVLMISLPMLGVALVVGIAISLFQAVTQIQEMTLTFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +I++AP++  Q+ SF   + S I +
Sbjct: 61 AMILAAPWMSDQMISFTRELFSMIPT 86


>gi|46398251|gb|AAS91805.1| AscS [Aeromonas hydrophila]
          Length = 88

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L      +W +L  S P +  A  +G L++ LQALTQIQE TL FV K+IAV I
Sbjct: 1  MSHADILHFTSQTLWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLIAVVI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +  ++G ++ SF  +VL ++
Sbjct: 61 TLFATTAWLGNELYSFADMVLYKV 84


>gi|83594155|ref|YP_427907.1| flagellar biosynthesis protein FliQ [Rhodospirillum rubrum ATCC
          11170]
 gi|83577069|gb|ABC23620.1| Flagellar biosynthesis protein FliQ [Rhodospirillum rubrum ATCC
          11170]
          Length = 84

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 53/72 (73%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          ++++AR A+ T+L  SAP L + M +G++IA  Q LTQIQE+TL FVPKI+ VF +L+++
Sbjct: 2  IMDVARDAILTMLIISAPPLLAGMVIGLIIALFQTLTQIQEMTLVFVPKIVVVFASLLLT 61

Query: 66 APFIGGQISSFV 77
           P++  Q S F+
Sbjct: 62 LPWMVRQASEFM 73


>gi|10955565|ref|NP_052406.1| YscS [Yersinia enterocolitica]
 gi|16082733|ref|NP_395179.1| needle complex export protein [Yersinia pestis CO92]
 gi|28372986|ref|NP_783680.1| YscS [Yersinia enterocolitica]
 gi|31795276|ref|NP_857737.1| needle complex export protein [Yersinia pestis KIM]
 gi|31795478|ref|NP_857932.1| needle complex export protein [Yersinia pestis KIM]
 gi|32470293|ref|NP_863528.1| YscS [Yersinia enterocolitica]
 gi|45478539|ref|NP_995366.1| type III secretion protein yscS YscS [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51593914|ref|YP_068481.1| yscS; putative type III secretion protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|108793659|ref|YP_636809.1| type III secretion protein [Yersinia pestis Antiqua]
 gi|122815817|ref|YP_001004083.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|145597137|ref|YP_001154601.1| type III secretion protein [Yersinia pestis Pestoides F]
 gi|149192694|ref|YP_001293926.1| putative type III secretion protein [Yersinia pestis CA88-4125]
 gi|162417747|ref|YP_001604477.1| type III secretion apparatus protein YscS [Yersinia pestis
          Angola]
 gi|165927783|ref|ZP_02223615.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165940088|ref|ZP_02228622.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166011708|ref|ZP_02232606.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166214448|ref|ZP_02240483.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167401906|ref|ZP_02307392.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167422415|ref|ZP_02314168.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167422450|ref|ZP_02314203.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167422878|ref|ZP_02314631.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167426849|ref|ZP_02318602.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|186897579|ref|YP_001874690.1| HrpO family type III secretion protein [Yersinia
          pseudotuberculosis PB1/+]
 gi|229896861|ref|ZP_04512021.1| putative type III secretion protein [Yersinia pestis Pestoides A]
 gi|229900216|ref|ZP_04515352.1| putative type III secretion protein [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|270491104|ref|ZP_06208176.1| type III secretion protein, HrpO family [Yersinia pestis KIM D27]
 gi|332163587|ref|YP_004424929.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|57015236|sp|P69982|YSCS_YERPE RecName: Full=Yop proteins translocation protein S
 gi|57015237|sp|P69983|YSCS_YERPS RecName: Full=Yop proteins translocation protein S
 gi|14579351|gb|AAK69228.1|AF336309_23 YscS [Yersinia enterocolitica]
 gi|475124|gb|AAA27679.1| yscS [Yersinia pseudotuberculosis]
 gi|2996236|gb|AAC62559.1| Yop proteins translocation protein S homolog [Yersinia pestis KIM
          10]
 gi|3822066|gb|AAC69786.1| type III secretion protein [Yersinia pestis KIM 10]
 gi|4324352|gb|AAD16829.1| YscS [Yersinia enterocolitica W22703]
 gi|5832465|emb|CAB54922.1| putative type III secretion protein [Yersinia pestis CO92]
 gi|23630558|gb|AAN37514.1| YscS [Yersinia enterocolitica]
 gi|45357161|gb|AAS58557.1| type III secretion protein yscS YscS [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51591611|emb|CAF25415.1| yscS; putative type III secretion protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|108782206|gb|ABG16261.1| type III secretion protein [Yersinia pestis Antiqua]
 gi|121663691|emb|CAL10053.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|145212905|gb|ABP42311.1| type III secretion protein [Yersinia pestis Pestoides F]
 gi|148872352|gb|ABR14842.1| putative type III secretion protein [Yersinia pestis CA88-4125]
 gi|162354767|gb|ABX88714.1| type III secretion apparatus protein YscS [Yersinia pestis
          Angola]
 gi|165911998|gb|EDR30641.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165920219|gb|EDR37520.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165989315|gb|EDR41616.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166204341|gb|EDR48821.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166958168|gb|EDR55189.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|166958652|gb|EDR55673.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|166958687|gb|EDR55708.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167048634|gb|EDR60042.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167054148|gb|EDR63975.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|186700605|gb|ACC91233.1| type III secretion protein, HrpO family [Yersinia
          pseudotuberculosis PB1/+]
 gi|229686736|gb|EEO78816.1| putative type III secretion protein [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229700132|gb|EEO88171.1| putative type III secretion protein [Yersinia pestis Pestoides A]
 gi|270334847|gb|EFA45626.1| type III secretion protein, HrpO family [Yersinia pestis KIM D27]
 gi|310923236|emb|CBW54702.1| YscS, T3SS component [Yersinia enterocolitica (type O:8)]
 gi|317374479|gb|ADV16654.1| type III secretion inner membrane protein [Yersinia pestis]
 gi|318608196|emb|CBY78170.1| type III secretion inner membrane protein (YscS,homologous to
          flagellar export components) [Yersinia enterocolitica
          subsp. palearctica Y11]
 gi|325667817|gb|ADZ44460.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
          Length = 88

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++ D++     A+W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV +
Sbjct: 1  MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL  +A ++G ++ SF  + + +IQ 
Sbjct: 61 TLFATASWLGNELHSFAEMTMMKIQG 86


>gi|284989539|ref|YP_003408093.1| export protein FliQ family 3 [Geodermatophilus obscurus DSM
          43160]
 gi|284062784|gb|ADB73722.1| export protein FliQ family 3 [Geodermatophilus obscurus DSM
          43160]
          Length = 91

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 53/76 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++ADV EIA A M      +APVL +A+ +G LI+  QA TQIQE TL+FVPK+IAV I
Sbjct: 1  MSDADVTEIAVATMLVAAKVAAPVLLTALLVGFLISLFQAATQIQEPTLSFVPKVIAVAI 60

Query: 61 TLIISAPFIGGQISSF 76
           L+++  ++  ++ +F
Sbjct: 61 ALLVTGNWVLSELVTF 76


>gi|39545584|gb|AAR27891.1| AscS [Aeromonas hydrophila]
          Length = 105

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 53/84 (63%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           M+ AD+L      +W +L  S P +  A  +G L++ LQALTQIQE TL FV K+IAV I
Sbjct: 18  MSHADILHFTSQTLWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLIAVVI 77

Query: 61  TLIISAPFIGGQISSFVTLVLSRI 84
           TL  +  ++G ++ SF  +VL ++
Sbjct: 78  TLFATTAWLGNELYSFADMVLFKV 101


>gi|209964221|ref|YP_002297136.1| flagellar biosynthesis protein FliQ [Rhodospirillum centenum SW]
 gi|209957687|gb|ACI98323.1| flagellar biosynthesis protein FliQ [Rhodospirillum centenum SW]
          Length = 91

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +ADV+ I R A+  ++    P++   + +G++I+  QALTQIQE T+TFVPKI+ +F 
Sbjct: 1  MTDADVIAIGREALLVVVIVGGPLMLIGLVVGLVISLFQALTQIQEQTITFVPKIVIMFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   PF+ G + SF+  +  +I
Sbjct: 61 AMVFLMPFMLGHLRSFMEGIADKI 84


>gi|54124951|gb|AAV30219.1| AscS [Aeromonas hydrophila]
          Length = 105

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 53/84 (63%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           M+ AD+L      +W +L  S P +  A  +G L++ LQALTQIQE TL FV K++AV I
Sbjct: 18  MSHADILHFTSQTLWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLVAVVI 77

Query: 61  TLIISAPFIGGQISSFVTLVLSRI 84
           TL  +  ++G ++ SF  +VL ++
Sbjct: 78  TLFATTAWLGNELYSFADMVLLKV 101


>gi|295690543|ref|YP_003594236.1| flagellar biosynthetic protein FliQ [Caulobacter segnis ATCC
          21756]
 gi|295432446|gb|ADG11618.1| flagellar biosynthetic protein FliQ [Caulobacter segnis ATCC
          21756]
          Length = 87

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL++ R A+W  L   APVL   + +G+ I   QALTQIQE TL + PKI+A+F+
Sbjct: 1  MTGAEVLDVGRDAIWLTLKLCAPVLIVGLVVGVAIGLFQALTQIQEQTLVYAPKIVAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L+I  P +G  +S+F+  + +RI
Sbjct: 61 SLLIFLPMMGALMSAFMRQIAARI 84


>gi|260438789|ref|ZP_05792605.1| flagellar biosynthetic protein FliQ [Butyrivibrio crossotus DSM
          2876]
 gi|292808778|gb|EFF67983.1| flagellar biosynthetic protein FliQ [Butyrivibrio crossotus DSM
          2876]
          Length = 91

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 58/83 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  +++I+R A++ I+  SAP+L  ++ +G++I+  Q +T IQE TLTFVPKIIAVFI
Sbjct: 1  MSEQQIIDISRKALYLIIQCSAPILIISLVVGLVISIFQTMTSIQEQTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           +++   ++   I+S++  + S 
Sbjct: 61 GVMLFGSWMLNNITSYMNELWSN 83


>gi|238916765|ref|YP_002930282.1| hypothetical protein EUBELI_00827 [Eubacterium eligens ATCC
          27750]
 gi|238872125|gb|ACR71835.1| Hypothetical protein EUBELI_00827 [Eubacterium eligens ATCC
          27750]
          Length = 88

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 54/80 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ IAR  +W I+ +S P+L  +M +G++I+  Q LT IQE TLTFVPK++A+ I
Sbjct: 1  MDAGQVVTIARQTIWVIVKTSVPLLLVSMIVGLIISLFQTLTSIQEQTLTFVPKLLAIMI 60

Query: 61 TLIISAPFIGGQISSFVTLV 80
           L++   +I  +I SF+ ++
Sbjct: 61 ALMLMGNWILNEIVSFMQML 80


>gi|114765221|ref|ZP_01444353.1| flagellar biosynthesis protein Q [Pelagibaca bermudensis
          HTCC2601]
 gi|114542356|gb|EAU45384.1| flagellar biosynthesis protein Q [Roseovarius sp. HTCC2601]
          Length = 89

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E+D   I   A   +L  S P++  A+ +G++IAF QALTQ+QE+TLTFVPKI+A+FI
Sbjct: 1  MTESDTYTILSDAFLAVLYGSGPIMAIALVVGLIIAFFQALTQVQEMTLTFVPKIVAIFI 60

Query: 61 TLIISAP 67
           L+   P
Sbjct: 61 GLLAFTP 67


>gi|253988528|ref|YP_003039884.1| type III secretion component protein scts [Photorhabdus
          asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211637890|emb|CAR66519.1| type iii secretion component protein scts [Photorhabdus
          asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779978|emb|CAQ83139.1| type iii secretion component protein scts [Photorhabdus
          asymbiotica]
          Length = 88

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L     ++W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV I
Sbjct: 1  MSNADILHFTSQSLWLVLILSLPPVLMAAVVGTLVSLIQALTQIQEQTLGFVIKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +A ++G ++ SF  +  S++
Sbjct: 61 TLFATATWLGNELYSFANMAFSKV 84


>gi|118443073|ref|YP_877990.1| flagellar biosynthetic protein FliQ [Clostridium novyi NT]
 gi|118133529|gb|ABK60573.1| flagellar biosynthetic protein FliQ [Clostridium novyi NT]
          Length = 89

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 53/76 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + AM+T + +SAP+L +++ +G+LI+  QA TQIQE TLTFVPK+I V I
Sbjct: 1  MSEEMVIGILKDAMYTGIIASAPILIASIAIGLLISIFQATTQIQEQTLTFVPKLIGVAI 60

Query: 61 TLIISAPFIGGQISSF 76
            +I+A FI   +  F
Sbjct: 61 VGLITAKFINHTVVGF 76


>gi|296531767|ref|ZP_06894589.1| flagellar biosynthesis protein FliQ [Roseomonas cervicalis ATCC
          49957]
 gi|296267906|gb|EFH13711.1| flagellar biosynthesis protein FliQ [Roseomonas cervicalis ATCC
          49957]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 45/68 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E DV+EI R   +  +  + P L +A+  G+ ++ LQALTQIQE+TL++VPKI+   +
Sbjct: 1  MQEGDVIEILRGGFYATMMVAGPPLLAALITGVAVSVLQALTQIQEMTLSYVPKIVVTLV 60

Query: 61 TLIISAPF 68
            ++S PF
Sbjct: 61 ATMLSLPF 68


>gi|168186133|ref|ZP_02620768.1| flagellar biosynthetic protein FliQ [Clostridium botulinum C str.
          Eklund]
 gi|169295660|gb|EDS77793.1| flagellar biosynthetic protein FliQ [Clostridium botulinum C str.
          Eklund]
          Length = 89

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 52/76 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + AM+T + +SAP+L  ++ +G+LI+  QA TQIQE TLTFVPK+I V I
Sbjct: 1  MSEEMVIGILKDAMYTGIMASAPILIVSIVIGLLISIFQATTQIQEQTLTFVPKLIGVAI 60

Query: 61 TLIISAPFIGGQISSF 76
            +I+A FI   +  F
Sbjct: 61 VGLITAKFINHTVVGF 76


>gi|16125327|ref|NP_419891.1| flagellar biosynthesis protein FliQ [Caulobacter crescentus CB15]
 gi|3023776|sp|Q45974|FLIQ_CAUCR RecName: Full=Flagellar biosynthetic protein FliQ
 gi|535423|gb|AAA66206.1| FliQ [Caulobacter crescentus CB15]
 gi|13422377|gb|AAK23059.1| flagellar biosynthesis protein FliQ [Caulobacter crescentus CB15]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL++ R A+W  L   APVL   + +G++I   QALTQIQE TL + PKI+A+FI
Sbjct: 1  MTGAEVLDVGRDAIWLTLQLCAPVLIVGLVVGVIIGLFQALTQIQEATLVYAPKIVAIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L+I  P +G  +S F+  + +RI
Sbjct: 61 SLLIFLPLMGSLMSGFMRQIAARI 84


>gi|221234066|ref|YP_002516502.1| flagellar biosynthesis protein FliQ [Caulobacter crescentus
          NA1000]
 gi|220963238|gb|ACL94594.1| flagellar biosynthesis protein FliQ [Caulobacter crescentus
          NA1000]
          Length = 88

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL++ R A+W  L   APVL   + +G++I   QALTQIQE TL + PKI+A+FI
Sbjct: 2  MTGAEVLDVGRDAIWLTLQLCAPVLIVGLVVGVIIGLFQALTQIQEATLVYAPKIVAIFI 61

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L+I  P +G  +S F+  + +RI
Sbjct: 62 SLLIFLPLMGSLMSGFMRQIAARI 85


>gi|27380922|ref|NP_772451.1| flagellar biosynthesis protein FliQ [Bradyrhizobium japonicum
          USDA 110]
 gi|27354088|dbj|BAC51076.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA
          110]
          Length = 87

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 59/84 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   + L++AR A+WTI+  S+P++   + +G++++  QALTQIQE TL +VPKI+A+F 
Sbjct: 1  MTGPETLDVARDAIWTIVIVSSPLMVVGLVVGVIVSLFQALTQIQEQTLIYVPKILAIFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T++++ PF+   + + +  + SRI
Sbjct: 61 TMLLALPFMADSLHAHMLRISSRI 84


>gi|256376456|ref|YP_003100116.1| export protein FliQ family 3 [Actinosynnema mirum DSM 43827]
 gi|255920759|gb|ACU36270.1| export protein FliQ family 3 [Actinosynnema mirum DSM 43827]
          Length = 90

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  V+E+   AM      +APVL +A+ +G  I+  Q++TQIQEVTL+FVPK   V +
Sbjct: 1  MNDTTVVELGSNAMMITAKLAAPVLLTALLIGFTISLFQSVTQIQEVTLSFVPKAAGVCV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L++S  ++  +I +F T +  RI S
Sbjct: 61 ALLLSGSWMVHEIITFTTDLFGRIPS 86


>gi|323703182|ref|ZP_08114835.1| flagellar biosynthetic protein FliQ [Desulfotomaculum nigrificans
          DSM 574]
 gi|323531841|gb|EGB21727.1| flagellar biosynthetic protein FliQ [Desulfotomaculum nigrificans
          DSM 574]
          Length = 89

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  V+ +AR A+  ++  S P L  AM +G++I+ LQA TQIQE TL+FVPK++AVF+
Sbjct: 1  MTETFVIHVAREALMMVVILSLPALGVAMLVGLIISILQATTQIQEQTLSFVPKMVAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+I+A ++     +F T +  +I
Sbjct: 61 TLLIAASWLLNIAVNFTTRLYQQI 84


>gi|288553048|ref|YP_003424983.1| flagellar biosynthesis protein FliQ [Bacillus pseudofirmus OF4]
 gi|288544208|gb|ADC48091.1| flagellar biosynthesis protein FliQ [Bacillus pseudofirmus OF4]
          Length = 89

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 54/85 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A   +WT+L  + P+L  A+ LG+L++  QA TQIQE TL F+PKI+ V  
Sbjct: 1  MSSEFVISMAENGVWTVLIVAGPLLIVALGLGLLVSIFQATTQIQEQTLAFIPKIVGVLA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          +L+I  P++  Q+++F   + S + 
Sbjct: 61 SLVIFGPWMLSQVTNFAYQIFSNLH 85


>gi|188581882|ref|YP_001925327.1| flagellar biosynthetic protein FliQ [Methylobacterium populi
          BJ001]
 gi|179345380|gb|ACB80792.1| flagellar biosynthetic protein FliQ [Methylobacterium populi
          BJ001]
          Length = 88

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 52/76 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L+IAR  ++  L  + P++  A+ +G++++  QALTQIQE TL +VPKI+AVF 
Sbjct: 1  MTGLAILDIARDGIFVFLKVAGPLMIVALVVGLIVSLFQALTQIQEQTLIYVPKIVAVFG 60

Query: 61 TLIISAPFIGGQISSF 76
           +++  PFIG  ++++
Sbjct: 61 VMLLMLPFIGDAMAAY 76


>gi|302384126|ref|YP_003819949.1| flagellar biosynthetic protein FliQ [Brevundimonas subvibrioides
          ATCC 15264]
 gi|302194754|gb|ADL02326.1| flagellar biosynthetic protein FliQ [Brevundimonas subvibrioides
          ATCC 15264]
          Length = 87

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A+VL++ R A+W  +   APVL   + +G+ I   QALTQIQE TL + PKIIA+F+
Sbjct: 1  MSGAEVLDVGRDAIWLTVQLCAPVLIVGLVVGVGIGLFQALTQIQEQTLVYAPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L++  P +GG + +F+  + +RI
Sbjct: 61 SLLLFLPLMGGLLGAFMRTIAARI 84


>gi|238924153|ref|YP_002937669.1| hypothetical protein EUBREC_1791 [Eubacterium rectale ATCC 33656]
 gi|238875828|gb|ACR75535.1| hypothetical protein EUBREC_1791 [Eubacterium rectale ATCC 33656]
 gi|291524886|emb|CBK90473.1| flagellar biosynthetic protein FliQ [Eubacterium rectale DSM
          17629]
          Length = 92

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 58/82 (70%)

Query: 2  NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
           +  VL+IAR A++T + +SAP+L  ++ +G++++  Q +T IQE TLTFVPKIIA+F+ 
Sbjct: 3  TQEAVLDIAREAIYTTIITSAPLLLISLIVGLIVSIFQTVTSIQEQTLTFVPKIIAIFLV 62

Query: 62 LIISAPFIGGQISSFVTLVLSR 83
          +++   ++   +S F+T + S+
Sbjct: 63 MMLCGSWMLDTMSGFMTDLWSK 84


>gi|163802010|ref|ZP_02195906.1| translocation protein in type III secretion [Vibrio sp. AND4]
 gi|159174151|gb|EDP58959.1| translocation protein in type III secretion [Vibrio sp. AND4]
          Length = 88

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+++     A+  +L  S P +  A  +G L++ +QALTQ+QE TL FV K+IAV I
Sbjct: 1  MNPAEIIHFTTQALTLVLFLSLPPILVAALVGTLVSLIQALTQVQEQTLGFVVKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G ++ SF TL L +I
Sbjct: 61 TLFVTTQWLGAELHSFATLTLDKI 84


>gi|163852025|ref|YP_001640068.1| flagellar biosynthetic protein FliQ [Methylobacterium extorquens
          PA1]
 gi|218530779|ref|YP_002421595.1| flagellar biosynthetic protein FliQ [Methylobacterium
          chloromethanicum CM4]
 gi|240139292|ref|YP_002963767.1| flagellar biosynthesis [Methylobacterium extorquens AM1]
 gi|254561748|ref|YP_003068843.1| flagellar biosynthesis [Methylobacterium extorquens DM4]
 gi|163663630|gb|ABY30997.1| flagellar biosynthetic protein FliQ [Methylobacterium extorquens
          PA1]
 gi|218523082|gb|ACK83667.1| flagellar biosynthetic protein FliQ [Methylobacterium
          chloromethanicum CM4]
 gi|240009264|gb|ACS40490.1| flagellar biosynthesis [Methylobacterium extorquens AM1]
 gi|254269026|emb|CAX24987.1| flagellar biosynthesis [Methylobacterium extorquens DM4]
          Length = 88

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 52/76 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L+IAR  ++  L  + P++  A+ +G++++  QALTQIQE TL +VPKI+AVF 
Sbjct: 1  MTGLAILDIARDGIFVFLKVAGPMMIVALVVGLIVSLFQALTQIQEQTLIYVPKIVAVFG 60

Query: 61 TLIISAPFIGGQISSF 76
           +++  PFIG  ++++
Sbjct: 61 VMLLMLPFIGDAMAAY 76


>gi|220932508|ref|YP_002509416.1| flagellar biosynthetic protein FliQ [Halothermothrix orenii H
          168]
 gi|219993818|gb|ACL70421.1| flagellar biosynthetic protein FliQ [Halothermothrix orenii H
          168]
          Length = 89

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++A V++I R A++ +L   APV+   +  G+L+A  QA TQIQE TL FVPKI+AV I
Sbjct: 1  MDKALVIDIGRNALFVVLKIIAPVIGFGLITGLLVAIFQATTQIQEQTLAFVPKILAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++ I  P++   I  FVT +   I + +
Sbjct: 61 SIAIFGPWMLSTIVDFVTSLFQHIPTYI 88


>gi|51246524|ref|YP_066408.1| flagellar biosynthetic protein (FliQ) [Desulfotalea psychrophila
          LSv54]
 gi|50877561|emb|CAG37401.1| probable flagellar biosynthetic protein (FliQ) [Desulfotalea
          psychrophila LSv54]
          Length = 88

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          + + R A+ TIL  +AP+L + M +G+ ++  QA TQI E TLTF+PKIIAVF+T+++  
Sbjct: 8  VNVCRKAIQTILMCAAPMLLAGMIVGLFVSIFQAATQINEQTLTFIPKIIAVFVTMLLFG 67

Query: 67 PFIGGQISSFVTLVLSRIQS 86
          P+I   + +F + V + I S
Sbjct: 68 PWIIKLLLTFTSGVFTTIAS 87


>gi|85059284|ref|YP_454986.1| putative type III secretion apparatus [Sodalis glossinidius str.
          'morsitans']
 gi|84779804|dbj|BAE74581.1| putative type III secretion apparatus [Sodalis glossinidius str.
          'morsitans']
          Length = 89

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+A +  +    MW +L +S PV+  A  +GIL++  QALTQIQ+ TL F+ K++AV I
Sbjct: 1  MNDAALTHLVTQLMWIVLITSLPVVLVASAVGILVSLFQALTQIQDQTLQFMIKLLAVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+ S P++GG +  +   VL +I
Sbjct: 61 TLMASYPWLGGILLGYTRQVLLQI 84


>gi|153832452|ref|ZP_01985119.1| VscS [Vibrio harveyi HY01]
 gi|148871247|gb|EDL70119.1| VscS [Vibrio harveyi HY01]
          Length = 88

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+++     A+  +L  S P +  A  +G L++ +QALTQ+QE TL FV K+IAV I
Sbjct: 1  MNPAEIIHFTTQALTLVLFLSLPPILVAALVGTLVSLVQALTQVQEQTLGFVVKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G ++ SF TL L +I
Sbjct: 61 TLFVTTQWLGAELHSFATLTLDKI 84


>gi|2465660|gb|AAB72202.1| YscS [Yersinia pestis]
          Length = 79

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 51/77 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++ D++     A+W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV +
Sbjct: 1  MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV 60

Query: 61 TLIISAPFIGGQISSFV 77
          TL  +A ++G ++ SFV
Sbjct: 61 TLFATASWLGNELHSFV 77


>gi|156974014|ref|YP_001444921.1| Type III secretory pathway, component EscS [Vibrio harveyi ATCC
          BAA-1116]
 gi|41834185|gb|AAS13323.1| VscS [Vibrio harveyi]
 gi|156525608|gb|ABU70694.1| hypothetical protein VIBHAR_01725 [Vibrio harveyi ATCC BAA-1116]
          Length = 88

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+++     A+  +L  S P +  A  +G L++ +QALTQ+QE TL FV K+IAV I
Sbjct: 1  MNPAEIIHFTTQALTLVLFLSLPPILVAALVGTLVSLVQALTQVQEQTLGFVVKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G ++ SF TL L +I
Sbjct: 61 TLFVTTQWLGAELHSFATLTLGKI 84


>gi|257871302|ref|ZP_05650955.1| flagellar biosynthesis protein [Enterococcus gallinarum EG2]
 gi|257805466|gb|EEV34288.1| flagellar biosynthesis protein [Enterococcus gallinarum EG2]
          Length = 87

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 53/81 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL++ R A   IL+ S P L   M +G++I+  QA TQIQE TL+FVPK++A+F+TLI++
Sbjct: 6  VLDVLREAFLRILAISGPALLVGMLVGLVISIFQATTQIQEQTLSFVPKLLAIFLTLILA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
            F+   + +F  ++   I +
Sbjct: 66 GNFMLNLLLNFTKMIFKMISA 86


>gi|91976174|ref|YP_568833.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisB5]
 gi|91682630|gb|ABE38932.1| export protein FliQ, family 3 [Rhodopseudomonas palustris BisB5]
          Length = 87

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 58/84 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   + L++AR A+WTI+  S P++   + +G+ ++ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGPETLDVARDAVWTIVIVSTPLMVVGLVVGVAVSLVQALTQIQEQTLVFVPKILAMFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T +++ PF+   + + +  + SRI
Sbjct: 61 TFVLTLPFMADVLHAEMLRISSRI 84


>gi|257866391|ref|ZP_05646044.1| flagellar biosynthesis protein [Enterococcus casseliflavus EC30]
 gi|257873093|ref|ZP_05652746.1| flagellar biosynthesis protein [Enterococcus casseliflavus EC10]
 gi|257876004|ref|ZP_05655657.1| flagellar biosynthesis protein [Enterococcus casseliflavus EC20]
 gi|257800349|gb|EEV29377.1| flagellar biosynthesis protein [Enterococcus casseliflavus EC30]
 gi|257807257|gb|EEV36079.1| flagellar biosynthesis protein [Enterococcus casseliflavus EC10]
 gi|257810170|gb|EEV38990.1| flagellar biosynthesis protein [Enterococcus casseliflavus EC20]
          Length = 87

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 52/79 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL++ R A   IL+ S P L   M +G++I+  QA TQIQE TL+FVPK++A+F+TLI++
Sbjct: 6  VLDVLREAFLRILAISGPALLVGMLVGLVISIFQATTQIQEQTLSFVPKLLAIFLTLILA 65

Query: 66 APFIGGQISSFVTLVLSRI 84
            F+   + +F  ++   I
Sbjct: 66 GNFMLNLLLNFTKMIFKMI 84


>gi|312883877|ref|ZP_07743594.1| type III secretion protein YscS [Vibrio caribbenthicus ATCC
          BAA-2122]
 gi|309368335|gb|EFP95870.1| type III secretion protein YscS [Vibrio caribbenthicus ATCC
          BAA-2122]
          Length = 88

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A+++ +   A+  +L  S P +  A F+G L++ +QALTQ+QE TL F  K++AV +
Sbjct: 1  MSSAEIIHLTTQALTLVLFLSLPPILVATFVGTLVSLIQALTQVQEQTLGFAVKLVAVIV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G ++ SF TL+L++I
Sbjct: 61 TLFVTTQWLGAELHSFSTLILNKI 84


>gi|325567518|ref|ZP_08144185.1| flagellar biosynthetic protein FliQ [Enterococcus casseliflavus
          ATCC 12755]
 gi|325158951|gb|EGC71097.1| flagellar biosynthetic protein FliQ [Enterococcus casseliflavus
          ATCC 12755]
          Length = 87

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 52/79 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL++ R A   IL+ S P L   M +G++I+  QA TQIQE TL+FVPK++A+F+TLI++
Sbjct: 6  VLDVLREAFLRILAISGPALLVGMLVGLVISIFQATTQIQEQTLSFVPKLLAIFLTLILA 65

Query: 66 APFIGGQISSFVTLVLSRI 84
            F+   + +F  ++   I
Sbjct: 66 GNFMLNLLLNFTEMIFKMI 84


>gi|251797427|ref|YP_003012158.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. JDR-2]
 gi|247545053|gb|ACT02072.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. JDR-2]
          Length = 89

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 57/83 (68%), Gaps = 1/83 (1%)

Query: 3  EAD-VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
           AD ++ +A  A+ T+L +SAP+L  A+ +G++I+  QA TQIQE TL FVPKI+AVF++
Sbjct: 2  SADFIIGLAGQAISTVLKASAPMLVLALVVGLIISIFQATTQIQEQTLAFVPKIVAVFVS 61

Query: 62 LIISAPFIGGQISSFVTLVLSRI 84
          LII  P+I   I  F   +L+ +
Sbjct: 62 LIIFGPWILNVIVDFTYNLLNNL 84


>gi|304404261|ref|ZP_07385923.1| flagellar biosynthetic protein FliQ [Paenibacillus
          curdlanolyticus YK9]
 gi|304347239|gb|EFM13071.1| flagellar biosynthetic protein FliQ [Paenibacillus
          curdlanolyticus YK9]
          Length = 89

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 51/69 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++TIL +SAP+L   + +G++++  QA TQIQE TL FVPKI+AVF+
Sbjct: 1  MSAEFIIGLAGQAIYTILKASAPMLIIGLVVGLIVSIFQATTQIQEQTLAFVPKIVAVFV 60

Query: 61 TLIISAPFI 69
          ++II  P+I
Sbjct: 61 SMIIFGPWI 69


>gi|37527634|ref|NP_930978.1| Type III secretion component protein SctS [Photorhabdus
          luminescens subsp. laumondii TTO1]
 gi|36787069|emb|CAE16144.1| Type III secretion component protein SctS [Photorhabdus
          luminescens subsp. laumondii TTO1]
          Length = 88

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L     ++W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV I
Sbjct: 1  MSNADILHFTSQSLWLVLILSLPPVLMAAAVGTLVSLIQALTQIQEQTLGFVIKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +A ++G ++ SF  +   ++
Sbjct: 61 TLFATATWLGNELYSFANMTFLKV 84


>gi|188586036|ref|YP_001917581.1| flagellar biosynthetic protein FliQ [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|179350723|gb|ACB84993.1| flagellar biosynthetic protein FliQ [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 89

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 55/85 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  VL + R A+ T+L ++AP+L SA+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MTEEFVLHLGREALITVLLAAAPMLASALIVGLMVSIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          ++    P++   ++ F   + S I 
Sbjct: 61 SVAFFGPWMYTLLTEFAINIFSNIN 85


>gi|27550056|gb|AAO18039.1| LscS [Photorhabdus luminescens]
          Length = 88

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L     ++W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV I
Sbjct: 1  MSNADILHFTSQSLWLVLILSLPPVLMAAAVGTLVSLIQALTQIQEQTLGFVIKLIAVVI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +A ++G ++ SF  +   ++
Sbjct: 61 TLFATATWLGNELYSFANMTFLKV 84


>gi|323341373|ref|ZP_08081617.1| flagellar biosynthetic protein FliQ [Lactobacillus ruminis ATCC
          25644]
 gi|323091250|gb|EFZ33878.1| flagellar biosynthetic protein FliQ [Lactobacillus ruminis ATCC
          25644]
          Length = 87

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V ++ R A+  +L  SAPV+  AM +G++I+  QA TQIQE TL+FVPK+ A+FITLII+
Sbjct: 6  VTDVMRDALIRVLIVSAPVILVAMIVGLIISIFQATTQIQEQTLSFVPKLAAIFITLIIA 65

Query: 66 APF 68
            F
Sbjct: 66 GNF 68


>gi|150390468|ref|YP_001320517.1| flagellar biosynthetic protein FliQ [Alkaliphilus metalliredigens
          QYMF]
 gi|149950330|gb|ABR48858.1| flagellar biosynthetic protein FliQ [Alkaliphilus metalliredigens
          QYMF]
          Length = 89

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 57/86 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA V+E+ +  M+TIL+ SAP+L   + +G+ ++  QA TQIQE TL F+PKIIAV  
Sbjct: 1  MSEAMVIELGQQTMFTILTMSAPMLGFGLLVGLAVSIFQATTQIQEATLAFIPKIIAVLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +++I  P++   I +F   + + + S
Sbjct: 61 SVVIFGPWLLSIIINFTLRLFTNMNS 86


>gi|317129192|ref|YP_004095474.1| flagellar biosynthetic protein FliQ [Bacillus cellulosilyticus
          DSM 2522]
 gi|315474140|gb|ADU30743.1| flagellar biosynthetic protein FliQ [Bacillus cellulosilyticus
          DSM 2522]
          Length = 89

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  V+ +A   ++T++  + P+L +A+ +G+L++  QA TQIQE TL F+PKI+ V +
Sbjct: 1  MNQETVISLAERGVYTVIMIAGPLLITALAIGLLVSIFQATTQIQEQTLAFIPKIVGVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           LI+  P++   I SF   + S +  
Sbjct: 61 ALIVFGPWMLSIIISFAEQIFSNLHH 86


>gi|269963169|ref|ZP_06177504.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832133|gb|EEZ86257.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 88

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+++     A+  +L  S P +  A  +G L++ +QALTQ+QE TL FV K+IAV I
Sbjct: 1  MNPAEIIHFTTQALTLVLFLSLPPIVVAALVGTLVSLIQALTQVQEQTLGFVVKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G ++ +F TL L +I
Sbjct: 61 TLFVTTQWLGAELHAFATLALDKI 84


>gi|331269329|ref|YP_004395821.1| flagellar biosynthesis protein FliQ [Clostridium botulinum
          BKT015925]
 gi|329125879|gb|AEB75824.1| flagellar biosynthesis protein FliQ [Clostridium botulinum
          BKT015925]
          Length = 89

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + AM+T + +SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+I V +
Sbjct: 1  MSEEMVIGILKDAMYTGIMASAPILIVSIVIGLVISIFQATTQIQEQTLTFVPKLIGVAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
            +I+A F+   +  F   + + I +
Sbjct: 61 VGLITAKFMNHTVVGFTERIFAMIAN 86


>gi|167464151|ref|ZP_02329240.1| FliQ [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322382377|ref|ZP_08056284.1| flagellar biosynthesis protein FliQ [Paenibacillus larvae subsp.
          larvae B-3650]
 gi|321153730|gb|EFX46105.1| flagellar biosynthesis protein FliQ [Paenibacillus larvae subsp.
          larvae B-3650]
          Length = 89

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 51/69 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++++A  A++T+L +S P+L  A+ +G+L++  QA TQIQE TL FVPKIIAV +
Sbjct: 1  MSSEFIIKLAGDAVYTVLKASGPMLIIALVVGLLVSIFQATTQIQEQTLAFVPKIIAVLL 60

Query: 61 TLIISAPFI 69
          ++II  P+I
Sbjct: 61 SVIIFGPWI 69


>gi|134300234|ref|YP_001113730.1| flagellar biosynthetic protein FliQ [Desulfotomaculum reducens
          MI-1]
 gi|134052934|gb|ABO50905.1| flagellar biosynthetic protein FliQ [Desulfotomaculum reducens
          MI-1]
          Length = 89

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  VL +AR A+  ++  S P L  AM +G++I   QA TQIQE TL+FVPK++AVF+
Sbjct: 1  MTQTYVLHLAREALMMVVILSIPTLGVAMLVGLIIGIFQATTQIQEQTLSFVPKMVAVFL 60

Query: 61 TLIISA 66
          TLI++A
Sbjct: 61 TLIVAA 66


>gi|237653573|ref|YP_002889887.1| flagellar biosynthesis protein FliQ [Thauera sp. MZ1T]
 gi|237624820|gb|ACR01510.1| flagellar biosynthetic protein FliQ [Thauera sp. MZ1T]
          Length = 89

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 53/77 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E+ R A+   L  SAP+  +A+  G++I+  QA TQI E+TL+FVPK++A+F+
Sbjct: 1  MTPTTVIELGRQAIEVTLMVSAPLFLAALVTGLIISIFQAATQINEMTLSFVPKLVAIFV 60

Query: 61 TLIISAPFIGGQISSFV 77
          TL+++ P++   ++ F+
Sbjct: 61 TLVLAGPWMITLLTDFI 77


>gi|289578417|ref|YP_003477044.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter italicus
          Ab9]
 gi|297544693|ref|YP_003676995.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter mathranii
          subsp. mathranii str. A3]
 gi|289528130|gb|ADD02482.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter italicus
          Ab9]
 gi|296842468|gb|ADH60984.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter mathranii
          subsp. mathranii str. A3]
          Length = 89

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L+ + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGVVIDIGREALTVTLTVATPLLAVALVVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFI 69
          +LI+  P++
Sbjct: 61 SLILFGPWM 69


>gi|28898447|ref|NP_798052.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus RIMD 2210633]
 gi|153836228|ref|ZP_01988895.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus AQ3810]
 gi|260365109|ref|ZP_05777680.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus K5030]
 gi|260876608|ref|ZP_05888963.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus AN-5034]
 gi|260895031|ref|ZP_05903527.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus Peru-466]
 gi|260900958|ref|ZP_05909353.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus AQ4037]
 gi|28806664|dbj|BAC59936.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus RIMD 2210633]
 gi|149750503|gb|EDM61248.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus AQ3810]
 gi|308086015|gb|EFO35710.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus Peru-466]
 gi|308093602|gb|EFO43297.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus AN-5034]
 gi|308110801|gb|EFO48341.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus AQ4037]
 gi|308111602|gb|EFO49142.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus K5030]
 gi|328468940|gb|EGF39900.1| translocation protein in type III secretion [Vibrio
          parahaemolyticus 10329]
          Length = 88

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+++     A+  +L  S P +  A  +G L++ +QALTQ+QE TL FV K+IAV I
Sbjct: 1  MNPAEIIHFTTQALTLVLFLSLPPILVAALVGTLVSLIQALTQVQEQTLGFVVKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL I+  ++G ++ +F +L L +I
Sbjct: 61 TLFITTQWLGAELHAFASLALDKI 84


>gi|298530623|ref|ZP_07018025.1| flagellar biosynthetic protein FliQ [Desulfonatronospira
          thiodismutans ASO3-1]
 gi|298509997|gb|EFI33901.1| flagellar biosynthetic protein FliQ [Desulfonatronospira
          thiodismutans ASO3-1]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+ T L  S P+L   M +GI I+ LQA TQIQE+TLT VPKIIA+F+
Sbjct: 1  MTPEFVVGFARHAIETTLMISLPMLGIGMIVGITISILQAATQIQEMTLTIVPKIIAIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+ S P+I  ++ +F T + + I +
Sbjct: 61 ALLFSFPWIMEKMVTFTTDLFNNIPN 86


>gi|312135837|ref|YP_004003175.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          owensensis OL]
 gi|311775888|gb|ADQ05375.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          owensensis OL]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VLEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MNTELVLEIARQAILTAFYVAGPILLVSMVVGIVISILQAATQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSF 76
          +L+I   ++  ++  F
Sbjct: 61 SLLIFGQWMLAKVVEF 76


>gi|332294882|ref|YP_004436805.1| export protein FliQ family 3 [Thermodesulfobium narugense DSM
          14796]
 gi|332177985|gb|AEE13674.1| export protein FliQ family 3 [Thermodesulfobium narugense DSM
          14796]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 53/77 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++   L+++R AM  +L  +APVL  A+F+G+ +   QA TQ+Q++T++FVPK++AV +
Sbjct: 1  MSQGLALDLSRNAMLVLLLITAPVLLVALFIGLFLGIFQAATQLQDITISFVPKLLAVIV 60

Query: 61 TLIISAPFIGGQISSFV 77
           + +  PF    ++S++
Sbjct: 61 VMFLLGPFTLNVLTSYI 77


>gi|253682353|ref|ZP_04863150.1| flagellar biosynthetic protein FliQ [Clostridium botulinum D str.
          1873]
 gi|253562065|gb|EES91517.1| flagellar biosynthetic protein FliQ [Clostridium botulinum D str.
          1873]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + AM+T + +SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+I V +
Sbjct: 1  MSEDMVIGILKDAMYTGIMASAPILIVSIVIGLVISIFQATTQIQEQTLTFVPKLIGVAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
            +I+A F+   +  F   + + I +
Sbjct: 61 IGLITAKFMNHTVVGFTERIFAMIAN 86


>gi|253996310|ref|YP_003048374.1| flagellar biosynthetic protein FliQ [Methylotenera mobilis JLW8]
 gi|253982989|gb|ACT47847.1| flagellar biosynthetic protein FliQ [Methylotenera mobilis JLW8]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L + + +G+L++  QA TQI E TL+F+PK++ VF+
Sbjct: 1  MTPESVMTLGRDAMSITLMIAAPILLTVLAIGLLVSIFQAATQINEQTLSFIPKLVGVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+++ P++ G +  ++ LV + I +
Sbjct: 61 ALMLAGPWMLGTMVDYMHLVFTSIPA 86


>gi|302037619|ref|YP_003797941.1| flagellar biosynthetic protein FliQ [Candidatus Nitrospira
          defluvii]
 gi|300605683|emb|CBK42016.1| Flagellar biosynthetic protein FliQ, export component [Candidatus
          Nitrospira defluvii]
          Length = 89

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 57/86 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V EI R A+ T +  SAP+L  ++ +G+L++  QA+TQI E TLTFVPK++AVF 
Sbjct: 1  MTIETVTEIGRQAIETTMLVSAPILGLSLIVGLLVSTFQAMTQINEATLTFVPKVLAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
            ++  P++ G + +F+T +++ I S
Sbjct: 61 ATLLFLPWMMGVLIAFMTHIITSIPS 86


>gi|312792664|ref|YP_004025587.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          kristjanssonii 177R1B]
 gi|312876514|ref|ZP_07736497.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          lactoaceticus 6A]
 gi|311796725|gb|EFR13071.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          lactoaceticus 6A]
 gi|312179804|gb|ADQ39974.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          kristjanssonii 177R1B]
          Length = 89

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A VLEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTALVLEIARQAILTAFYVAGPILLVSMVVGIVISILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I   ++  ++  F   + + I  
Sbjct: 61 SLLIFGQWMLTKVIEFTRYLWTNINQ 86


>gi|309388835|gb|ADO76715.1| flagellar biosynthetic protein FliQ [Halanaerobium praevalens DSM
          2228]
          Length = 89

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M EA VL+I R A++T++    PVL + +  G+L+A  QA TQIQE TL FVPKI AV  
Sbjct: 1  MGEAVVLDIGRQALFTVIIVVFPVLGAGLITGLLVAIFQATTQIQEQTLAFVPKIFAVLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++    P+I   +  FV  +L  I + L
Sbjct: 61 SIAFFGPWIMRTVIEFVQELLRNIPTYL 88


>gi|291613057|ref|YP_003523214.1| flagellar biosynthetic protein FliQ [Sideroxydans lithotrophicus
          ES-1]
 gi|291583169|gb|ADE10827.1| flagellar biosynthetic protein FliQ [Sideroxydans lithotrophicus
          ES-1]
          Length = 89

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ I + A+   +  SAP L +A+ +G+L++  QA TQI E+TL+F+PK++  F+
Sbjct: 1  MTPESVMTIGQQALELTIMVSAPPLLTALIIGLLVSIFQAATQINELTLSFIPKLLGAFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           LIIS P++ G +  ++T + S I
Sbjct: 61 VLIISGPWMIGILLDYITRLFSSI 84


>gi|256370974|ref|YP_003108798.1| flagellar biosynthetic protein FliQ [Acidimicrobium ferrooxidans
          DSM 10331]
 gi|256007558|gb|ACU53125.1| flagellar biosynthetic protein FliQ [Acidimicrobium ferrooxidans
          DSM 10331]
          Length = 91

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+A VL+IAR A+      + PVL  A+ +G+++A  Q LTQIQE TL+FVPK+ A+ +
Sbjct: 1  MNDAAVLQIARTALEVATLVAGPVLAVALLVGLVVALAQTLTQIQEATLSFVPKLAAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+ +  ++  ++++  T + S+I
Sbjct: 61 VLLFTGHWMLQELTTMTTQLYSQI 84


>gi|172057872|ref|YP_001814332.1| flagellar biosynthetic protein FliQ [Exiguobacterium sibiricum
          255-15]
 gi|171990393|gb|ACB61315.1| flagellar biosynthetic protein FliQ [Exiguobacterium sibiricum
          255-15]
          Length = 90

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 60/84 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  ++++A +A+WT+L  SAP+L  ++ +G+L++ LQA TQIQE TL+FVPKI+AVF+
Sbjct: 1  MTQEMIIQLASSAVWTLLKVSAPLLLVSLVVGLLVSILQATTQIQEQTLSFVPKIVAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+   P+I  ++ +F   +  +I
Sbjct: 61 ALVFFGPWIMEELKTFTIEIFKQI 84


>gi|167040313|ref|YP_001663298.1| flagellar biosynthesis protein FliQ [Thermoanaerobacter sp. X514]
 gi|256750757|ref|ZP_05491642.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus CCSD1]
 gi|300914397|ref|ZP_07131713.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X561]
 gi|307724367|ref|YP_003904118.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X513]
 gi|166854553|gb|ABY92962.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X514]
 gi|256750340|gb|EEU63359.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus CCSD1]
 gi|300889332|gb|EFK84478.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X561]
 gi|307581428|gb|ADN54827.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X513]
          Length = 89

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L  ++P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGVVIDIGREALTVALKVASPLLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFI 69
          +LI+  P++
Sbjct: 61 SLILFGPWM 69


>gi|17548595|ref|NP_521935.1| flagellar biosynthesis protein FliQ [Ralstonia solanacearum
          GMI1000]
 gi|17430843|emb|CAD17525.1| probable flagellar biosynthetic fliq transmembrane protein
          [Ralstonia solanacearum GMI1000]
          Length = 89

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLNMARQAMQVAMMIGAPMLLVSLIVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T+I++ P++ G I  +   VL+ I +
Sbjct: 61 TMILAGPWVLGVIVDYTRDVLTNIPN 86


>gi|108757472|ref|YP_630668.1| FliQ/MopD/SpaQ family protein [Myxococcus xanthus DK 1622]
 gi|108461352|gb|ABF86537.1| FliQ/MopD/SpaQ family protein [Myxococcus xanthus DK 1622]
          Length = 87

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          I + A++ +L +SAP +  ++ +G +I+  QA TQIQE TLTF PK++AVF  L ++ P+
Sbjct: 7  ITQEALFLVLVASAPPVLMSLLVGFIISLFQATTQIQEQTLTFAPKVVAVFGVLALAGPW 66

Query: 69 IGGQISSFVTLVLSR 83
          IG Q+  F   V  R
Sbjct: 67 IGSQLVRFTFHVFDR 81


>gi|146312186|ref|YP_001177260.1| flagellar biosynthesis protein FliQ [Enterobacter sp. 638]
 gi|145319062|gb|ABP61209.1| flagellar biosynthetic protein FliQ [Enterobacter sp. 638]
          Length = 89

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   +S +AP+L  A+  G++I+ LQA TQI E+TL+F+PKIIAVF+
Sbjct: 1  MTPESVMMMGTEAMKVAISVAAPLLLVALVTGLVISILQAATQINEMTLSFIPKIIAVFV 60

Query: 61 TLIISAPFI 69
          T+I++ P++
Sbjct: 61 TIIVAGPWM 69


>gi|89068704|ref|ZP_01156090.1| putative flagellar biosynthetic transmembrane protein [Oceanicola
          granulosus HTCC2516]
 gi|89045667|gb|EAR51729.1| putative flagellar biosynthetic transmembrane protein [Oceanicola
          granulosus HTCC2516]
          Length = 88

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+  +   A+  +L +SAPVL  A+ +G+ IA  QALTQIQE+TLTFVPKI+A+F+
Sbjct: 1  MSAADIYAVLSDAILAVLLASAPVLVVALVVGLGIALFQALTQIQEMTLTFVPKIVAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+ S PF+   +      V   I S
Sbjct: 61 ALLASLPFVYATLEGLSDTVFDLIVS 86


>gi|304316892|ref|YP_003852037.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302778394|gb|ADL68953.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 89

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I R A+   +  SAP+L  ++ +G++I+  QA TQIQE TLTFVPKI+A+F 
Sbjct: 1  MDPGVVLDIGREALMVTMIVSAPLLIVSLLIGLIISIFQATTQIQEQTLTFVPKILAIFA 60

Query: 61 TLIISAPFI 69
          ++I+  P++
Sbjct: 61 SIILFGPWM 69


>gi|119384845|ref|YP_915901.1| export protein FliQ [Paracoccus denitrificans PD1222]
 gi|119374612|gb|ABL70205.1| export protein FliQ, family 3 [Paracoccus denitrificans PD1222]
          Length = 88

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 49/78 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  + ++ R A+W  +  SAP+L  A+  G++I   QALT +QE+TLTFVPKI  + +
Sbjct: 1  MDENLIFDLTRQALWIAVRMSAPLLIVALVTGVVIGLFQALTSVQEMTLTFVPKIGLMLV 60

Query: 61 TLIISAPFIGGQISSFVT 78
             +S  F+   ++SF T
Sbjct: 61 VFWVSMSFMTATLASFFT 78


>gi|226313053|ref|YP_002772947.1| flagellar biosynthetic protein FliQ [Brevibacillus brevis NBRC
          100599]
 gi|226096001|dbj|BAH44443.1| flagellar biosynthetic protein FliQ [Brevibacillus brevis NBRC
          100599]
          Length = 89

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 52/69 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  +++IA+++++TIL  SAP L  A+ +G++++  QA TQIQE TL F+PKI+AVF+
Sbjct: 1  MTQELLMQIAQSSVYTILLISAPALGVALLVGLMVSVFQATTQIQEQTLAFIPKIVAVFV 60

Query: 61 TLIISAPFI 69
           ++ + P++
Sbjct: 61 VILAAGPWM 69


>gi|167037652|ref|YP_001665230.1| flagellar biosynthesis protein FliQ [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|320116067|ref|YP_004186226.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
 gi|326389466|ref|ZP_08211033.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus JW 200]
 gi|166856486|gb|ABY94894.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|319929158|gb|ADV79843.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
 gi|325994471|gb|EGD52896.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus JW 200]
          Length = 89

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L+ + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGMVIDIGREALTIALTVATPLLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFI 69
          +LI+  P++
Sbjct: 61 SLILFGPWM 69


>gi|323705430|ref|ZP_08117005.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          xylanolyticum LX-11]
 gi|323535332|gb|EGB25108.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          xylanolyticum LX-11]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I R A+   +  SAP+L  ++ +G++I+  QA TQIQE TLTFVPKI+A+F 
Sbjct: 1  MDPGLVLDIGREALMVTMMVSAPLLIISLLVGLIISIFQATTQIQEQTLTFVPKILAIFA 60

Query: 61 TLIISAPFI 69
          ++I+  P++
Sbjct: 61 SIILFGPWM 69


>gi|261855325|ref|YP_003262608.1| flagellar biosynthetic protein FliQ [Halothiobacillus
          neapolitanus c2]
 gi|261835794|gb|ACX95561.1| flagellar biosynthetic protein FliQ [Halothiobacillus
          neapolitanus c2]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL++ R AM  IL  S P+L +A+ +G+L+   QA TQI E+TL+F+PK+ AV +
Sbjct: 1  MSPDTVLDLTRQAMVIILLLSMPILLTALAVGLLVGMFQAATQINEMTLSFIPKLFAVVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++++ P++   +  F T +  RI
Sbjct: 61 AILLAGPWMLHLLVDFTTDLFHRI 84


>gi|158320530|ref|YP_001513037.1| flagellar biosynthetic protein FliQ [Alkaliphilus oremlandii
          OhILAs]
 gi|158140729|gb|ABW19041.1| flagellar biosynthetic protein FliQ [Alkaliphilus oremlandii
          OhILAs]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E+ V+E+ + AM+TIL  SAP L   + +G+ ++  QA TQIQE TL F+PKI+A+  
Sbjct: 1  MSESMVIELGQQAMFTILLLSAPTLLIGLIVGLAVSIFQATTQIQEATLAFIPKIVAILG 60

Query: 61 TLIISAPFI 69
          +L++  P++
Sbjct: 61 SLVVFGPWL 69


>gi|302670737|ref|YP_003830697.1| flagellar biosynthetic protein FliQ [Butyrivibrio proteoclasticus
          B316]
 gi|302395210|gb|ADL34115.1| flagellar biosynthetic protein FliQ [Butyrivibrio proteoclasticus
          B316]
          Length = 90

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 54/79 (68%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
           D+ EI  +A++ ++  S PVL ++M +G++I+  Q +T IQE TLTFVPK++ VF+ ++
Sbjct: 5  GDINEIISSALFMVIKMSLPVLLTSMIIGLVISIFQTVTSIQEQTLTFVPKVLGVFVMIM 64

Query: 64 ISAPFIGGQISSFVTLVLS 82
          I   ++  +++ F+T + S
Sbjct: 65 ILGNWMATELAGFITTLWS 83


>gi|307264884|ref|ZP_07546446.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter wiegelii
          Rt8.B1]
 gi|306920142|gb|EFN50354.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter wiegelii
          Rt8.B1]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L  + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGMVIDIGREALTIALKVATPLLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFI 69
          +LI+  P++
Sbjct: 61 SLILFGPWM 69


>gi|117923327|ref|YP_863944.1| flagellar biosynthetic protein FliQ [Magnetococcus sp. MC-1]
 gi|117607083|gb|ABK42538.1| flagellar biosynthetic protein FliQ [Magnetococcus sp. MC-1]
          Length = 89

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 46/56 (82%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          SAP+L +A+ +GI I+ LQA+TQIQE+TLTF+PKI+A F+ L+++ P++  +++ +
Sbjct: 21 SAPMLLTALVVGITISLLQAVTQIQEMTLTFIPKILATFLALMLTLPWMIQKLTDY 76


>gi|298346007|ref|YP_003718694.1| flagellar biosynthesis protein FliQ [Mobiluncus curtisii ATCC
          43063]
 gi|304390235|ref|ZP_07372189.1| flagellar biosynthetic protein FliQ [Mobiluncus curtisii subsp.
          curtisii ATCC 35241]
 gi|315654595|ref|ZP_07907501.1| flagellar biosynthetic protein FliQ [Mobiluncus curtisii ATCC
          51333]
 gi|315657500|ref|ZP_07910382.1| flagellar biosynthetic protein FliQ [Mobiluncus curtisii subsp.
          holmesii ATCC 35242]
 gi|298236068|gb|ADI67200.1| flagellar biosynthesis protein FliQ [Mobiluncus curtisii ATCC
          43063]
 gi|304326717|gb|EFL93961.1| flagellar biosynthetic protein FliQ [Mobiluncus curtisii subsp.
          curtisii ATCC 35241]
 gi|315491059|gb|EFU80678.1| flagellar biosynthetic protein FliQ [Mobiluncus curtisii ATCC
          51333]
 gi|315491972|gb|EFU81581.1| flagellar biosynthetic protein FliQ [Mobiluncus curtisii subsp.
          holmesii ATCC 35242]
          Length = 90

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN + VL++A  AM      SAP+L +++ +G LI+  Q++TQIQEVTLTFVPK +AV I
Sbjct: 1  MNSSAVLDLALTAMLMGAKLSAPILITSLVVGFLISLFQSITQIQEVTLTFVPKTVAVGI 60

Query: 61 TLIISA 66
           L I+ 
Sbjct: 61 ALYITG 66


>gi|315498433|ref|YP_004087237.1| flagellar biosynthetic protein fliq [Asticcacaulis excentricus CB
          48]
 gi|315416445|gb|ADU13086.1| flagellar biosynthetic protein FliQ [Asticcacaulis excentricus CB
          48]
          Length = 87

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +VL + R A+W  +   APVL   + +G++I   QALTQIQE TL + PKIIAVF+
Sbjct: 1  MTGTEVLSVGRDAIWLTIQLCAPVLIVGLVVGVVIGLFQALTQIQEQTLIYAPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++  P +G  +S F+  + ++I
Sbjct: 61 TLLLVLPLMGALLSGFMKEIATKI 84


>gi|91224469|ref|ZP_01259731.1| translocation protein in type III secretion [Vibrio alginolyticus
          12G01]
 gi|262394132|ref|YP_003285986.1| type III secretion protein YscS [Vibrio sp. Ex25]
 gi|269967240|ref|ZP_06181304.1| translocation protein in type III secretion [Vibrio alginolyticus
          40B]
 gi|91190811|gb|EAS77078.1| translocation protein in type III secretion [Vibrio alginolyticus
          12G01]
 gi|262284524|gb|ACY41061.1| VscS [Vibrio alginolyticus]
 gi|262337726|gb|ACY51521.1| type III secretion protein YscS [Vibrio sp. Ex25]
 gi|269828096|gb|EEZ82366.1| translocation protein in type III secretion [Vibrio alginolyticus
          40B]
          Length = 88

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A+++     A+  +L  S P +  A  +G L++ +QALTQ+QE TL FV K+IAV I
Sbjct: 1  MHSAEIIHFTTQALTLVLYLSLPPILVAALVGTLVSLIQALTQVQEQTLGFVVKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G ++ +F +L + +I
Sbjct: 61 TLFVTTQWLGAELHAFASLAMDKI 84


>gi|119899017|ref|YP_934230.1| flagellar biosynthesis protein FliQ [Azoarcus sp. BH72]
 gi|119671430|emb|CAL95343.1| flagellar biosynthesis protein FliQ [Azoarcus sp. BH72]
          Length = 89

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 52/77 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E+ R A+   L  SAP+  +A+  G++I+  QA TQI E+TL+FVPKI+ +F+
Sbjct: 1  MTPTAVIELGRQAIEVTLLVSAPLFLAALVTGLIISIFQAATQINEMTLSFVPKIVVMFV 60

Query: 61 TLIISAPFIGGQISSFV 77
          TL+++ P++   ++ F+
Sbjct: 61 TLVLAGPWMITMLTDFM 77


>gi|146296297|ref|YP_001180068.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          saccharolyticus DSM 8903]
 gi|145409873|gb|ABP66877.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          saccharolyticus DSM 8903]
          Length = 89

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A  LEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDIAVALEIARQAILTAFYIAGPILIVSMIVGIVISILQATTQINEQTLTFVPKLIAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I   ++  +   F   +L+ I  
Sbjct: 61 SLLIFGHWMLTKAVEFTKYLLTNINQ 86


>gi|284006887|emb|CBA72156.1| type III secretion component protein SctS [Arsenophonus nasoniae]
          Length = 87

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN  D + ++  ++W +   S P +  A  +G L++ +QALTQIQE TL F+ K+ +V +
Sbjct: 1  MNSLDFIYLSEQSLWLVFMLSMPPIVVAAIVGTLVSLIQALTQIQEQTLGFLFKLTSVIV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++ A ++G +I  F  L+  RI
Sbjct: 61 TLLMIADWLGNEIYRFTELIFQRI 84


>gi|312126836|ref|YP_003991710.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          hydrothermalis 108]
 gi|311776855|gb|ADQ06341.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          hydrothermalis 108]
          Length = 89

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VLEIAR A+ T    + P+L  +M +GI+++ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTTLVLEIARQAILTAFYVAGPILLVSMVVGIVVSILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I   ++  ++  F   + + I  
Sbjct: 61 SLLIFGQWMLTKVVEFTRYLWTNINQ 86


>gi|222530122|ref|YP_002574004.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor bescii
          DSM 6725]
 gi|222456969|gb|ACM61231.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor bescii
          DSM 6725]
          Length = 89

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VLEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTTVVLEIARQAILTAFYVAGPILLISMVVGIVISILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I   ++  ++  F   + + I  
Sbjct: 61 SLLIFGQWMLTKVIEFTRYLWTNINQ 86


>gi|332799192|ref|YP_004460691.1| flagellar biosynthetic protein FliQ [Tepidanaerobacter sp. Re1]
 gi|332696927|gb|AEE91384.1| flagellar biosynthetic protein FliQ [Tepidanaerobacter sp. Re1]
          Length = 89

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ IAR A+   L  SAP+L   M +GI+++  QA TQIQE TLTFVPKII V  
Sbjct: 1  MTQEMVIYIAREALSVALLVSAPMLLLGMLVGIIVSIFQATTQIQEQTLTFVPKIIVVMF 60

Query: 61 TLIISAPFIGGQISSF 76
          +++I  P++   I+ F
Sbjct: 61 SMVIFGPWMLTIITQF 76


>gi|160880830|ref|YP_001559798.1| flagellar biosynthetic protein FliQ [Clostridium phytofermentans
          ISDg]
 gi|160429496|gb|ABX43059.1| flagellar biosynthetic protein FliQ [Clostridium phytofermentans
          ISDg]
          Length = 89

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 53/76 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  ++E+ R  ++ I+  S+P+L +++ +G++++ LQ +T +QE TLTFVPK+I VF+
Sbjct: 1  MDENLLVELLRQTLFLIIKVSSPMLITSLVIGLVVSVLQTVTSVQEQTLTFVPKLIGVFL 60

Query: 61 TLIISAPFIGGQISSF 76
           L++   +I   I+ +
Sbjct: 61 VLMLCGNWIMKNITEY 76


>gi|24215310|ref|NP_712791.1| endoflagellar biosynthesis pathway protein [Leptospira
          interrogans serovar Lai str. 56601]
 gi|45657251|ref|YP_001337.1| flagellar biosynthetic protein fliQ [Leptospira interrogans
          serovar Copenhageni str. Fiocruz L1-130]
 gi|24196411|gb|AAN49809.1| endoflagellar biosynthesis pathway protein [Leptospira
          interrogans serovar Lai str. 56601]
 gi|45600489|gb|AAS69974.1| flagellar biosynthetic protein fliQ [Leptospira interrogans
          serovar Copenhageni str. Fiocruz L1-130]
          Length = 87

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 46/64 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E DV+ + R +++  L  S+P+LF+A+ +G+++  LQ  T IQE T+ FVPK++A+FI
Sbjct: 1  MTELDVMTLIRDSLYITLKISSPILFTALVVGLIVGILQTTTSIQEPTIAFVPKLLAIFI 60

Query: 61 TLII 64
           ++I
Sbjct: 61 VIVI 64


>gi|115377825|ref|ZP_01465013.1| flagellar biosynthetic protein FliQ [Stigmatella aurantiaca
          DW4/3-1]
 gi|310820308|ref|YP_003952666.1| bacterial export protein fliq, family 3 [Stigmatella aurantiaca
          DW4/3-1]
 gi|115365157|gb|EAU64204.1| flagellar biosynthetic protein FliQ [Stigmatella aurantiaca
          DW4/3-1]
 gi|309393380|gb|ADO70839.1| Bacterial export protein FliQ, family 3 [Stigmatella aurantiaca
          DW4/3-1]
          Length = 88

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          I + A++ +L  SAP +  ++ +G +IA  QA TQIQE TLTF PK++ VFI L ++ P+
Sbjct: 7  ITQQALFLVLIVSAPPVLISLVVGFIIALFQATTQIQEQTLTFAPKVVIVFIVLAMAGPW 66

Query: 69 IGGQISSFVTLVLSR 83
          IG Q+  F   V  R
Sbjct: 67 IGHQLLRFTFHVFDR 81


>gi|260222419|emb|CBA31964.1| Flagellar biosynthetic protein fliQ [Curvibacter putative
          symbiont of Hydra magnipapillata]
          Length = 89

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 54/87 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VL + + A+  +L  SAPVL +A+ +G+L++  QA+TQI E TL FVPK++AV  
Sbjct: 1  MNAQTVLTMGQEALLMLLMVSAPVLGAALVVGLLVSLFQAVTQIHEATLAFVPKLLAVIA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
             I+ P++   +  ++  +L  I +S
Sbjct: 61 VFAIAGPWMLTMLVEYIRRMLEAIPAS 87


>gi|118592627|ref|ZP_01550017.1| Type III secretory pathway, component EscS [Stappia aggregata IAM
          12614]
 gi|118434678|gb|EAV41329.1| Type III secretory pathway, component EscS [Stappia aggregata IAM
          12614]
          Length = 89

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  AD L +   AM+ +L  S P + +A  +G+ ++ LQALTQIQE TL F  K+IAV I
Sbjct: 1  MAPADALHVTTEAMFLVLLLSMPPILAASIVGLAVSLLQALTQIQEQTLPFAAKLIAVAI 60

Query: 61 TLIISAPFIGGQISSF 76
          +L  ++ ++GG++ +F
Sbjct: 61 SLAATSTYLGGEMYNF 76


>gi|332702321|ref|ZP_08422409.1| flagellar biosynthetic protein FliQ [Desulfovibrio africanus str.
          Walvis Bay]
 gi|332552470|gb|EGJ49514.1| flagellar biosynthetic protein FliQ [Desulfovibrio africanus str.
          Walvis Bay]
          Length = 89

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+   L+ S P+L   M +GI ++ LQA TQIQE+TLTFVPKIIA+FI
Sbjct: 1  MTPEFVIGFARQAIELTLTISLPLLGIGMIVGIFVSVLQAATQIQEMTLTFVPKIIAIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P+I  ++ ++   +L    S L
Sbjct: 61 ALLLFFPWIMDKMITYTRDLLINFPSYL 88


>gi|256833224|ref|YP_003161951.1| flagellar biosynthetic protein FliQ [Jonesia denitrificans DSM
          20603]
 gi|256686755|gb|ACV09648.1| flagellar biosynthetic protein FliQ [Jonesia denitrificans DSM
          20603]
          Length = 90

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I   A+W      AP+L +A+ +G  I+ LQ++TQ+QEVTL+FVPK + V I
Sbjct: 1  MDTTAVLDIGLQALWLTAKLCAPILITALAVGFAISLLQSITQVQEVTLSFVPKALGVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + IS  ++  +  +F   + +RI + L
Sbjct: 61 VIYISGHWMIEETVAFTNEMFNRIPTLL 88


>gi|300693348|ref|YP_003749321.1| fliq: flagellar biosynthesis protein. fliq/mopd/spaq family
          [Ralstonia solanacearum PSI07]
 gi|299075385|emb|CBJ34680.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum PSI07]
          Length = 89

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLNMARQAMQVAMMIGAPMLLVSLIVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T+I++ P++ G I  +   VL  I +
Sbjct: 61 TMILAGPWVLGVIVDYTRDVLINIPN 86


>gi|329901240|ref|ZP_08272765.1| Flagellar biosynthesis protein fliQ [Oxalobacteraceae bacterium
          IMCC9480]
 gi|327549172|gb|EGF33764.1| Flagellar biosynthesis protein fliQ [Oxalobacteraceae bacterium
          IMCC9480]
          Length = 89

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 47/69 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++ +F+
Sbjct: 1  MTPESVMVMGRHAMEVTLMVAAPLLMVALLIGLIVSIFQAATQINEQTLSFIPKLVGIFV 60

Query: 61 TLIISAPFI 69
          TL+I+ P++
Sbjct: 61 TLVIAGPWM 69


>gi|312621585|ref|YP_004023198.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          kronotskyensis 2002]
 gi|312202052|gb|ADQ45379.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          kronotskyensis 2002]
          Length = 89

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VLEIAR A+ T    + P+L  +M +GI+++ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTTVVLEIARQAILTAFYVAGPILLISMVVGIVVSILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I   ++  ++  F   + + I  
Sbjct: 61 SLLIFGQWMLTKVIEFTRYLWTNINQ 86


>gi|302872554|ref|YP_003841190.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          obsidiansis OB47]
 gi|302575413|gb|ADL43204.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          obsidiansis OB47]
          Length = 89

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ + VLEIAR A+ T    + P+L  +M +GI+++ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTSVVLEIARQAILTAFYVAGPILLVSMVVGIVVSILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSF 76
          +L++   ++  ++  F
Sbjct: 61 SLLVFGQWMLTKVVEF 76


>gi|227876757|ref|ZP_03994866.1| flagellar biosynthesis protein FliQ [Mobiluncus mulieris ATCC
          35243]
 gi|269976284|ref|ZP_06183280.1| flagellar biosynthetic protein FliQ [Mobiluncus mulieris 28-1]
 gi|306817704|ref|ZP_07451446.1| flagellar biosynthetic protein FliQ [Mobiluncus mulieris ATCC
          35239]
 gi|307701591|ref|ZP_07638608.1| putative flagellar biosynthetic protein FliQ [Mobiluncus mulieris
          FB024-16]
 gi|227842654|gb|EEJ52854.1| flagellar biosynthesis protein FliQ [Mobiluncus mulieris ATCC
          35243]
 gi|269935613|gb|EEZ92151.1| flagellar biosynthetic protein FliQ [Mobiluncus mulieris 28-1]
 gi|304649518|gb|EFM46801.1| flagellar biosynthetic protein FliQ [Mobiluncus mulieris ATCC
          35239]
 gi|307613270|gb|EFN92522.1| putative flagellar biosynthetic protein FliQ [Mobiluncus mulieris
          FB024-16]
          Length = 90

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A VL++A  AM      +APVL +++ +G +I+  Q++TQIQEVTLTFVPK IAV I
Sbjct: 1  MNSAAVLDLALTAMIMGAKLAAPVLITSLVVGFVISLFQSITQIQEVTLTFVPKTIAVGI 60

Query: 61 TLIISA 66
           L I  
Sbjct: 61 ALYICG 66


>gi|317151988|ref|YP_004120036.1| flagellar biosynthetic protein FliQ [Desulfovibrio aespoeensis
          Aspo-2]
 gi|316942239|gb|ADU61290.1| flagellar biosynthetic protein FliQ [Desulfovibrio aespoeensis
          Aspo-2]
          Length = 89

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 51/78 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+   L  S P+L   M +GI I+ LQA TQIQE+TLT VPKI+A+FI
Sbjct: 1  MTPEFVVGFARQAIEITLVISLPMLGVGMIVGIFISVLQAATQIQEMTLTMVPKIVAIFI 60

Query: 61 TLIISAPFIGGQISSFVT 78
           L+++ P+I  ++ ++ T
Sbjct: 61 ALLVAFPWIMDKMMTYTT 78


>gi|220929451|ref|YP_002506360.1| flagellar biosynthetic protein FliQ [Clostridium cellulolyticum
          H10]
 gi|219999779|gb|ACL76380.1| flagellar biosynthetic protein FliQ [Clostridium cellulolyticum
          H10]
          Length = 89

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M+E+ ++ IA+ A+  IL  SAP+L  +M +G++I+  QA TQIQE TLTFVPKI++V
Sbjct: 1  MDESGIINIAQDALKVILYVSAPILLISMIVGLVISIFQATTQIQEQTLTFVPKILSV 58


>gi|291529027|emb|CBK94613.1| Flagellar biosynthesis pathway, component FliQ [Eubacterium
          rectale M104/1]
          Length = 61

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 46/60 (76%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + +  VL+IAR A++T + +SAP+L  ++ +G++++  Q +T IQE TLTFVPKIIA+F+
Sbjct: 2  ITQEAVLDIAREAIYTTIITSAPLLLISLIVGLIVSIFQTVTSIQEQTLTFVPKIIAIFL 61


>gi|83646011|ref|YP_434446.1| type III secretory pathway subunit EscS [Hahella chejuensis KCTC
          2396]
 gi|83634054|gb|ABC30021.1| Type III secretory pathway, component EscS [Hahella chejuensis
          KCTC 2396]
          Length = 89

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M EADV++    A+  +L  S P +  A F G+L++ LQA+TQIQE TL F  K++A+  
Sbjct: 1  MTEADVIQYTTEALLLVLILSMPPILVATFTGVLVSLLQAVTQIQEQTLGFAVKLVAIVA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++A ++G ++  +  LV   I
Sbjct: 61 TLYLTARWLGMEMYQYTVLVFDAI 84


>gi|302343743|ref|YP_003808272.1| flagellar biosynthetic protein FliQ [Desulfarculus baarsii DSM
          2075]
 gi|301640356|gb|ADK85678.1| flagellar biosynthetic protein FliQ [Desulfarculus baarsii DSM
          2075]
          Length = 89

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   ++  AR  M   L  +APVL   M +G+L++  Q++TQIQE+TLTFVPKI+AV +
Sbjct: 1  MNVDFIIGFARQGMEITLLMAAPVLGVGMVVGLLVSIFQSVTQIQEMTLTFVPKILAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+   P++  ++ ++   ++  I +
Sbjct: 61 ALLFFGPWMLAKMMNYTESIIQNIPT 86


>gi|119503676|ref|ZP_01625759.1| flagellar biosynthesis protein Q [marine gamma proteobacterium
          HTCC2080]
 gi|119460738|gb|EAW41830.1| flagellar biosynthesis protein Q [marine gamma proteobacterium
          HTCC2080]
          Length = 89

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++ R A+W  +  + P+L +A+ +G+ I  +QA TQIQE+TL+F+PK++A+ +
Sbjct: 1  MGPETVLDLGRDALWLAVLLAGPLLGAALAVGLFIGVIQAATQIQEMTLSFIPKLLALVV 60

Query: 61 TLIISAPFI 69
          TL +  P++
Sbjct: 61 TLFVIGPWM 69


>gi|85058020|ref|YP_453722.1| flagellar biosynthesis protein FliQ [Sodalis glossinidius str.
          'morsitans']
 gi|84778540|dbj|BAE73317.1| flagellar protein FliQ [Sodalis glossinidius str. 'morsitans']
          Length = 89

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L+ S P L +AM  G+L++ LQA TQI E+TL+F+PKI+AV I
Sbjct: 1  MTPEAVMTLGFDAMKVGLALSTPPLLAAMVTGLLVSLLQASTQINEMTLSFIPKILAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I+ P++   +  +V  + S++  S+
Sbjct: 61 SLVIAGPWMLSLLLDYVRTLFSQLPYSI 88


>gi|323490155|ref|ZP_08095375.1| flagellar biosynthetic protein FliQ [Planococcus donghaensis
          MPA1U2]
 gi|323396203|gb|EGA89029.1| flagellar biosynthetic protein FliQ [Planococcus donghaensis
          MPA1U2]
          Length = 89

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 51/69 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++A  +++T++  SAP+L  A+ +G+L++  QA+TQIQE TL F+PKI+AVFI
Sbjct: 1  MTPDMVIKLAEQSIFTVILISAPMLLIALAVGLLVSVFQAMTQIQEQTLAFIPKILAVFI 60

Query: 61 TLIISAPFI 69
           L++  P++
Sbjct: 61 ALVVFGPWM 69


>gi|225181594|ref|ZP_03735035.1| flagellar biosynthetic protein FliQ [Dethiobacter alkaliphilus
          AHT 1]
 gi|225167702|gb|EEG76512.1| flagellar biosynthetic protein FliQ [Dethiobacter alkaliphilus
          AHT 1]
          Length = 89

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL +AR A+ T L  +APVL  ++ +G+ I+  QA TQIQE TLTFVPKIIAVF+
Sbjct: 1  MSHEFVLSVARDAILTTLFIAAPVLIISLLVGLGISVFQATTQIQEQTLTFVPKIIAVFL 60

Query: 61 TLII 64
           L++
Sbjct: 61 ALLV 64


>gi|226327731|ref|ZP_03803249.1| hypothetical protein PROPEN_01604 [Proteus penneri ATCC 35198]
 gi|225203435|gb|EEG85789.1| hypothetical protein PROPEN_01604 [Proteus penneri ATCC 35198]
          Length = 89

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +   AM   LS + P+L SA+  G++I+ LQA TQI E+TL+F+PKI+AV +
Sbjct: 1  MTPESVLALGTEAMKIALSLAGPLLLSALVTGLVISMLQAATQINEMTLSFIPKILAVLV 60

Query: 61 TLIISAPFI 69
           ++++ P++
Sbjct: 61 AILVAGPWM 69


>gi|326204609|ref|ZP_08194465.1| flagellar biosynthetic protein FliQ [Clostridium papyrosolvens
          DSM 2782]
 gi|325985176|gb|EGD46016.1| flagellar biosynthetic protein FliQ [Clostridium papyrosolvens
          DSM 2782]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M+E+ ++ IA+ A+  IL  SAP+L  +M +G++I+  QA TQIQE TLTFVPKI++V
Sbjct: 1  MDESSIINIAQEALKVILYVSAPILVISMVVGLVISIFQATTQIQEQTLTFVPKILSV 58


>gi|167630308|ref|YP_001680807.1| flagellar biosynthetic protein fliq, putative [Heliobacterium
          modesticaldum Ice1]
 gi|167593048|gb|ABZ84796.1| flagellar biosynthetic protein fliq, putative [Heliobacterium
          modesticaldum Ice1]
          Length = 91

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R A+  +L  SAP+L +++ +G++I+  QA TQIQE TLTFVPKIIAV +
Sbjct: 1  MTPELVIQLGRDALAAVLLISAPLLGASLLVGLVISVFQATTQIQEATLTFVPKIIAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +++  P++   +  +V  +L  + +
Sbjct: 61 VILLFGPWMLEAMMKYVDQMLGSLNT 86


>gi|327399032|ref|YP_004339901.1| flagellar biosynthetic protein FliQ [Hippea maritima DSM 10411]
 gi|327181661|gb|AEA33842.1| flagellar biosynthetic protein FliQ [Hippea maritima DSM 10411]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ I + AM   +  + P+L  ++  G+L++  QA+TQIQE+TLTF+PKIIA  +
Sbjct: 1  MDIATVIAIGKEAMKVTMLIAMPILIVSLIAGLLVSIFQAVTQIQEMTLTFIPKIIATAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T+I  AP++   + ++V  + S I +
Sbjct: 61 TVIFLAPWMTKLLVNYVIHLYSSIPT 86


>gi|254417849|ref|ZP_05031573.1| flagellar biosynthetic protein FliQ [Brevundimonas sp. BAL3]
 gi|196184026|gb|EDX79002.1| flagellar biosynthetic protein FliQ [Brevundimonas sp. BAL3]
          Length = 87

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+VL++ R A+W  +    PVL   + +G++I   QALTQIQE TL + PKIIA+F+
Sbjct: 1  MNGAEVLDVGRDAIWLTIQLCLPVLLVGLVVGVVIGLFQALTQIQEQTLIYAPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L++  P +G  +  F+  + +RI
Sbjct: 61 SLLLFLPLMGALLGGFMRQIAARI 84


>gi|88704276|ref|ZP_01101990.1| Bacterial export protein FliQ, family 3 [Congregibacter litoralis
          KT71]
 gi|88701327|gb|EAQ98432.1| Bacterial export protein FliQ, family 3 [Congregibacter litoralis
          KT71]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 47/69 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + + A+W  +  + P+L SA+ +G+LI   QA TQIQE+TL+F+PK++A+ +
Sbjct: 1  MGPETVLAVGQDALWLAVLLAGPLLLSALAVGLLIGIFQAATQIQEMTLSFIPKLLALVV 60

Query: 61 TLIISAPFI 69
           L ++ P++
Sbjct: 61 ALFVAGPWM 69


>gi|304414277|ref|ZP_07395645.1| type III secretion system apparatus protein [Candidatus Regiella
          insecticola LSR1]
 gi|304283491|gb|EFL91887.1| type III secretion system apparatus protein [Candidatus Regiella
          insecticola LSR1]
          Length = 89

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 57/86 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA V+++A   +W +L  S PV+  A  +G++I+  QALTQIQ+ TL F+ K++AV I
Sbjct: 1  MSEAIVVQLATQVLWIVLMLSMPVVVVASAVGLIISLFQALTQIQDQTLQFLIKLLAVSI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL++S  ++G  + ++   V  +I S
Sbjct: 61 TLLVSYHWMGSTLLNYTQQVFLQIGS 86


>gi|327441039|dbj|BAK17404.1| flagellar biosynthesis pathway, component FliQ [Solibacillus
          silvestris StLB046]
          Length = 89

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ IA  A++TIL  S P+L  A+  G++++  QA T IQE TL FVPKI+AV +
Sbjct: 1  MTQEMVIAIAENAVFTILIVSGPLLLIALISGLIVSIFQATTSIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           +I   PF+  +++ +   +L+ +
Sbjct: 61 AIIFFGPFMISKMTDYFHDILNNL 84


>gi|224370773|ref|YP_002604937.1| FliQ [Desulfobacterium autotrophicum HRM2]
 gi|223693490|gb|ACN16773.1| FliQ [Desulfobacterium autotrophicum HRM2]
          Length = 89

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E A+ A+   +  S P+L   +  G++I+  QA+T IQE+TLTFVPKIIAVF+
Sbjct: 1  MTPEFVIEFAKQAILLTIYLSMPMLGLGLAAGLIISIFQAVTSIQEMTLTFVPKIIAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+  AP++  +++SF   V+  I
Sbjct: 61 GLLFFAPWMLDEMTSFTRRVIENI 84


>gi|220915855|ref|YP_002491159.1| type III secretion protein, HrpO family [Anaeromyxobacter
          dehalogenans 2CP-1]
 gi|219953709|gb|ACL64093.1| type III secretion protein, HrpO family [Anaeromyxobacter
          dehalogenans 2CP-1]
          Length = 88

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A +L + R A+  +L  SAP L +A+ +G++   LQA TQ+QE TL  VP+++AV I
Sbjct: 1  MDPA-LLHLGREALLLVLVLSAPPLGAALLVGLVTGVLQAATQVQEQTLGVVPRLVAVVI 59

Query: 61 TLIISAPFIGGQISSF 76
          +L I+AP+IG +   F
Sbjct: 60 SLAIAAPWIGARAVRF 75


>gi|288942624|ref|YP_003444864.1| flagellar biosynthetic protein FliQ [Allochromatium vinosum DSM
          180]
 gi|288897996|gb|ADC63832.1| flagellar biosynthetic protein FliQ [Allochromatium vinosum DSM
          180]
          Length = 89

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++ + A   I+  SAP L + + +G++I+  QA TQIQE+TLTF+PK++ V  
Sbjct: 1  MTPEMVLDVGKEAGEVIILMSAPPLLAGLIIGLIISLFQAATQIQEMTLTFIPKLVGVGA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           LI + P++   ++ +VT +   I  
Sbjct: 61 ALIFAGPWMLTLVTDYVTRLYESIPG 86


>gi|311030114|ref|ZP_07708204.1| flagellar biosynthesis protein FliQ [Bacillus sp. m3-13]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 54/85 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A   ++TIL  SAP+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSPEFVISMAERGVYTILLISAPLLILALVVGLIVSIFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           L++  P++   + S+   + + I 
Sbjct: 61 GLVVFGPWMLSNMLSYALEIFNNIH 85


>gi|323700134|ref|ZP_08112046.1| flagellar biosynthetic protein FliQ [Desulfovibrio sp. ND132]
 gi|323460066|gb|EGB15931.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          ND132]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 52/78 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+   L  S P+L   M +GI I+ +QA TQIQE+TLT VPKIIA+F+
Sbjct: 1  MTPEFVVGFARQAIEMTLIISLPMLGIGMIVGIFISIIQAATQIQEMTLTMVPKIIAIFL 60

Query: 61 TLIISAPFIGGQISSFVT 78
           L+++ P+I  +++++ T
Sbjct: 61 ALLLAFPWIMDKMTAYTT 78


>gi|73539700|ref|YP_300067.1| flagellar biosynthesis protein FliQ [Ralstonia eutropha JMP134]
 gi|72123037|gb|AAZ65223.1| Flagellar biosynthesis protein FliQ [Ralstonia eutropha JMP134]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ IA  AM   L  +AP L  A+  G++++  QA TQI E+TLTF+PK++A+F 
Sbjct: 1  MTPETVMTIATHAMKMTLMLAAPPLLVALAAGLVVSLFQAATQINEMTLTFIPKLVALFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+++ P++   +  ++  VL  I +
Sbjct: 61 TLVLAGPWMINTMVDYMREVLQSIPA 86


>gi|269796381|ref|YP_003315836.1| flagellar biosynthetic protein FliQ [Sanguibacter keddieii DSM
          10542]
 gi|269098566|gb|ACZ23002.1| flagellar biosynthetic protein FliQ [Sanguibacter keddieii DSM
          10542]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ + VL+I    +       APVL +A+ +G  ++ LQ++TQIQEVTL+FVPK IAV +
Sbjct: 1  MDTSAVLDIGVQGLIIAAKLCAPVLITALVVGFAVSLLQSITQIQEVTLSFVPKAIAVSL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+IS  ++  ++ SF   +  RI
Sbjct: 61 ALLISGHWMISEMISFTHELFGRI 84


>gi|296439625|sp|P0CF98|FLIQ_CLOTE RecName: Full=Flagellar biosynthetic protein FliQ
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M+E  ++ + R A+ T L  SAP+L SA+ +G+LI+ LQA TQIQE TLTFVPK+I V
Sbjct: 1  MSENMIMGVMRDAISTGLLVSAPILISAIVVGLLISILQATTQIQEQTLTFVPKLITV 58


>gi|121533745|ref|ZP_01665572.1| flagellar biosynthetic protein FliQ [Thermosinus carboxydivorans
          Nor1]
 gi|121307736|gb|EAX48651.1| flagellar biosynthetic protein FliQ [Thermosinus carboxydivorans
          Nor1]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 46/63 (73%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          ++I R A+  ++  SAP+L   + +GI+I+  QA TQIQE TL+FVPKIIAVF+ +++  
Sbjct: 7  IQIGRDALMMVMLVSAPMLGLGLLVGIIISIFQATTQIQEQTLSFVPKIIAVFVAILLFG 66

Query: 67 PFI 69
          P++
Sbjct: 67 PWM 69


>gi|187926924|ref|YP_001893269.1| flagellar biosynthetic protein FliQ [Ralstonia pickettii 12J]
 gi|241665253|ref|YP_002983612.1| flagellar biosynthesis protein FliQ [Ralstonia pickettii 12D]
 gi|187728678|gb|ACD29842.1| flagellar biosynthetic protein FliQ [Ralstonia pickettii 12J]
 gi|240867280|gb|ACS64940.1| flagellar biosynthetic protein FliQ [Ralstonia pickettii 12D]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E +L+F+PK++AV  
Sbjct: 1  MTPEYVLDMARQAMQVAMMVGAPMLLVSLIVGLLVAVFQAATQLNEQSLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T++++ P+I   I  +   +L+ I S
Sbjct: 61 TMVLAGPWILSVIVDYTRNLLTNIPS 86


>gi|261340414|ref|ZP_05968272.1| flagellar biosynthetic protein FliQ [Enterobacter cancerogenus
          ATCC 35316]
 gi|288317506|gb|EFC56444.1| flagellar biosynthetic protein FliQ [Enterobacter cancerogenus
          ATCC 35316]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   ++ +AP+L  A+  G++I+ LQA TQI E+TL+F+PKIIAVF+
Sbjct: 1  MTPESVMMMGTEAMRVAIAVAAPLLLVALVTGLVISILQAATQINEMTLSFIPKIIAVFV 60

Query: 61 TLIISAPFI 69
           +I++ P++
Sbjct: 61 AIIVAGPWM 69


>gi|149178713|ref|ZP_01857296.1| flagellar biosynthesis protein Q [Planctomyces maris DSM 8797]
 gi|148842411|gb|EDL56791.1| flagellar biosynthesis protein Q [Planctomyces maris DSM 8797]
          Length = 88

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 58/88 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ + VL++ R  +  +L  S PV+ +A+ +G++I+  QA+TQIQ+ T++FVPKII + +
Sbjct: 1  MDTSTVLDLGREGLLIMLEVSGPVMLTAVVVGLVISIGQAVTQIQDQTISFVPKIIMMVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++ + P+I   +  + T +++ I + L
Sbjct: 61 AILYTLPWITSLMVEYSTNLITNIPTRL 88


>gi|253998479|ref|YP_003050542.1| flagellar biosynthetic protein FliQ [Methylovorus sp. SIP3-4]
 gi|313200554|ref|YP_004039212.1| flagellar biosynthetic protein fliq [Methylovorus sp. MP688]
 gi|253985158|gb|ACT50015.1| flagellar biosynthetic protein FliQ [Methylovorus sp. SIP3-4]
 gi|312439870|gb|ADQ83976.1| flagellar biosynthetic protein FliQ [Methylovorus sp. MP688]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  SAP+L   + +G+L++  QA TQI E TL+F+PK++ VF 
Sbjct: 1  MTPEGVMTLGRQAMEVTLMVSAPMLIVVLVIGLLVSIFQAATQINETTLSFIPKLVGVFA 60

Query: 61 TLIISAPFI 69
           L+I+ P++
Sbjct: 61 VLVIAGPWM 69


>gi|114797953|ref|YP_759003.1| flagellar biosynthetic protein fliQ [Hyphomonas neptunium ATCC
          15444]
 gi|114738127|gb|ABI76252.1| flagellar biosynthetic protein fliQ [Hyphomonas neptunium ATCC
          15444]
          Length = 87

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E ++ E+ RA +W       P+L   + +G +I  +QALT IQE+TLTF+PKI+AV I
Sbjct: 1  MSEGEIFEVLRAHIWGAAMMGLPILAVTLVVGFVIGLIQALTSIQEMTLTFIPKILAVII 60

Query: 61 TLIISAPFI 69
             +S  ++
Sbjct: 61 VFFLSLGYM 69


>gi|218288311|ref|ZP_03492610.1| flagellar biosynthetic protein FliQ [Alicyclobacillus
          acidocaldarius LAA1]
 gi|258511389|ref|YP_003184823.1| flagellar biosynthetic protein FliQ [Alicyclobacillus
          acidocaldarius subsp. acidocaldarius DSM 446]
 gi|218241670|gb|EED08843.1| flagellar biosynthetic protein FliQ [Alicyclobacillus
          acidocaldarius LAA1]
 gi|257478115|gb|ACV58434.1| flagellar biosynthetic protein FliQ [Alicyclobacillus
          acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 89

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +A   MW ++  +APVL   + +G++++  QA TQ+QE TL F+PKIIAV I
Sbjct: 1  MTDTYVIGLAAQVMWLVVKITAPVLLLGLAMGLVVSIFQATTQLQEQTLAFIPKIIAVVI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+   P++   +  F   +L  +
Sbjct: 61 ALLAFGPWMLQNLIDFTNSILGNL 84


>gi|329849684|ref|ZP_08264530.1| flagellar biosynthetic protein FliQ [Asticcacaulis biprosthecum
          C19]
 gi|328841595|gb|EGF91165.1| flagellar biosynthetic protein FliQ [Asticcacaulis biprosthecum
          C19]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M+ A+VL + R A+W  +    P+L   + +G+ I   QALTQIQE TL + PKII +F
Sbjct: 1  MSGAEVLGVGRDAIWLTIQLCTPILLVGLVVGVAIGLFQALTQIQEATLIYAPKIICIF 59


>gi|148240968|ref|YP_001220469.1| flagellar biosynthetic protein fliQ [Bradyrhizobium sp. BTAi1]
 gi|146411344|gb|ABQ39797.1| Flagellar biosynthetic protein fliQ [Bradyrhizobium sp. BTAi1]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+ +V+  A  A+ T++  SAP+L     +G+ ++  QALTQIQE TL   PKI A F+
Sbjct: 1  MNDLEVMSAAHDAVMTVVVISAPLLIVGTVVGVAVSLFQALTQIQEQTLIQAPKIFATFL 60

Query: 61 TLIISAPFIG 70
          T +I+ PF+ 
Sbjct: 61 TFLIALPFMA 70


>gi|283853452|ref|ZP_06370696.1| flagellar biosynthetic protein FliQ [Desulfovibrio sp. FW1012B]
 gi|283571172|gb|EFC19188.1| flagellar biosynthetic protein FliQ [Desulfovibrio sp. FW1012B]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 58/81 (71%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ ++R A+ T L  + P+L  ++ +G++I+ LQA TQIQE+TLTFVPKI+++FI L+I+
Sbjct: 6  VVALSRQAIETALFLALPMLGVSLVVGVIISVLQAATQIQEMTLTFVPKILSMFIALLIA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++  ++ +F   +L  I +
Sbjct: 66 FPWMMDKMLNFTRELLMNIPT 86


>gi|197121154|ref|YP_002133105.1| type III secretion protein, HrpO family [Anaeromyxobacter sp. K]
 gi|196171003|gb|ACG71976.1| type III secretion protein, HrpO family [Anaeromyxobacter sp. K]
          Length = 88

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 1/76 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A +L + R A+  +L  SAP L +A+ +G++   LQA TQ+QE TL  VP+++AV I
Sbjct: 1  MDPA-LLHLGREALLLVLVLSAPPLGAALLVGLVTGVLQAATQVQEQTLGVVPRLVAVVI 59

Query: 61 TLIISAPFIGGQISSF 76
           L I+AP+IG +   F
Sbjct: 60 VLAITAPWIGARAVRF 75


>gi|205373390|ref|ZP_03226194.1| flagellar biosynthesis protein FliQ [Bacillus coahuilensis m4-4]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 56/86 (65%), Gaps = 3/86 (3%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+++A   ++T L  SAP+L  A+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MNAETVIKLAEQGVYTTLIISAPLLLLALIVGLIVSIFQATTQIQEQTLAFVPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           LI   P++   +++ VT  L+  Q+
Sbjct: 61 GLIFFGPWM---LTTLVTYTLNIFQN 83


>gi|296103569|ref|YP_003613715.1| flagellar biosynthesis protein FliQ [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295058028|gb|ADF62766.1| flagellar biosynthesis protein FliQ [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   ++ +AP+L  A+  G++I+ LQA TQI E+TL+F+PKIIAVF+
Sbjct: 1  MTPESVMMMGTEAMKIAIAVAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFV 60

Query: 61 TLIISAPFI 69
           +I++ P++
Sbjct: 61 AIIVAGPWM 69


>gi|89069820|ref|ZP_01157155.1| flagellar biosynthetic protein FliQ [Oceanicola granulosus
          HTCC2516]
 gi|89044621|gb|EAR50737.1| flagellar biosynthetic protein FliQ [Oceanicola granulosus
          HTCC2516]
          Length = 88

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E+   ++ R  +W  ++ S P+L  A+  G+ +   QALT IQE+TLTFVPK+ A+  
Sbjct: 1  MSESHFYDVVRHGLWVAVAMSLPILSVALVAGLAVGLFQALTSIQEMTLTFVPKLAAIVA 60

Query: 61 TLIISAPFIGGQISSFV--TLVL 81
             ++  F+ G +++F   TLVL
Sbjct: 61 IFWVTMGFMTGTLTAFFRDTLVL 83


>gi|154686053|ref|YP_001421214.1| flagellar biosynthesis protein FliQ [Bacillus amyloliquefaciens
          FZB42]
 gi|154351904|gb|ABS73983.1| FliQ [Bacillus amyloliquefaciens FZB42]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L  S P+L  A+ +G+L++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLMISGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           LI   P++   I SF T + S + 
Sbjct: 61 GLIFFGPWMLSTILSFTTDLFSHLN 85


>gi|328958269|ref|YP_004375655.1| flagellar biosynthesis protein FliQ [Carnobacterium sp. 17-4]
 gi|328674593|gb|AEB30639.1| flagellar biosynthesis protein FliQ [Carnobacterium sp. 17-4]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL+I R A   +++ + P L  A+ +G++I+ +QA TQ+QE TL+FVPKI+AV +
Sbjct: 1  MTTVKVLDIIREAFMVMITVAGPTLIIALVIGLIISIIQATTQLQEQTLSFVPKILAVIV 60

Query: 61 TLIISAPF 68
          +LII   F
Sbjct: 61 SLIIFGNF 68


>gi|157692316|ref|YP_001486778.1| flagellar biosynthesis protein FliQ [Bacillus pumilus SAFR-032]
 gi|194014415|ref|ZP_03053032.1| flagellar biosynthetic protein FliQ [Bacillus pumilus ATCC 7061]
 gi|157681074|gb|ABV62218.1| flagellar biosynthesis protein FliQ [Bacillus pumilus SAFR-032]
 gi|194013441|gb|EDW23006.1| flagellar biosynthetic protein FliQ [Bacillus pumilus ATCC 7061]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 54/85 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  +++ +L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV I
Sbjct: 1  MSSEFVITMAERSVYVVLLVSGPLLALALIVGLIVSVFQATTQIQEQTLAFIPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           L++  P++   I SF T + S + 
Sbjct: 61 GLVVFGPWMLSTIVSFTTELFSNLD 85


>gi|326319060|ref|YP_004236732.1| flagellar biosynthetic protein FliQ [Acidovorax avenae subsp.
          avenae ATCC 19860]
 gi|323375896|gb|ADX48165.1| flagellar biosynthetic protein FliQ [Acidovorax avenae subsp.
          avenae ATCC 19860]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 3/86 (3%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + R A+  +L  S PVL + M +G+L++  QA+TQIQE TL FVPK+IA  +
Sbjct: 1  MTSQMVLTMGRDALTLLLMVSMPVLGAVMVIGLLVSIFQAVTQIQEATLAFVPKLIAAMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
             ++ P++   I+S V  +   I+S
Sbjct: 61 VFAVAGPWM---ITSLVDYIRRTIES 83


>gi|197285500|ref|YP_002151372.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|227355991|ref|ZP_03840383.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
 gi|194682987|emb|CAR43423.1| flagellar biosynthetic protein [Proteus mirabilis HI4320]
 gi|227163979|gb|EEI48881.1| flagellar biosynthetic protein [Proteus mirabilis ATCC 29906]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +   AM   LS + P+L SA+  G++I+ LQA TQI E+TL+F+PKI+AV  
Sbjct: 1  MTPESVLALGTEAMKIALSLAGPLLLSALVTGLVISMLQAATQINEMTLSFIPKILAVLA 60

Query: 61 TLIISAPFI 69
           ++++ P++
Sbjct: 61 AILVAGPWM 69


>gi|254510132|ref|ZP_05122199.1| flagellar biosynthetic protein FliQ [Rhodobacteraceae bacterium
          KLH11]
 gi|221533843|gb|EEE36831.1| flagellar biosynthetic protein FliQ [Rhodobacteraceae bacterium
          KLH11]
          Length = 90

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++E    +I R A+W  + +S P+L  A+  G+ +   QALT +QE+TLTFVPK+IA+ I
Sbjct: 2  LSEGLFYDIVRQALWVAVITSVPILAVALISGLAVGLFQALTSVQEMTLTFVPKLIAIVI 61

Query: 61 TLIISAPFIGGQISSFVT 78
             IS  F+   + +F T
Sbjct: 62 VFWISMGFMTQTLVTFFT 79


>gi|282891200|ref|ZP_06299703.1| type III secretion inner membrane protein SctS [Parachlamydia
          acanthamoebae str. Hall's coccus]
 gi|281498893|gb|EFB41209.1| type III secretion inner membrane protein SctS [Parachlamydia
          acanthamoebae str. Hall's coccus]
          Length = 92

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 50/83 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++A   +  IL  SAP +  +MF GIL+A  QA TQIQE TL+F  K+ AV +
Sbjct: 1  MHATQVIQLAYQGLLLILILSAPPILVSMFFGILVAIFQAATQIQEQTLSFTVKLCAVTL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
          TL+    ++G QI +F + +   
Sbjct: 61 TLMFLGGWLGAQIMTFASNIFQH 83


>gi|304321147|ref|YP_003854790.1| flagellar biosynthetic protein FliQ [Parvularcula bermudensis
          HTCC2503]
 gi|303300049|gb|ADM09648.1| flagellar biosynthetic protein FliQ [Parvularcula bermudensis
          HTCC2503]
          Length = 87

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 49/71 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + +A ++++ R A+ T    SAP+L +A+  G+++  LQALT +QE+TLTFVPK+ A+ +
Sbjct: 2  LTDAQIIDLTREAVMTAALMSAPLLIAALVAGLIVGLLQALTSVQELTLTFVPKVAAMLL 61

Query: 61 TLIISAPFIGG 71
             +++ F+ G
Sbjct: 62 VFALTSSFMVG 72


>gi|153953790|ref|YP_001394555.1| hypothetical protein CKL_1165 [Clostridium kluyveri DSM 555]
 gi|146346671|gb|EDK33207.1| FliQ [Clostridium kluyveri DSM 555]
          Length = 89

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IAV I
Sbjct: 1  MSENMVMGIIKDAIQTGLLISAPILIISILVGLIISIFQATTQIQEQTLTFVPKLIAVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            +++  ++  QI SF   + + I
Sbjct: 61 IGLLTGSWMLHQIVSFTERIFTYI 84


>gi|219854406|ref|YP_002471528.1| hypothetical protein CKR_1063 [Clostridium kluyveri NBRC 12016]
 gi|219568130|dbj|BAH06114.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 92

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IAV I
Sbjct: 4  MSENMVMGIIKDAIQTGLLISAPILIISILVGLIISIFQATTQIQEQTLTFVPKLIAVAI 63

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            +++  ++  QI SF   + + I
Sbjct: 64 IGLLTGSWMLHQIVSFTERIFTYI 87


>gi|297620336|ref|YP_003708473.1| type III secretion inner membrane protein SctS [Waddlia
          chondrophila WSU 86-1044]
 gi|297375637|gb|ADI37467.1| type III secretion inner membrane protein SctS [Waddlia
          chondrophila WSU 86-1044]
          Length = 92

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+++A   M  IL  SAP +  +MF G+++A  QA TQIQE TL+F  K++AV +
Sbjct: 1  MFQTQVVQLAYQGMLLILILSAPPILISMFFGLMVAIFQAATQIQEQTLSFTVKLVAVTL 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+    ++G QI SF
Sbjct: 61 TLMFLGGWLGAQIMSF 76


>gi|312879604|ref|ZP_07739404.1| flagellar biosynthetic protein FliQ [Aminomonas paucivorans DSM
          12260]
 gi|310782895|gb|EFQ23293.1| flagellar biosynthetic protein FliQ [Aminomonas paucivorans DSM
          12260]
          Length = 89

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
            AMW  L +S P+L  AM +G++I  LQ  T IQE TL F+PKI+AV + +I+  P++ 
Sbjct: 11 HQAMWVTLFASLPLLLVAMVVGLIIGILQTATSIQEQTLVFIPKIVAVILAMILLGPWMC 70

Query: 71 GQISSFVTLVLSRIQ 85
            +  + T +   + 
Sbjct: 71 RLVGDYATFLFESLH 85


>gi|308273530|emb|CBX30132.1| Flagellar biosynthetic protein fliQ [uncultured Desulfobacterium
          sp.]
          Length = 89

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 53/76 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A+ A+ T +  S PVL  A+ +G++I+  QA+TQI E+TLTFVPKI+A+F+
Sbjct: 1  MSPEFVINLAQEAIKTTILVSMPVLLIALVVGLVISIFQAVTQINEMTLTFVPKILAIFL 60

Query: 61 TLIISAPFIGGQISSF 76
           LI+   ++   I++F
Sbjct: 61 GLILFGSWMLEHIATF 76


>gi|126653732|ref|ZP_01725650.1| flagellar biosynthesis protein Q [Bacillus sp. B14905]
 gi|126589696|gb|EAZ83832.1| flagellar biosynthesis protein Q [Bacillus sp. B14905]
          Length = 89

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  A+  IL +S P+L  A+  G+ ++  QA T IQE TL FVPKIIAVF+
Sbjct: 1  MTGELVISVAERAIMIILLTSGPLLLVALITGLAVSIFQATTSIQEQTLAFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSF 76
           ++   P++  Q++S+
Sbjct: 61 AIVFFGPWMLSQVTSY 76


>gi|16078699|ref|NP_389518.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221309514|ref|ZP_03591361.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221313838|ref|ZP_03595643.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. NCIB 3610]
 gi|221318761|ref|ZP_03600055.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. JH642]
 gi|221323033|ref|ZP_03604327.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. SMY]
 gi|296330851|ref|ZP_06873326.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305674369|ref|YP_003866041.1| flagellar export machinery protein [Bacillus subtilis subsp.
          spizizenii str. W23]
 gi|321315403|ref|YP_004207690.1| flagellar biosynthesis protein FliQ [Bacillus subtilis BSn5]
 gi|544316|sp|P35535|FLIQ_BACSU RecName: Full=Flagellar biosynthetic protein FliQ
 gi|142932|gb|AAA22454.1| flagellar protein [Bacillus subtilis]
 gi|2634008|emb|CAB13509.1| component of the flagellar export machinery [Bacillus subtilis
          subsp. subtilis str. 168]
 gi|296151856|gb|EFG92730.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305412613|gb|ADM37732.1| component of the flagellar export machinery [Bacillus subtilis
          subsp. spizizenii str. W23]
 gi|320021677|gb|ADV96663.1| flagellar biosynthesis protein FliQ [Bacillus subtilis BSn5]
          Length = 89

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 52/85 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           LI   P++   I SF T + S + 
Sbjct: 61 ALIFFGPWMLSTILSFTTELFSNLN 85


>gi|212639550|ref|YP_002316070.1| flagellar biosynthesis protein FliQ [Anoxybacillus flavithermus
          WK1]
 gi|212561030|gb|ACJ34085.1| Flagellar biosynthesis pathway, component FliQ [Anoxybacillus
          flavithermus WK1]
          Length = 92

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++A   ++ +L    P++  A+ +G+LI+ LQA TQIQE TL FVPKI+AV +
Sbjct: 4  MSPDFVIQVAERGVYMVLVVCGPLMLLALAVGLLISILQATTQIQEQTLAFVPKIVAVLL 63

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+   P++  ++ S+   + S +
Sbjct: 64 GLVFFGPWMLSRMVSYAYNIFSNL 87


>gi|92114089|ref|YP_574017.1| flagellar biosynthetic protein FliQ [Chromohalobacter salexigens
          DSM 3043]
 gi|91797179|gb|ABE59318.1| flagellar biosynthetic protein FliQ [Chromohalobacter salexigens
          DSM 3043]
          Length = 89

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A   M   L  + P+L +A+ +G+L++  QA TQI E+TLTF+PKI+ VF 
Sbjct: 1  MTPEMVMGLAYQGMKVTLMLAGPLLMTALLIGLLVSLFQAATQINEMTLTFIPKILGVFG 60

Query: 61 TLIISAPFI 69
           L+++ P++
Sbjct: 61 ALVVAGPWL 69


>gi|146278637|ref|YP_001168796.1| export protein FliQ [Rhodobacter sphaeroides ATCC 17025]
 gi|145556878|gb|ABP71491.1| export protein FliQ, family 3 [Rhodobacter sphaeroides ATCC
          17025]
          Length = 88

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA + +  R  +W  +  SAP+L  A+ +G+ I  LQALT +QE+TLTFVPK+ A+ +
Sbjct: 1  MSEAALYDALRQGLWVAVLISAPLLTVALVVGVGIGILQALTSVQEMTLTFVPKVGAMLL 60

Query: 61 TLIISAPFIGGQ-ISSFVTLVLSRIQSS 87
             +S  F+    ++ FV  ++ RI+  
Sbjct: 61 VFWVSMSFMTTTLVAFFVEGIIPRIEGG 88


>gi|149194202|ref|ZP_01871300.1| Flagellar biosynthesis protein FliQ [Caminibacter mediatlanticus
          TB-2]
 gi|149136155|gb|EDM24633.1| Flagellar biosynthesis protein FliQ [Caminibacter mediatlanticus
          TB-2]
          Length = 88

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          +++++ +A A +   L  S P L  +M +G+LI+  QA TQI E+TL+FVPKIIA+ I L
Sbjct: 2  QSEIISLAVATLKLALFLSLPALLVSMIVGLLISIFQATTQINEMTLSFVPKIIAIAIVL 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQSSL 88
          I + P++  ++  F   V S I + L
Sbjct: 62 IFTLPWMMNEMIDFTKYVFSLIPTFL 87


>gi|302389677|ref|YP_003825498.1| flagellar biosynthetic protein FliQ [Thermosediminibacter oceani
          DSM 16646]
 gi|302200305|gb|ADL07875.1| flagellar biosynthetic protein FliQ [Thermosediminibacter oceani
          DSM 16646]
          Length = 89

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +AR A+  ++  SAP+L   M +G+LI+  QA TQIQE +LTFVPKI+ V +
Sbjct: 1  MTQETVIYLAREALSMVILVSAPMLGIGMLVGLLISIFQATTQIQEQSLTFVPKIVVVMM 60

Query: 61 TLIISAPFIGGQISSF 76
           ++I  P++   + +F
Sbjct: 61 AILIFGPWMLNLMVNF 76


>gi|289548902|ref|YP_003473890.1| flagellar biosynthetic protein FliQ [Thermocrinis albus DSM
          14484]
 gi|289182519|gb|ADC89763.1| flagellar biosynthetic protein FliQ [Thermocrinis albus DSM
          14484]
          Length = 85

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 49/70 (70%), Gaps = 4/70 (5%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL + + A+  +L  SAPVL     +G+L++ LQA TQIQE+TL+++PKI+A +IT++  
Sbjct: 2  VLTVGQRALELMLLLSAPVLLVTFLVGLLVSLLQAATQIQEMTLSYIPKILAAYITVL-- 59

Query: 66 APFIGGQISS 75
            F+GG + S
Sbjct: 60 --FLGGWMMS 67


>gi|168334562|ref|ZP_02692718.1| flagellar biosynthetic protein FliQ [Epulopiscium sp. 'N.t.
          morphotype B']
          Length = 88

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 53/81 (65%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E  ++++ R  +  ++  ++P+L  A+ +G++++  Q +T IQE TL F+PKI+AVF  +
Sbjct: 2  EGQIIDVMRETIMLLIKVASPILLVALSVGLIVSIFQTVTSIQEQTLAFIPKILAVFAAI 61

Query: 63 IISAPFIGGQISSFVTLVLSR 83
          I   P++   +S FVT ++S+
Sbjct: 62 IFFGPWMLTMLSQFVTDIISK 82


>gi|319944173|ref|ZP_08018449.1| flagellar biosynthesis protein FliQ [Lautropia mirabilis ATCC
          51599]
 gi|319742468|gb|EFV94879.1| flagellar biosynthesis protein FliQ [Lautropia mirabilis ATCC
          51599]
          Length = 94

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 53/78 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL I R A+ T++++++P+L   +  G+LI+ LQALTQI E TL+FVPK++   +
Sbjct: 1  MTPETVLTIGRQALETLMTTASPILLVILVTGLLISILQALTQINEATLSFVPKLVLSSL 60

Query: 61 TLIISAPFIGGQISSFVT 78
           L+++ P++   ++ F++
Sbjct: 61 VLVLAGPWMLSNLTDFIS 78


>gi|149200774|ref|ZP_01877749.1| Flagellar protein FliQ [Roseovarius sp. TM1035]
 gi|149145107|gb|EDM33133.1| Flagellar protein FliQ [Roseovarius sp. TM1035]
          Length = 88

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 48/80 (60%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E  R A W IL ++ PVL  A+ +G++I  LQA T I E TL+FVPK+  V +T+ + +
Sbjct: 7  IEHLRMAYWNILLTAGPVLLVALAVGLVIGILQAATSINEATLSFVPKMAIVIVTMALMS 66

Query: 67 PFIGGQISSFVTLVLSRIQS 86
           F+   ++ + T V   I +
Sbjct: 67 GFMLSTMTDYFTHVFDAIAT 86


>gi|308173599|ref|YP_003920304.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606463|emb|CBI42834.1| component of the flagellar export machinery [Bacillus
          amyloliquefaciens DSM 7]
 gi|328553469|gb|AEB23961.1| flagellar biosynthesis protein FliQ [Bacillus amyloliquefaciens
          TA208]
          Length = 89

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L    P+L  A+ +G+L++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLMICGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           LI   P++   I SF T + S + 
Sbjct: 61 GLIFFGPWMLSTILSFTTDLFSHLN 85


>gi|229827383|ref|ZP_04453452.1| hypothetical protein GCWU000182_02771 [Abiotrophia defectiva ATCC
          49176]
 gi|229788321|gb|EEP24435.1| hypothetical protein GCWU000182_02771 [Abiotrophia defectiva ATCC
          49176]
          Length = 102

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 54/83 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V++I+R  +  IL  SAP+L +++ +G++I+ +Q +T IQE TLTFVPK+I   +
Sbjct: 1  MSVDRVIDISRETVMLILKLSAPMLLASLVVGLIISLIQTITSIQEQTLTFVPKLIVTML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           L+++  ++   +S F T + S 
Sbjct: 61 MLVLTGGWMMTSLSEFATELFSN 83


>gi|311068158|ref|YP_003973081.1| flagellar biosynthesis protein FliQ [Bacillus atrophaeus 1942]
 gi|310868675|gb|ADP32150.1| flagellar biosynthesis protein FliQ [Bacillus atrophaeus 1942]
          Length = 89

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 52/85 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLLISGPLLAIALLVGLVVSIFQATTQIQEQTLAFIPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           LI   P++   I SF T + S + 
Sbjct: 61 GLIFFGPWMLSTILSFTTELFSNLN 85


>gi|291280090|ref|YP_003496925.1| flagellar biosynthetic protein FliQ [Deferribacter desulfuricans
          SSM1]
 gi|290754792|dbj|BAI81169.1| flagellar biosynthetic protein FliQ [Deferribacter desulfuricans
          SSM1]
          Length = 91

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+EI    +   +  +AP+L   + +G+LI+  QA+TQIQE+TLTF+PKI+AV +
Sbjct: 1  MTADFVIEITTKTLELTMIIAAPMLLFGLIVGLLISIFQAVTQIQEMTLTFIPKIVAVVV 60

Query: 61 TLIISAPFIGGQISSF 76
           LII  P+I  ++ +F
Sbjct: 61 ALIIFFPWILDKLVAF 76


>gi|331005443|ref|ZP_08328822.1| Flagellar biosynthesis protein fliQ [gamma proteobacterium
          IMCC1989]
 gi|330420719|gb|EGG95006.1| Flagellar biosynthesis protein fliQ [gamma proteobacterium
          IMCC1989]
          Length = 88

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 49/70 (70%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E++   +WT +   APVL  +M +G++++ +Q +TQIQE++LTF+PK++A  I L++  
Sbjct: 7  IELSNELLWTAILMCAPVLGISMLVGLIVSMVQVVTQIQEMSLTFIPKMLAAAIALVVFG 66

Query: 67 PFIGGQISSF 76
          P++ G +  F
Sbjct: 67 PWMLGVLIEF 76


>gi|152979930|ref|YP_001353120.1| FliQ component of flagellar biosynthesis pathway
          [Janthinobacterium sp. Marseille]
 gi|151280007|gb|ABR88417.1| FliQ component of flagellar biosynthesis pathway
          [Janthinobacterium sp. Marseille]
          Length = 98

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R A+   L  +AP+L  A+ +G++++  QA TQI E TL+F+PK+I +F+
Sbjct: 10 MTPETVMTMGRHAIEVTLMVAAPMLLVALGIGLIVSIFQAATQINETTLSFIPKLIGIFV 69

Query: 61 TLIISAPFI 69
           L+++ P++
Sbjct: 70 ALVVAGPWM 78


>gi|71906401|ref|YP_283988.1| flagellar biosynthesis protein FliQ [Dechloromonas aromatica RCB]
 gi|71846022|gb|AAZ45518.1| Flagellar biosynthesis protein FliQ [Dechloromonas aromatica RCB]
          Length = 83

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 46/63 (73%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +EI R A+   L  SAP+L +A+ +G++++  QA TQ+ E TL FVPK++A+F+ L+++ 
Sbjct: 1  MEIGRQAIEVTLLISAPMLITALVVGLIVSIFQAATQLNESTLQFVPKLVAMFVVLLLTG 60

Query: 67 PFI 69
          P++
Sbjct: 61 PWM 63


>gi|52080239|ref|YP_079030.1| flagellar biosynthesis protein FliQ [Bacillus licheniformis ATCC
          14580]
 gi|52785616|ref|YP_091445.1| flagellar biosynthesis protein FliQ [Bacillus licheniformis ATCC
          14580]
 gi|319645982|ref|ZP_08000212.1| FliQ protein [Bacillus sp. BT1B_CT2]
 gi|52003450|gb|AAU23392.1| flagellar protein [Bacillus licheniformis ATCC 14580]
 gi|52348118|gb|AAU40752.1| FliQ [Bacillus licheniformis ATCC 14580]
 gi|317391732|gb|EFV72529.1| FliQ protein [Bacillus sp. BT1B_CT2]
          Length = 89

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 53/85 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MNSEFVISMAERAVYVTLLISGPLLALALLVGLIVSVFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           L++  P++   I SF T + S + 
Sbjct: 61 GLVVFGPWMLSTILSFATELFSNLN 85


>gi|111115099|ref|YP_709717.1| flagellar biosynthesis protein [Borrelia afzelii PKo]
 gi|216264085|ref|ZP_03436079.1| flagellar biosynthetic protein FliQ [Borrelia afzelii ACA-1]
 gi|110890373|gb|ABH01541.1| flagellar biosynthesis protein [Borrelia afzelii PKo]
 gi|215980129|gb|EEC20951.1| flagellar biosynthetic protein FliQ [Borrelia afzelii ACA-1]
          Length = 87

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLTVVIFGPWILNKLMQFTYMI 80

Query: 81 LSRIQS 86
           +++Q+
Sbjct: 81 FNQLQN 86


>gi|119714989|ref|YP_921954.1| export protein FliQ [Nocardioides sp. JS614]
 gi|119535650|gb|ABL80267.1| export protein FliQ, family 3 [Nocardioides sp. JS614]
          Length = 89

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++  ++EIA   +   L  SAP+L +++ +G  I+  Q+LTQIQE TL FVPK+I V I
Sbjct: 1  MSDTAIIEIALRTLVVALKLSAPILVTSLVIGFAISLFQSLTQIQEATLAFVPKLIGVGI 60

Query: 61 TLIISAPFIGGQISSF 76
           L++S  ++   + SF
Sbjct: 61 ALLLSGNWMMHTLVSF 76


>gi|313673291|ref|YP_004051402.1| flagellar biosynthetic protein fliq [Calditerrivibrio
          nitroreducens DSM 19672]
 gi|312940047|gb|ADR19239.1| flagellar biosynthetic protein FliQ [Calditerrivibrio
          nitroreducens DSM 19672]
          Length = 90

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VL +   A+   L  +AP+L   +  G++++  QA+TQIQE+TL+F+PKI+AV I
Sbjct: 1  MNPDLVLSLTTKALEVALMLAAPMLLFGLIAGLVVSIFQAVTQIQEMTLSFIPKILAVVI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+I  P++   + SF   + + I S
Sbjct: 61 ALVIFFPWMMDTMISFTINLFTNINS 86


>gi|20807872|ref|NP_623043.1| flagellar biosynthesis protein FliQ [Thermoanaerobacter
          tengcongensis MB4]
 gi|20516436|gb|AAM24647.1| Flagellar biosynthesis/type III secretory pathway protein
          [Thermoanaerobacter tengcongensis MB4]
          Length = 89

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ +  +++ R A+   L+ + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+AV +
Sbjct: 1  MSSSMAVDLGREALSVALTVATPMLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAVLL 60

Query: 61 TLIISAPFI 69
          +LI+  P++
Sbjct: 61 SLILFGPWM 69


>gi|91776319|ref|YP_546075.1| flagellar biosynthetic protein FliQ [Methylobacillus flagellatus
          KT]
 gi|91710306|gb|ABE50234.1| flagellar biosynthetic protein FliQ [Methylobacillus flagellatus
          KT]
          Length = 89

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ + R A   +L  + P+L   + +G+L++  QA TQI E TLTF+PK++ VF 
Sbjct: 1  MSPEHVMTMGRQAAEILLMVAGPMLLVVLAIGLLVSIFQAATQINEATLTFIPKLLGVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL+I+ P++    + ++  V + I
Sbjct: 61 TLLIAGPWMLSVFTDYLRAVFTSI 84


>gi|288958050|ref|YP_003448391.1| flagellar biosynthetic protein [Azospirillum sp. B510]
 gi|288910358|dbj|BAI71847.1| flagellar biosynthetic protein [Azospirillum sp. B510]
          Length = 119

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE +V+EI R ++ T++    P+L   M +G +I+  QA+TQI E TL  VPK++ VF 
Sbjct: 1  MNETEVIEICRTSIVTLVIVCGPILVIMMAVGTVISIFQAVTQISEQTLAMVPKVLLVFG 60

Query: 61 TLIISAPFIGGQISSF 76
            I+  PF+  +++ F
Sbjct: 61 LSILLMPFMLSKLTEF 76


>gi|325109028|ref|YP_004270096.1| flagellar biosynthetic protein FliQ [Planctomyces brasiliensis
          DSM 5305]
 gi|324969296|gb|ADY60074.1| flagellar biosynthetic protein FliQ [Planctomyces brasiliensis
          DSM 5305]
          Length = 88

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 47/69 (68%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          EI R A+   +   APV+  AM +G++I+  QA+TQ+Q+ TL+FVPKI+ +  T+++  P
Sbjct: 8  EITRQAILLAVIVGAPVMLVAMLVGLVISLFQAVTQLQDQTLSFVPKILLMVGTVVVLLP 67

Query: 68 FIGGQISSF 76
          ++ GQI  +
Sbjct: 68 WLIGQIVDY 76


>gi|114566401|ref|YP_753555.1| hypothetical protein Swol_0866 [Syntrophomonas wolfei subsp.
          wolfei str. Goettingen]
 gi|114337336|gb|ABI68184.1| conserved hypothetical protein [Syntrophomonas wolfei subsp.
          wolfei str. Goettingen]
          Length = 90

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  +L IA  A+  +L  SAPVL +A+  G+LI+ LQA TQ+QE+TLTFVPKII VF+
Sbjct: 1  MYENIILGIANEALIVVLLLSAPVLGAALITGLLISILQATTQLQEMTLTFVPKIIVVFL 60

Query: 61 TLIISAPFIGGQISSF 76
           +II  P++   I++F
Sbjct: 61 VIIIFGPWMLNVITAF 76


>gi|310816829|ref|YP_003964793.1| flagellar biosynthetic protein FliQ [Ketogulonicigenium vulgare
          Y25]
 gi|308755564|gb|ADO43493.1| flagellar biosynthetic protein FliQ [Ketogulonicigenium vulgare
          Y25]
          Length = 89

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 49/81 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++EA + +  RA +W     S P+L  A+  G+++   QALT +QE+TLTFVPK+ A+ +
Sbjct: 2  LSEAQIYDTLRAGLWAAFLMSTPILVVALVAGLIVGLFQALTSVQEMTLTFVPKLAAIVV 61

Query: 61 TLIISAPFIGGQISSFVTLVL 81
             ++  F+   ++++   VL
Sbjct: 62 VFWLTMGFMTRTLTAYFHGVL 82


>gi|134095088|ref|YP_001100163.1| flagellar biosynthetic protein fliQ [Herminiimonas
          arsenicoxydans]
 gi|133738991|emb|CAL62039.1| Flagellar biosynthetic protein FliQ [Herminiimonas
          arsenicoxydans]
          Length = 89

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R A+   L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++ +F+
Sbjct: 1  MTPETVMTMGRHAIEITLMVAAPMLLVALGIGLIVSIFQAATQINETTLSFIPKLVGIFL 60

Query: 61 TLIISAPFI 69
           LII+ P++
Sbjct: 61 ALIIAGPWM 69


>gi|269792927|ref|YP_003317831.1| export protein FliQ family 3 [Thermanaerovibrio acidaminovorans
          DSM 6589]
 gi|269100562|gb|ACZ19549.1| export protein FliQ family 3 [Thermanaerovibrio acidaminovorans
          DSM 6589]
          Length = 89

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V +  R A+W  + SS P+L  AM +G++I  LQ  T IQE TL F+PKI+A+  
Sbjct: 1  MESLSVADAFRQALWISMISSMPILVIAMVVGLVIGILQTATSIQEQTLLFIPKILAIIG 60

Query: 61 TLIISAPFIG 70
           L+I  P++G
Sbjct: 61 GLLILGPWMG 70


>gi|89895723|ref|YP_519210.1| hypothetical protein DSY2977 [Desulfitobacterium hafniense Y51]
 gi|89335171|dbj|BAE84766.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 90

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 55/78 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN++DVL +A+ A+ T L    PVL  ++ +G+L++  QA+TQIQE TLTF+PKI+A+ +
Sbjct: 1  MNQSDVLYLAKEALMTALMIGGPVLGVSLLVGLLVSIFQAMTQIQEQTLTFIPKILAIAL 60

Query: 61 TLIISAPFIGGQISSFVT 78
           +++  P++   I+ F T
Sbjct: 61 VMLLLGPWMLNVITGFTT 78


>gi|68164509|gb|AAY87238.1| predicted flagellar biosynthesis protein [uncultured bacterium
          BAC17H8]
          Length = 88

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +E  R A W I+ ++ P+L  A+ +G+LI  +QA T I E+TL+FVPK++ V +
Sbjct: 1  MDFDSNVEFLRIAFWQIIMAAGPLLAVALAVGLLIGIIQAATSINEMTLSFVPKLVVVIL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T  + + F+  Q+S +   +  +I
Sbjct: 61 TFGLMSSFMLAQLSEYFQFIFDQI 84


>gi|116328497|ref|YP_798217.1| endoflagellar biosynthesis pathway protein [Leptospira
          borgpetersenii serovar Hardjo-bovis L550]
 gi|116331227|ref|YP_800945.1| endoflagellar biosynthesis pathway protein [Leptospira
          borgpetersenii serovar Hardjo-bovis JB197]
 gi|116121241|gb|ABJ79284.1| Endoflagellar biosynthesis pathway protein [Leptospira
          borgpetersenii serovar Hardjo-bovis L550]
 gi|116124916|gb|ABJ76187.1| Endoflagellar biosynthesis pathway protein [Leptospira
          borgpetersenii serovar Hardjo-bovis JB197]
          Length = 87

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 43/64 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E D + + R +++  L  S+P+L +A+ +G++I  LQ  T IQE T+ FVPK+ AVF+
Sbjct: 1  MTELDAMTLIRDSLYITLKISSPILLTALVVGLIIGILQTTTSIQEPTIAFVPKLAAVFV 60

Query: 61 TLII 64
           ++I
Sbjct: 61 VIVI 64


>gi|322836571|ref|YP_004210067.1| type III secretion apparatus protein YscS [Yersinia pestis Java
          9]
 gi|321161345|gb|ADW67051.1| type III secretion apparatus protein YscS [Yersinia pestis Java
          9]
          Length = 67

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 46/64 (71%), Gaps = 1/64 (1%)

Query: 23 PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          PVL +A+ +G L++ +QALTQIQE TL FV K+IAV +TL  +A ++G ++ SF  + + 
Sbjct: 3  PVLVAAV-VGTLVSLVQALTQIQEQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMM 61

Query: 83 RIQS 86
          +IQ 
Sbjct: 62 KIQG 65


>gi|258404718|ref|YP_003197460.1| flagellar biosynthetic protein FliQ [Desulfohalobium retbaense
          DSM 5692]
 gi|257796945|gb|ACV67882.1| flagellar biosynthetic protein FliQ [Desulfohalobium retbaense
          DSM 5692]
          Length = 91

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 46/64 (71%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ + R ++ TIL  ++P++ SA+ +G+LI+  QA TQIQE TL+F PK+ AV + L I 
Sbjct: 6  VVALTRQSVETILLVTSPMMISAVVVGLLISIFQAATQIQEQTLSFAPKVAAVMVALTIF 65

Query: 66 APFI 69
          AP+I
Sbjct: 66 APWI 69


>gi|126730136|ref|ZP_01745948.1| flagellar biosynthetic protein FliQ [Sagittula stellata E-37]
 gi|126709516|gb|EBA08570.1| flagellar biosynthetic protein FliQ [Sagittula stellata E-37]
          Length = 89

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          +NE    +  R  +W    +S P+L +A+  G+ I  LQALT IQE+TLTFVPK++A+  
Sbjct: 2  LNETVFFDTLRMGLWVAAVTSVPILAAALIAGVGIGLLQALTSIQEMTLTFVPKLLAIVA 61

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   +  F
Sbjct: 62 VFWMSMSFMTNTLVGF 77


>gi|261407967|ref|YP_003244208.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. Y412MC10]
 gi|329929295|ref|ZP_08283048.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. HGF5]
 gi|261284430|gb|ACX66401.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. Y412MC10]
 gi|328936664|gb|EGG33107.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. HGF5]
          Length = 89

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++ +L  SAP+L  A+ +G++I+  QA TQIQE TL FVPKII V +
Sbjct: 1  MSAEFIIGLAGQAVYIVLQVSAPMLVLALVVGLIISIFQATTQIQEQTLAFVPKIIIVLV 60

Query: 61 TLIISAPFI 69
           L++  P+I
Sbjct: 61 ALLLFGPWI 69


>gi|297569686|ref|YP_003691030.1| flagellar biosynthetic protein FliQ [Desulfurivibrio alkaliphilus
          AHT2]
 gi|296925601|gb|ADH86411.1| flagellar biosynthetic protein FliQ [Desulfurivibrio alkaliphilus
          AHT2]
          Length = 89

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 44/63 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ ADV  + + A+   L+ + P+L   M +G+ IA  QA+TQIQE+TLTFVPKI AV +
Sbjct: 1  MSPADVAVLIQQAVKVTLTLAGPILGMGMAVGLTIALFQAVTQIQEMTLTFVPKIFAVLL 60

Query: 61 TLI 63
          T++
Sbjct: 61 TVL 63


>gi|260431750|ref|ZP_05785721.1| flagellar biosynthetic protein FliQ [Silicibacter
          lacuscaerulensis ITI-1157]
 gi|260415578|gb|EEX08837.1| flagellar biosynthetic protein FliQ [Silicibacter
          lacuscaerulensis ITI-1157]
          Length = 90

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + E    +I R A+W  + +S P+L  A+  G+ +   QALT IQE+TLTFVPK++ + I
Sbjct: 2  LGEGLYFDIVRQALWVAVITSVPILAVALVTGLAVGLFQALTSIQEMTLTFVPKLVCIVI 61

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   + +F
Sbjct: 62 AFWMSMGFMTQALVTF 77


>gi|125973003|ref|YP_001036913.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          ATCC 27405]
 gi|256004800|ref|ZP_05429775.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum DSM
          2360]
 gi|281417214|ref|ZP_06248234.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          JW20]
 gi|125713228|gb|ABN51720.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          ATCC 27405]
 gi|255991250|gb|EEU01357.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum DSM
          2360]
 gi|281408616|gb|EFB38874.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          JW20]
 gi|316940761|gb|ADU74795.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum DSM
          1313]
          Length = 89

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+E+A+ A+ T+L  +AP+L  ++ +G+ ++  QA TQIQE TLTF+PKI++V  
Sbjct: 1  MEQGLVMELAQKAIMTVLYVAAPMLGLSLLVGLAVSIFQATTQIQEQTLTFIPKILSVLG 60

Query: 61 TLIISAPFI 69
           + I  P++
Sbjct: 61 AIAIFGPWM 69


>gi|315648122|ref|ZP_07901223.1| flagellar biosynthetic protein FliQ [Paenibacillus vortex V453]
 gi|315276768|gb|EFU40111.1| flagellar biosynthetic protein FliQ [Paenibacillus vortex V453]
          Length = 89

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++ +L  SAP++  A+ +G++I+  QA TQIQE TL FVPKI+ V +
Sbjct: 1  MSSEFIIGLAGQAVYIVLQVSAPMMVLALVVGLIISIFQATTQIQEQTLAFVPKIVIVLV 60

Query: 61 TLIISAPFI 69
          +L++  P+I
Sbjct: 61 SLLLFGPWI 69


>gi|251789177|ref|YP_003003898.1| flagellar biosynthesis protein FliQ [Dickeya zeae Ech1591]
 gi|247537798|gb|ACT06419.1| flagellar biosynthetic protein FliQ [Dickeya zeae Ech1591]
          Length = 89

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P L +A+  G++I+ LQA TQI E+TL+F+PK++ VF 
Sbjct: 1  MTPESVMALGYEAMKIALMLAGPPLIAALVSGLIISLLQAATQINEMTLSFIPKVLTVFF 60

Query: 61 TLIISAPFI 69
          TL+++ P++
Sbjct: 61 TLVVAGPWM 69


>gi|255523690|ref|ZP_05390656.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
 gi|296186694|ref|ZP_06855096.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
 gi|255512559|gb|EET88833.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
 gi|296048731|gb|EFG88163.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
          Length = 89

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IA+ +
Sbjct: 1  MSENMVIGIIKDAIQTGLIVSAPILIISILVGLIISIFQATTQIQEQTLTFVPKLIAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            +++  ++  Q+ +F   + + I
Sbjct: 61 VGLLTGSWMLHQLVNFTERIFTYI 84


>gi|224534382|ref|ZP_03674960.1| flagellar biosynthetic protein FliQ [Borrelia spielmanii A14S]
 gi|224514484|gb|EEF84800.1| flagellar biosynthetic protein FliQ [Borrelia spielmanii A14S]
          Length = 87

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S+P+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SSPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLTVVIFGPWILNKLMQFTYMI 80

Query: 81 LSRIQS 86
           +++Q+
Sbjct: 81 FNQLQN 86


>gi|299534770|ref|ZP_07048100.1| flagellar biosynthetic protein [Lysinibacillus fusiformis ZC1]
 gi|298729858|gb|EFI70403.1| flagellar biosynthetic protein [Lysinibacillus fusiformis ZC1]
          Length = 89

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ IA  A+  IL +S P+L  A+  G+ ++  QA T IQE TL FVPKIIAV +
Sbjct: 1  MTGELVISIAERAIMIILLTSGPLLLVALISGLAVSIFQATTSIQEQTLAFVPKIIAVLV 60

Query: 61 TLIISAPFIGGQISSF 76
           ++   P++  Q++S+
Sbjct: 61 AIVFFGPWMLSQVTSY 76


>gi|163789634|ref|ZP_02184072.1| flagellar biosynthesis protein [Carnobacterium sp. AT7]
 gi|159875166|gb|EDP69232.1| flagellar biosynthesis protein [Carnobacterium sp. AT7]
          Length = 87

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL+I R A   +++ + P L  A+ +G++I+  QA TQ+QE TL+FVPKI+AV +
Sbjct: 1  MTIVQVLDIIREAFMVMIAVAGPTLVIALVVGLIISIFQATTQLQEQTLSFVPKILAVIV 60

Query: 61 TLIISAPFIGGQISSF 76
          +LI+   F+   + +F
Sbjct: 61 SLIVFGNFMLNGLITF 76


>gi|6708105|gb|AAF25802.1|AF172245_4 BscS [Bordetella bronchiseptica]
          Length = 88

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++     A++ +L  S P +  A  +G L + LQALTQ+QE TL+F  K+IAVF 
Sbjct: 1  MQTQDLVSFMTQALYLVLWLSLPPIAVAAIVGTLFSLLQALTQVQEQTLSFAVKLIAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          TL+++A +I  +I +F   VL 
Sbjct: 61 TLMLAARWISAEIYNFTIAVLD 82


>gi|291484189|dbj|BAI85264.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          natto BEST195]
          Length = 81

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV + LI   P+
Sbjct: 1  MAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLLALIFFGPW 60

Query: 69 IGGQISSFVTLVLSRIQ 85
          +   I SF T + S + 
Sbjct: 61 MLSTILSFTTELFSNLN 77


>gi|329889295|ref|ZP_08267638.1| putative translocation protein y4yM [Brevundimonas diminuta ATCC
          11568]
 gi|328844596|gb|EGF94160.1| putative translocation protein y4yM [Brevundimonas diminuta ATCC
          11568]
          Length = 90

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A  +E+   A+W +L  SAP + +A  +G+++A +Q+ TQ+QE TL +  K  A+ +
Sbjct: 1  MMNAQAIELVNQALWLVLFLSAPPIIAASIVGLIVAVIQSATQLQEQTLQYTAKFFAIVL 60

Query: 61 TLIISAPFIGGQISSF 76
          TL  +A  IGG +  F
Sbjct: 61 TLFATAALIGGSLYQF 76


>gi|307131600|ref|YP_003883616.1| flagellar biosynthesis protein fliQ [Dickeya dadantii 3937]
 gi|306529129|gb|ADM99059.1| Flagellar biosynthesis protein fliQ [Dickeya dadantii 3937]
          Length = 89

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P L +A+  G++I+ LQA TQI E+TL+F+PK++ VF 
Sbjct: 1  MTPESVMALGYEAMKIALMLAGPPLVAALVSGLIISLLQAATQINEMTLSFIPKVLTVFF 60

Query: 61 TLIISAPFI 69
          TL+++ P++
Sbjct: 61 TLVVAGPWM 69


>gi|254466972|ref|ZP_05080383.1| export protein FliQ, family 3 [Rhodobacterales bacterium Y4I]
 gi|206687880|gb|EDZ48362.1| export protein FliQ, family 3 [Rhodobacterales bacterium Y4I]
          Length = 90

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 47/76 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E+   +  R A+W  ++ S P+L  A+ +G+ I   QALT +QE+TLTFVPK+ A+ +
Sbjct: 2  MSESLFYDTLRQALWAAVTMSTPILVVALVVGLTIGLFQALTSVQEMTLTFVPKLTAILV 61

Query: 61 TLIISAPFIGGQISSF 76
             ++  F+   + +F
Sbjct: 62 VFWMTMGFMTQTLVAF 77


>gi|126738580|ref|ZP_01754285.1| flagellar biosynthetic protein FliQ [Roseobacter sp. SK209-2-6]
 gi|126720379|gb|EBA17085.1| flagellar biosynthetic protein FliQ [Roseobacter sp. SK209-2-6]
          Length = 90

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E    +  R A+WT ++ S P+L  A+ +G+ +   QALT +QE++LTFVPK+ A+ +
Sbjct: 2  MTEGQFYDTLRQALWTAVTMSTPILTVALVVGLAVGLFQALTSVQEMSLTFVPKLAAIVV 61

Query: 61 TLIISAPFI 69
             ++  F+
Sbjct: 62 VFWMTMGFM 70


>gi|303240271|ref|ZP_07326790.1| flagellar biosynthetic protein FliQ [Acetivibrio cellulolyticus
          CD2]
 gi|302592181|gb|EFL61910.1| flagellar biosynthetic protein FliQ [Acetivibrio cellulolyticus
          CD2]
          Length = 89

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 44/59 (74%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M++  V+E+A+ ++ T++  SAP+L  ++ +G+ I+  QA TQIQE TLTF+PKI+AV 
Sbjct: 1  MDQGMVIELAQKSIMTVIYVSAPMLGLSLIVGLAISIFQATTQIQEQTLTFIPKILAVL 59


>gi|171319606|ref|ZP_02908702.1| export protein FliQ family 3 [Burkholderia ambifaria MEX-5]
 gi|171095177|gb|EDT40179.1| export protein FliQ family 3 [Burkholderia ambifaria MEX-5]
          Length = 88

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E+  L++    +W     + PVL + +  G+L++  Q +TQ+QE++L++VPK++   I
Sbjct: 1  MSESQALQMLSQLIWNSFLIAGPVLAATLIAGLLVSIFQVVTQLQEMSLSYVPKLVVAGI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+  AP++ G+++ F T + + I
Sbjct: 61 VLVTLAPWMLGRLTGFTTTLFAGI 84


>gi|326791525|ref|YP_004309346.1| flagellar biosynthetic protein FliQ [Clostridium lentocellum DSM
          5427]
 gi|326542289|gb|ADZ84148.1| flagellar biosynthetic protein FliQ [Clostridium lentocellum DSM
          5427]
          Length = 87

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 46/74 (62%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E  VL+  R A+  I+  S P+L + + +G++I+  Q  T IQE TL F+PKIIAVF+ +
Sbjct: 2  EQIVLDYMREALMMIVKVSLPILLTGLVVGLIISIFQTATSIQEQTLAFIPKIIAVFLAI 61

Query: 63 IISAPFIGGQISSF 76
          II   +I   +S +
Sbjct: 62 IIFGSWIINMLSVY 75


>gi|238787478|ref|ZP_04631276.1| Secretion system apparatus protein ssaS [Yersinia frederiksenii
          ATCC 33641]
 gi|238724265|gb|EEQ15907.1| Secretion system apparatus protein ssaS [Yersinia frederiksenii
          ATCC 33641]
          Length = 89

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ +A   +W +L  S PV+  A  +G++++ LQALTQIQ+ TL F+ K++AV  
Sbjct: 1  MSNAIVVHLATQLLWIVLLLSMPVVLVASVVGLVVSLLQALTQIQDQTLQFLIKLLAVSA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+++  ++G  + ++
Sbjct: 61 TLLVTYHWMGSTLLNY 76


>gi|78224288|ref|YP_386035.1| flagellar biosynthesis protein FliQ [Geobacter metallireducens
          GS-15]
 gi|78195543|gb|ABB33310.1| Flagellar biosynthesis protein FliQ [Geobacter metallireducens
          GS-15]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++AR +    L  SAP+L S + +G+LI+  QA+T IQE TL F PKII V +
Sbjct: 1  MSPDLVVQLARRSFEVTLLLSAPLLISGLVVGLLISIFQAVTSIQEATLAFAPKIIIVMV 60

Query: 61 TLIISAPFIGGQISSF 76
           ++I  P++   +S F
Sbjct: 61 AMVIFFPWMMSYMSDF 76


>gi|121608108|ref|YP_995915.1| flagellar biosynthetic protein FliQ [Verminephrobacter eiseniae
          EF01-2]
 gi|121552748|gb|ABM56897.1| flagellar biosynthetic protein FliQ [Verminephrobacter eiseniae
          EF01-2]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL I R A+  +L  S PVL + + +G++++  QA+TQI E TL FVPK+IA   
Sbjct: 1  MTAQMVLTIGRDALSLLLMISMPVLAAVLAVGLIVSIFQAVTQIHEATLAFVPKLIAAMA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L ++ P++ G +  F+   +  I S
Sbjct: 61 VLALAGPWMLGLLVDFIRRTIESIPS 86


>gi|306820132|ref|ZP_07453780.1| flagellar biosynthetic protein FliQ [Eubacterium yurii subsp.
          margaretiae ATCC 43715]
 gi|304551910|gb|EFM39853.1| flagellar biosynthetic protein FliQ [Eubacterium yurii subsp.
          margaretiae ATCC 43715]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ I + A   IL  SAP+L   + +G++++  QA TQIQE TL FVPKI+AV ++++I 
Sbjct: 6  VVNIIQQAALMILLLSAPMLLIGLVVGLIVSIFQATTQIQEATLAFVPKIVAVLLSMVIF 65

Query: 66 APFIGGQISSF 76
           P+I   + +F
Sbjct: 66 GPWIISTLVNF 76


>gi|146277691|ref|YP_001167850.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides ATCC
          17025]
 gi|145555932|gb|ABP70545.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides ATCC
          17025]
          Length = 88

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E  R A W IL ++ PVL  A+ +G++I  LQA T I E TL+FVPK+  V +T+ +++
Sbjct: 7  IEHLRIAYWNILLTAGPVLGVALAVGLVIGILQAATSINEATLSFVPKLAIVLLTMALAS 66

Query: 67 PFIGGQISSFVTLVLSRIQS 86
           F+  +++ +   V   I +
Sbjct: 67 SFMLTRMTDYFAFVFETIAT 86


>gi|169827137|ref|YP_001697295.1| flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
 gi|168991625|gb|ACA39165.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  A+  IL +S P+L  A+  G+ ++  QA T IQE TL FVPKI+AV +
Sbjct: 1  MTGELVISVAERAIMIILLTSGPLLLVALITGLAVSIFQATTSIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSF 76
           ++   P++  Q++S+
Sbjct: 61 AIVFFGPWMLSQVTSY 76


>gi|94264045|ref|ZP_01287845.1| Flagellar biosynthesis protein FliQ [delta proteobacterium
          MLMS-1]
 gi|94266369|ref|ZP_01290068.1| Flagellar biosynthesis protein FliQ [delta proteobacterium
          MLMS-1]
 gi|93453021|gb|EAT03509.1| Flagellar biosynthesis protein FliQ [delta proteobacterium
          MLMS-1]
 gi|93455556|gb|EAT05743.1| Flagellar biosynthesis protein FliQ [delta proteobacterium
          MLMS-1]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ ADV+ + + A+   L  + P+L  AM +G+ IA  QA+TQIQE+TLTFVPKI AV +
Sbjct: 1  MDPADVVVLIQQAVRVTLLMAGPILGIAMGVGLTIALFQAITQIQEMTLTFVPKIFAVLL 60


>gi|260429257|ref|ZP_05783234.1| flagellar biosynthetic protein FliQ [Citreicella sp. SE45]
 gi|260419880|gb|EEX13133.1| flagellar biosynthetic protein FliQ [Citreicella sp. SE45]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + EA   +  R  +W    +SAP+L +A+  G+ +   QALT IQE+TLTFVPK++A+ +
Sbjct: 2  LTEAIFYDTLRQGLWIATVTSAPILTAALVAGVGVGLFQALTSIQEMTLTFVPKLMAIVV 61

Query: 61 TLIISAPFI 69
             +S  F+
Sbjct: 62 VFWMSMSFM 70


>gi|300854221|ref|YP_003779205.1| flagellar biosynthesis protein FliQ [Clostridium ljungdahlii DSM
          13528]
 gi|300434336|gb|ADK14103.1| flagellar biosynthesis protein FliQ [Clostridium ljungdahlii DSM
          13528]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L   AP+L  ++ +G++I+  QA TQIQE TLTFVPK+IAV +
Sbjct: 1  MSENMVIGIIKDAVQTGLIVGAPILIVSVVVGLIISIFQATTQIQEQTLTFVPKLIAVAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            +I+  ++  Q+ +F   + + I
Sbjct: 61 IGLITGSWMLQQVVAFTERIFTYI 84


>gi|271500075|ref|YP_003333100.1| flagellar biosynthetic protein FliQ [Dickeya dadantii Ech586]
 gi|270343630|gb|ACZ76395.1| flagellar biosynthetic protein FliQ [Dickeya dadantii Ech586]
          Length = 89

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P L +A+  G++++ LQA TQI E+TL+F+PK++ VF 
Sbjct: 1  MTPESVMALGYEAMKIALMLAGPPLIAALVSGLIVSMLQAATQINEMTLSFIPKVLTVFF 60

Query: 61 TLIISAPFI 69
          TL+++ P++
Sbjct: 61 TLVVAGPWM 69


>gi|39995532|ref|NP_951483.1| flagellar biosynthetic protein FliQ [Geobacter sulfurreducens
          PCA]
 gi|39982295|gb|AAR33756.1| flagellar biosynthetic protein FliQ [Geobacter sulfurreducens
          PCA]
 gi|298504533|gb|ADI83256.1| flagellar biogenesis protein FliQ [Geobacter sulfurreducens
          KN400]
          Length = 89

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 46/71 (64%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++AR +    L  +AP+L S + +G+ ++  QA+T IQE TL F PKIIAV + L+I 
Sbjct: 6  VVQLARRSFEVTLMLAAPLLISGLVVGLAVSIFQAVTSIQEATLAFAPKIIAVMVALVIF 65

Query: 66 APFIGGQISSF 76
           P++   +S F
Sbjct: 66 FPWMMNYMSDF 76


>gi|317486798|ref|ZP_07945614.1| HrpO family type III secretion protein [Bilophila wadsworthia
          3_1_6]
 gi|316921961|gb|EFV43231.1| HrpO family type III secretion protein [Bilophila wadsworthia
          3_1_6]
          Length = 87

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (62%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E+  ++ A  A++ +L  S P +  A  +GIL++ +QA+TQ+QE TLTF  K++AV +TL
Sbjct: 2  ESAAIDYAMKALYLVLMLSMPPIIVASLIGILLSLIQAITQLQEQTLTFGVKLLAVVLTL 61

Query: 63 IISAPFIGGQISSFVTLVLSR 83
           I   ++ G+I  +   + SR
Sbjct: 62 FIMGGWLSGEILRYADDIFSR 82


>gi|16764770|ref|NP_460385.1| type III secretion system apparatus protein [Salmonella enterica
          subsp. enterica serovar Typhimurium str. LT2]
 gi|56413609|ref|YP_150684.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62180011|ref|YP_216428.1| secretion system apparatus SsaS [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|161614163|ref|YP_001588128.1| hypothetical protein SPAB_01905 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|197362533|ref|YP_002142170.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|207857074|ref|YP_002243725.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|224584069|ref|YP_002637867.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|238913177|ref|ZP_04657014.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Tennessee str. CDC07-0191]
 gi|3024663|sp|P74891|SSAS_SALTY RecName: Full=Secretion system apparatus protein SsaS
 gi|1526986|emb|CAA68200.1| secretion system apparatus, SsaS [Salmonella enterica subsp.
          enterica serovar Typhimurium]
 gi|16419941|gb|AAL20344.1| secretion system apparatus [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|56127866|gb|AAV77372.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62127644|gb|AAX65347.1| Secretion system apparatus SsaS [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|161363527|gb|ABX67295.1| hypothetical protein SPAB_01905 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|197094010|emb|CAR59506.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|206708877|emb|CAR33207.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|224468596|gb|ACN46426.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|261246626|emb|CBG24436.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267993309|gb|ACY88194.1| type III secretion system apparatus protein [Salmonella enterica
          subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157955|emb|CBW17450.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312912405|dbj|BAJ36379.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|322615096|gb|EFY12019.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322619937|gb|EFY16810.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322622249|gb|EFY19094.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322627771|gb|EFY24561.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322632884|gb|EFY29628.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322636625|gb|EFY33328.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322641182|gb|EFY37824.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322644883|gb|EFY41416.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650281|gb|EFY46695.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322655854|gb|EFY52156.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660180|gb|EFY56419.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322665254|gb|EFY61442.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322669511|gb|EFY65659.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673437|gb|EFY69539.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322677365|gb|EFY73429.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322679972|gb|EFY76011.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322687444|gb|EFY83416.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|322714478|gb|EFZ06049.1| type III secretion system apparatus protein [Salmonella enterica
          subsp. enterica serovar Choleraesuis str. A50]
 gi|323129692|gb|ADX17122.1| type III secretion system apparatus protein [Salmonella enterica
          subsp. enterica serovar Typhimurium str. 4/74]
 gi|323194103|gb|EFZ79302.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323198584|gb|EFZ83685.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323202910|gb|EFZ87945.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323208630|gb|EFZ93568.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323211166|gb|EFZ96013.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323217607|gb|EGA02322.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323218956|gb|EGA03466.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323223786|gb|EGA08090.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323229409|gb|EGA13532.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323232632|gb|EGA16728.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323240330|gb|EGA24374.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323242681|gb|EGA26702.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323245892|gb|EGA29880.1| type III secretion system protein SsaS [Salmonella enterica
          subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252456|gb|EGA36303.1| type III secretion system protein SsaS [Salmonella enterica
          subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323256475|gb|EGA40208.1| type III secretion system protein SsaS [Salmonella enterica
          subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323260038|gb|EGA43663.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323267199|gb|EGA50684.1| type III secretion system protein SsaS [Salmonella enterica
          subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323271478|gb|EGA54899.1| type III secretion system protein SsaS [Salmonella enterica
          subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|332988307|gb|AEF07290.1| type III secretion system apparatus protein [Salmonella enterica
          subsp. enterica serovar Typhimurium str. UK-1]
          Length = 88

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 58/84 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN++++ +     +W +L +S PV+  A  +G++++ +QALTQIQ+ TL F+ K++A+ I
Sbjct: 1  MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++S P++ G + ++   ++ RI
Sbjct: 61 TLMVSYPWLSGILLNYTRQIMLRI 84


>gi|224438532|ref|ZP_03659452.1| flagellar biosynthesis protein FliQ [Helicobacter cinaedi CCUG
          18818]
 gi|313144959|ref|ZP_07807152.1| flagellar biosynthesis protein FliQ [Helicobacter cinaedi CCUG
          18818]
 gi|313129990|gb|EFR47607.1| flagellar biosynthesis protein FliQ [Helicobacter cinaedi CCUG
          18818]
          Length = 88

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +A       L  S P+L + + +G+LI+  QA TQI E+TLTFVPKI+AV   +
Sbjct: 2  EAQLMALAIQTYKLTLILSLPMLLAGLIVGLLISIFQATTQINEMTLTFVPKILAVVAVI 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQS 86
          I + P++   I+ +  ++ + I S
Sbjct: 62 IFAMPWMINMITDYTRMLFTMISS 85


>gi|328911740|gb|AEB63336.1| component of the flagellar export machinery [Bacillus
          amyloliquefaciens LL3]
          Length = 81

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          +A  A++  L    P+L  A+ +G+L++  QA TQIQE TL F+PKI+AV + LI   P+
Sbjct: 1  MAEKAVYVTLMICGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVMLGLIFFGPW 60

Query: 69 IGGQISSFVTLVLSRIQ 85
          +   I SF T + S + 
Sbjct: 61 MLSTILSFTTDLFSHLN 77


>gi|289208348|ref|YP_003460414.1| flagellar biosynthetic protein FliQ [Thioalkalivibrio sp. K90mix]
 gi|288943979|gb|ADC71678.1| flagellar biosynthetic protein FliQ [Thioalkalivibrio sp. K90mix]
          Length = 89

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R  +  ++  +AP L +A+ +G+ I  LQA TQIQE+TL+F+PK++A+F 
Sbjct: 1  MTPEMVVDVGRETLTVVVLLAAPPLLTALAVGLAIGMLQAATQIQEMTLSFIPKLLAMFA 60

Query: 61 TLIISA 66
           L+IS 
Sbjct: 61 ALLISG 66


>gi|254474996|ref|ZP_05088382.1| flagellar biosynthetic protein FliQ [Ruegeria sp. R11]
 gi|214029239|gb|EEB70074.1| flagellar biosynthetic protein FliQ [Ruegeria sp. R11]
          Length = 90

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++E    +  R A+WT +  S P+L  A+ +G+ I   QALT +QE+TLTFVPK+ A+ I
Sbjct: 2  LSEGIFYDTLRQALWTSVIMSTPILLVALVVGLAIGLFQALTSVQEMTLTFVPKVTAIVI 61

Query: 61 TLIISAPFIGGQISSF 76
             ++  F+   + +F
Sbjct: 62 VFWMTMGFMTQSLVAF 77


>gi|255264177|ref|ZP_05343519.1| flagellar biosynthetic protein FliQ [Thalassiobium sp. R2A62]
 gi|255106512|gb|EET49186.1| flagellar biosynthetic protein FliQ [Thalassiobium sp. R2A62]
          Length = 89

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          +NE    +I R  +W  +  S P+L  A+  G+++   QALT IQE+TLTFVPK+ A+  
Sbjct: 2  LNEQVFFDILRQGLWIAVMMSLPILAVALATGLVVGLFQALTSIQEMTLTFVPKLGAILA 61

Query: 61 TLIISAPFIGGQISSF 76
             ++  F+   +SSF
Sbjct: 62 VFWVTMGFMTQTLSSF 77


>gi|186477689|ref|YP_001859159.1| flagellar biosynthetic protein FliQ [Burkholderia phymatum
          STM815]
 gi|184194148|gb|ACC72113.1| flagellar biosynthetic protein FliQ [Burkholderia phymatum
          STM815]
          Length = 89

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 52/86 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V  +A  AM+  L  +AP LF  + +G++++  QA TQI E TL+F+PK+ A+ +
Sbjct: 1  MTPETVTTLAHEAMYIALLLAAPPLFVGLVVGLIVSLFQAATQINEATLSFIPKLFAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL++  P++  ++  ++  + + I +
Sbjct: 61 TLVLIGPWMLAKMLDYMRHMFTSIPT 86


>gi|254517018|ref|ZP_05129076.1| flagellar biosynthetic protein FliQ [gamma proteobacterium
          NOR5-3]
 gi|219674523|gb|EED30891.1| flagellar biosynthetic protein FliQ [gamma proteobacterium
          NOR5-3]
          Length = 89

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + + A+W  +  + P+L SA+ +G+LI   QA TQIQE+TL+F+PK++A+ +
Sbjct: 1  MGPETVLAVGKDALWLAVLLAGPLLLSALAVGLLIGIFQAATQIQEMTLSFIPKLLALVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+++ P++   + SF T +   I S L
Sbjct: 61 ALLVAGPWMIQVVVSFSTRLFREIPSLL 88


>gi|77463635|ref|YP_353139.1| flagellar protein FliQ [Rhodobacter sphaeroides 2.4.1]
 gi|332558491|ref|ZP_08412813.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides
          WS8N]
 gi|3435110|gb|AAC32323.1| flagellar protein FliQ [Rhodobacter sphaeroides]
 gi|77388053|gb|ABA79238.1| Flagellar protein FliQ [Rhodobacter sphaeroides 2.4.1]
 gi|332276203|gb|EGJ21518.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides
          WS8N]
          Length = 88

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +E  R A W IL ++ PVL  A+ +G++I  LQA T I E TL+FVPK+  V +
Sbjct: 1  MDFDGSIEHLRLAYWNILLTAGPVLGVALAVGLVIGILQAATSINESTLSFVPKLAIVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T+ +++ F+  +++ +   V   I +
Sbjct: 61 TMALASSFMLTRMTDYFAFVFETIAT 86


>gi|78358621|ref|YP_390070.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          subsp. desulfuricans str. G20]
 gi|78221026|gb|ABB40375.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          subsp. desulfuricans str. G20]
          Length = 89

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+   L+ S P+L   + +G+ ++ +QA TQIQE TL+F+PKI+++F+
Sbjct: 1  MTPEFVVGFARQAIELALTISLPMLGIGLAVGVFVSVIQAATQIQETTLSFIPKIVSIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L++S P+I  ++ +F   V   I +
Sbjct: 61 ALLVSFPWIMDKMLAFTREVFINIPN 86


>gi|221639478|ref|YP_002525740.1| Flagellar protein FliQ [Rhodobacter sphaeroides KD131]
 gi|221160259|gb|ACM01239.1| Flagellar protein FliQ [Rhodobacter sphaeroides KD131]
          Length = 89

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 50/86 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +E  R A W IL ++ PVL  A+ +G+ I  LQA T I E TL+FVPK+  V +
Sbjct: 2  MDFDGSIEHLRLAYWNILLTAGPVLGVALAVGLFIGILQAATSINESTLSFVPKLAIVLL 61

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T+ +++ F+  +++ +   V   I +
Sbjct: 62 TMALASSFMLTRMTDYFAFVFETIAT 87


>gi|126462467|ref|YP_001043581.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides ATCC
          17029]
 gi|126104131|gb|ABN76809.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides ATCC
          17029]
          Length = 88

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E  R A W IL ++ PVL  A+ +G++I  LQA T I E TL+FVPK+  V +T+ +++
Sbjct: 7  IEHLRLAYWNILLTAGPVLGVALAVGLVIGILQAATSINESTLSFVPKLAIVLLTMALAS 66

Query: 67 PFIGGQISSFVTLVLSRIQS 86
           F+  +++ +   V   I +
Sbjct: 67 SFMLTRMTDYFAFVFETIAA 86


>gi|294084390|ref|YP_003551148.1| flagellar biosynthetic protein FliQ [Candidatus Puniceispirillum
          marinum IMCC1322]
 gi|292663963|gb|ADE39064.1| flagellar biosynthetic protein FliQ [Candidatus Puniceispirillum
          marinum IMCC1322]
          Length = 88

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 49/84 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +E  R A W I+ ++ P+L  A+ +G+LI   QA T I E TL+FVPK++ V +
Sbjct: 1  MDFDSNVEFLRIAFWQIIIAAGPLLGVALAIGLLIGIFQAATSINEQTLSFVPKLVIVML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T  + + F+  Q+S +   +  +I
Sbjct: 61 TFGLVSSFMLAQLSDYFAFIFDQI 84


>gi|56695102|ref|YP_165449.1| flagellar biosynthetic protein FliQ [Ruegeria pomeroyi DSS-3]
 gi|56676839|gb|AAV93505.1| flagellar biosynthetic protein FliQ [Ruegeria pomeroyi DSS-3]
          Length = 90

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E    +  R  +W  + +S P+L  A+  G+ +   QALT IQE+TLTFVPK+ A+ I
Sbjct: 2  MSEGLFYDTVRQGLWIAVITSVPILSVALIAGLAVGLFQALTSIQEMTLTFVPKLAAIVI 61

Query: 61 TLIISAPFIGGQISSFVTLVL 81
             IS  F+   + ++ T  L
Sbjct: 62 VFWISMGFMTQTLVNYFTTTL 82


>gi|297538205|ref|YP_003673974.1| flagellar biosynthetic protein FliQ [Methylotenera sp. 301]
 gi|297257552|gb|ADI29397.1| flagellar biosynthetic protein FliQ [Methylotenera sp. 301]
          Length = 89

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 51/86 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L   + +G+L++  QA TQI E TL+F+PK++ VF 
Sbjct: 1  MTPESVMTLGRDAMEITLLVAAPILLVVLAIGLLVSIFQAATQINEATLSFIPKLVGVFG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+ +  ++   +  ++ LV + I +
Sbjct: 61 TLMFAGQWMLTTLVDYMHLVFTSIPA 86


>gi|205352864|ref|YP_002226665.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|205272645|emb|CAR37555.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|309243392|gb|ADO51968.1| SsaS [Salmonella enterica subsp. enterica serovar Gallinarum]
 gi|326627936|gb|EGE34279.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 9]
          Length = 88

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 58/84 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN++++ +     +W +L +S PV+  A  +G++++ +QALTQIQ+ TL F+ K++A+ I
Sbjct: 1  MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++S P++ G + ++   ++ R+
Sbjct: 61 TLMVSYPWLSGILLNYTRQIMLRV 84


>gi|16760491|ref|NP_456108.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|29141749|ref|NP_805091.1| type III secretion protein [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|213162231|ref|ZP_03347941.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E00-7866]
 gi|213416631|ref|ZP_03349775.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E01-6750]
 gi|213426015|ref|ZP_03358765.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E02-1180]
 gi|213581366|ref|ZP_03363192.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
 gi|213613056|ref|ZP_03370882.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213647288|ref|ZP_03377341.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213854183|ref|ZP_03382715.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|289805084|ref|ZP_06535713.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. AG3]
 gi|289827205|ref|ZP_06545928.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-3139]
 gi|25303010|pir||AH0696 probable type III secretion protein ssaS [imported] - Salmonella
          enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16502787|emb|CAD01945.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29137377|gb|AAO68940.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
          Length = 88

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 58/84 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN++++ +     +W +L +S PV+  A  +G++++ +QALTQIQ+ TL F+ K++A+ I
Sbjct: 1  MNDSELTQFITQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++S P++ G + ++   ++ RI
Sbjct: 61 TLMVSYPWLSGILLNYTRQIMLRI 84


>gi|148380605|ref|YP_001255146.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A str.
          ATCC 3502]
 gi|153930978|ref|YP_001384892.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A str.
          ATCC 19397]
 gi|153937262|ref|YP_001388361.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A str.
          Hall]
 gi|153940246|ref|YP_001391948.1| flagellar biosynthesis protein FliQ [Clostridium botulinum F str.
          Langeland]
 gi|168180928|ref|ZP_02615592.1| flagellar biosynthesis protein FliQ [Clostridium botulinum NCTC
          2916]
 gi|168182730|ref|ZP_02617394.1| flagellar biosynthesis protein FliQ [Clostridium botulinum Bf]
 gi|226950060|ref|YP_002805151.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A2
          str. Kyoto]
 gi|237796087|ref|YP_002863639.1| flagellar biosynthesis protein FliQ [Clostridium botulinum Ba4
          str. 657]
 gi|148290089|emb|CAL84208.1| flagellar biosynthetic protein [Clostridium botulinum A str. ATCC
          3502]
 gi|152927022|gb|ABS32522.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A str.
          ATCC 19397]
 gi|152933176|gb|ABS38675.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A str.
          Hall]
 gi|152936142|gb|ABS41640.1| flagellar biosynthesis protein FliQ [Clostridium botulinum F str.
          Langeland]
 gi|182668265|gb|EDT80244.1| flagellar biosynthesis protein FliQ [Clostridium botulinum NCTC
          2916]
 gi|182674208|gb|EDT86169.1| flagellar biosynthesis protein FliQ [Clostridium botulinum Bf]
 gi|226842552|gb|ACO85218.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A2
          str. Kyoto]
 gi|229263883|gb|ACQ54916.1| flagellar biosynthesis protein FliQ [Clostridium botulinum Ba4
          str. 657]
 gi|295319966|gb|ADG00344.1| flagellar biosynthesis protein FliQ [Clostridium botulinum F str.
          230613]
          Length = 89

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IAV +
Sbjct: 1  MSENMVMGIIKDAIQTGLLISAPILTISILVGLIISIFQATTQIQEQTLTFVPKLIAVAV 60

Query: 61 TLIISAPFIGGQISSF 76
            +++  ++  Q+ +F
Sbjct: 61 VGLLTGSWMLHQLLAF 76


>gi|163738062|ref|ZP_02145478.1| flagellar biosynthetic protein FliQ [Phaeobacter gallaeciensis
          BS107]
 gi|163742542|ref|ZP_02149928.1| flagellar biosynthetic protein FliQ [Phaeobacter gallaeciensis
          2.10]
 gi|161384127|gb|EDQ08510.1| flagellar biosynthetic protein FliQ [Phaeobacter gallaeciensis
          2.10]
 gi|161388678|gb|EDQ13031.1| flagellar biosynthetic protein FliQ [Phaeobacter gallaeciensis
          BS107]
          Length = 90

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E    +  R A+W  +  S P+L  A+ +G+ I   QALT +QE+TLTFVPK+ A+ +
Sbjct: 2  MSEGLFYDTLRQALWASVMMSTPILLVALVVGLAIGLFQALTSVQEMTLTFVPKLTAILV 61

Query: 61 TLIISAPFI 69
             ++  F+
Sbjct: 62 VFWMTMGFM 70


>gi|33596844|ref|NP_884487.1| putative type III secretion protein [Bordetella parapertussis
          12822]
 gi|33600618|ref|NP_888178.1| putative type III secretion protein [Bordetella bronchiseptica
          RB50]
 gi|33568217|emb|CAE32130.1| putative type III secretion protein [Bordetella bronchiseptica
          RB50]
 gi|33573545|emb|CAE37536.1| putative type III secretion protein [Bordetella parapertussis]
          Length = 91

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++     A++ +L  S P +  A  +G L + LQALTQ+QE TL+F  K+IAVF 
Sbjct: 4  MQTQDLVSFMTQALYLVLWLSLPPIAVAAIVGTLFSLLQALTQVQEQTLSFAVKLIAVFA 63

Query: 61 TLIISAPFIGGQISSF 76
          TL+++A +I  +I +F
Sbjct: 64 TLMLAARWISAEIYNF 79


>gi|170756651|ref|YP_001782264.1| flagellar biosynthesis protein FliQ [Clostridium botulinum B1
          str. Okra]
 gi|170758611|ref|YP_001787968.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A3
          str. Loch Maree]
 gi|187778763|ref|ZP_02995236.1| hypothetical protein CLOSPO_02358 [Clostridium sporogenes ATCC
          15579]
 gi|169121863|gb|ACA45699.1| flagellar biosynthesis protein FliQ [Clostridium botulinum B1
          str. Okra]
 gi|169405600|gb|ACA54011.1| flagellar biosynthesis protein FliQ [Clostridium botulinum A3
          str. Loch Maree]
 gi|187772388|gb|EDU36190.1| hypothetical protein CLOSPO_02358 [Clostridium sporogenes ATCC
          15579]
          Length = 89

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IAV +
Sbjct: 1  MSENMVMGIIKDAIQTGLLVSAPILTISILVGLIISIFQATTQIQEQTLTFVPKLIAVAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            +++  ++  Q+ +F   + + I
Sbjct: 61 VGLLTGSWMLHQLLAFTERIFAMI 84


>gi|32265937|ref|NP_859969.1| flagellar biosynthesis protein FliQ [Helicobacter hepaticus ATCC
          51449]
 gi|32261986|gb|AAP77035.1| flagellar basal body protein FliQ [Helicobacter hepaticus ATCC
          51449]
          Length = 88

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 51/84 (60%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +A       L  S P+L + + +G+LI+  QA TQI E+TLTFVPKI+AV   +
Sbjct: 2  EAQLMALAIQTYKLTLILSLPMLLAGLIVGLLISIFQATTQINEMTLTFVPKILAVVAVI 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQS 86
          I + P++   I+ +  ++ + I +
Sbjct: 62 IFTMPWMINMITDYTRMLFTMISN 85


>gi|226941266|ref|YP_002796340.1| FliQ1 [Laribacter hongkongensis HLHK9]
 gi|226716193|gb|ACO75331.1| FliQ1 [Laribacter hongkongensis HLHK9]
          Length = 89

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + + A+  ++  ++P+L  ++ +G+L++  QA TQI E+TLTF+PK++A+F+
Sbjct: 1  MTPEHVINLVQNALLILILIASPLLAVSLGVGLLVSVFQAATQINEMTLTFIPKLLAMFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T+I++ P++   ++ F   + S I
Sbjct: 61 TVILAGPWMLRTLTDFTIRLYSSI 84


>gi|117928066|ref|YP_872617.1| flagellar biosynthetic protein FliQ [Acidothermus cellulolyticus
          11B]
 gi|117648529|gb|ABK52631.1| flagellar biosynthetic protein FliQ [Acidothermus cellulolyticus
          11B]
          Length = 91

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +A  AM       AP+L +++ +G  I+  QA TQIQE TL+FVPKI+AV I
Sbjct: 1  MTDTAVIHLAMQAMVVAAKLCAPILLTSLLVGFGISLFQAATQIQEFTLSFVPKILAVGI 60

Query: 61 TLIISAPFI 69
           +++S  ++
Sbjct: 61 AIVVSGHWM 69


>gi|46445835|ref|YP_007200.1| type III secretion inner membrane protein SctS [Candidatus
          Protochlamydia amoebophila UWE25]
 gi|46399476|emb|CAF22925.1| probable type III secretion inner membrane protein SctS
          [Candidatus Protochlamydia amoebophila UWE25]
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M ++ V+++A   M  IL  SAP +  +MF GI++A  QA TQIQE TL+F  K++AV +
Sbjct: 1  MFQSQVVQLAYQGMLLILILSAPPILVSMFFGIIVAIFQAATQIQEQTLSFTIKLVAVTL 60

Query: 61 TLIISAPFIGG 71
          TL+    F+GG
Sbjct: 61 TLM----FLGG 67


>gi|319649550|ref|ZP_08003706.1| flagellar biosynthesis protein Q [Bacillus sp. 2_A_57_CT2]
 gi|317398712|gb|EFV79394.1| flagellar biosynthesis protein Q [Bacillus sp. 2_A_57_CT2]
          Length = 89

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ IA   + T+L    P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MTPETVISIAERGIITVLMICGPLLILALVVGLVVSIFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++   + S+   + S +
Sbjct: 61 GVVFFGPWMLSHMLSYANEIFSNL 84


>gi|126697833|ref|YP_001086730.1| flagellar export protein [Clostridium difficile 630]
 gi|255099429|ref|ZP_05328406.1| flagellar export protein [Clostridium difficile QCD-63q42]
 gi|115249270|emb|CAJ67083.1| Flagellar biosynthetic protein FliQ [Clostridium difficile]
          Length = 89

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  ++ + +  M+T    +APVL  ++ +G+LI+  QA TQIQE TLTFVPK+IA+ +
Sbjct: 1  MSEFMIMSVLKNGMFTGAMIAAPVLIVSLVVGLLISVFQATTQIQEQTLTFVPKLIAILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           + I   ++   + SF + + + I
Sbjct: 61 VVAIGGSWMLHTLISFTSEIFNMI 84


>gi|222053617|ref|YP_002535979.1| flagellar biosynthetic protein FliQ [Geobacter sp. FRC-32]
 gi|221562906|gb|ACM18878.1| flagellar biosynthetic protein FliQ [Geobacter sp. FRC-32]
          Length = 89

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++AR +  T L  SAP+L  ++ +G+LI+  QA+T I E TL F PKI AV + LII 
Sbjct: 6  VVQLARRSFETTLLLSAPLLTFSLVVGLLISIFQAITSINEATLAFAPKIAAVMVALIIF 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++   +S F   + + I +
Sbjct: 66 FPWMMSYMSDFTREIYNMIPN 86


>gi|237751246|ref|ZP_04581726.1| flagellar biosynthesis protein FliQ [Helicobacter bilis ATCC
          43879]
 gi|229372612|gb|EEO23003.1| flagellar biosynthesis protein FliQ [Helicobacter bilis ATCC
          43879]
          Length = 88

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S PVL  A+ +G+LI+  QA TQI E+TL FVPKI+AV   +I + P++   +  F  +V
Sbjct: 20 SLPVLLVALIMGLLISIFQATTQINEMTLAFVPKILAVVAMIIFTMPWMLNMLMDFTKMV 79

Query: 81 LSRIQS 86
          ++ I +
Sbjct: 80 INMIPT 85


>gi|89056686|ref|YP_512137.1| export protein FliQ [Jannaschia sp. CCS1]
 gi|88866235|gb|ABD57112.1| flagellar biosynthetic protein FliQ [Jannaschia sp. CCS1]
          Length = 88

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E    +  R  +W  +  + P+L +A+  GI++   QALT +QE+TLTFVPK+ A+ +
Sbjct: 1  MDEMIFFDTMRQGLWISVVVATPILAAALVSGIVVGLFQALTSVQEMTLTFVPKLAAIVV 60

Query: 61 TLIISAPFIGGQISSFVT 78
             +S  F+   + S+ T
Sbjct: 61 VFWVSMGFMSQTLVSYFT 78


>gi|83647783|ref|YP_436218.1| type III secretory pathway subunit EscS [Hahella chejuensis KCTC
          2396]
 gi|83635826|gb|ABC31793.1| Type III secretory pathway, component EscS [Hahella chejuensis
          KCTC 2396]
          Length = 90

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 55/85 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA+V+  A   +  +L  S P +  A  +G L++ +Q+LTQIQ+ TL+F  K+IAV I
Sbjct: 1  MSEAEVIHYASQLLMLVLVLSMPTVIVAAVVGTLVSLVQSLTQIQDQTLSFAIKLIAVSI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          T++++A ++G +I  F   +L  I+
Sbjct: 61 TIMLTARWLGIEIYHFSMNILDHIE 85


>gi|162147442|ref|YP_001601903.1| flagellar biosynthetic protein fliQ [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209545552|ref|YP_002277781.1| export protein FliQ family 3 [Gluconacetobacter diazotrophicus
          PAl 5]
 gi|161786019|emb|CAP55601.1| putative flagellar biosynthetic protein fliQ [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209533229|gb|ACI53166.1| export protein FliQ family 3 [Gluconacetobacter diazotrophicus
          PAl 5]
          Length = 91

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 49/83 (59%)

Query: 2  NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          +  D+ +I R  +   +   AP L +++  G+L++  QA+TQ+ E TL+FVPK +A    
Sbjct: 3  HTVDIHDILRQTLIVAVKMGAPSLLASLCAGVLVSLFQAMTQVNEATLSFVPKFVAAMAA 62

Query: 62 LIISAPFIGGQISSFVTLVLSRI 84
          L+++  F+   ++++  ++  ++
Sbjct: 63 LLLTGSFMYSTLNTYAHVIFDQM 85


>gi|294141000|ref|YP_003556978.1| type III secretion system EscS protein [Shewanella violacea
          DSS12]
 gi|293327469|dbj|BAJ02200.1| type III secretion system EscS protein [Shewanella violacea
          DSS12]
          Length = 102

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  ++ +    +W +L  S PV+  A  +G++++ +QALTQIQ+ TL F+ K++AV I
Sbjct: 14 MSENIIMHLTSELLWIVLLLSLPVVIVASIIGVIVSLVQALTQIQDQTLQFLIKLVAVCI 73

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++S  ++GG + ++  +   +I
Sbjct: 74 TLVVSYHWMGGSLLNYAGMTFDQI 97


>gi|302874604|ref|YP_003843237.1| flagellar biosynthetic protein FliQ [Clostridium cellulovorans
          743B]
 gi|307690785|ref|ZP_07633231.1| flagellar biosynthesis protein FliQ [Clostridium cellulovorans
          743B]
 gi|302577461|gb|ADL51473.1| flagellar biosynthetic protein FliQ [Clostridium cellulovorans
          743B]
          Length = 89

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  +  + + A+ T L  SAP+L +A+ +G++I+  QA TQIQE TLTFVPK+I + +
Sbjct: 1  MSENMLATVMKDAITTGLLMSAPILITAILVGLIISIFQATTQIQEQTLTFVPKLIGIAL 60

Query: 61 TLIISAPFI 69
            IIS  ++
Sbjct: 61 VGIISGRWM 69


>gi|295399825|ref|ZP_06809806.1| flagellar biosynthetic protein FliQ [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|312111663|ref|YP_003989979.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y4.1MC1]
 gi|294978228|gb|EFG53825.1| flagellar biosynthetic protein FliQ [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|311216764|gb|ADP75368.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y4.1MC1]
          Length = 89

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 4  AD-VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          AD V+ +A   ++ IL  S P+L  ++ +G++I+  QA TQIQE TL FVPKI+AV + L
Sbjct: 3  ADFVIRMAEQGVYAILIVSGPLLLLSLAVGLIISIFQATTQIQEQTLAFVPKIVAVLVGL 62

Query: 63 IISAPFIGGQISSFVTLVLSRI 84
          +   P++  +I S+   +L+ +
Sbjct: 63 VFFGPWMLTKIVSYAYEILNNL 84


>gi|239909256|ref|YP_002955998.1| flagellar biosynthetic protein FliQ [Desulfovibrio magneticus
          RS-1]
 gi|239799123|dbj|BAH78112.1| flagellar biosynthetic protein FliQ [Desulfovibrio magneticus
          RS-1]
          Length = 89

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 52/71 (73%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ ++R A+   L  + P+L  ++ +G+ ++ LQA TQIQE+TLTFVPKI+++FI L+++
Sbjct: 6  VVALSRQAIELALFLALPMLGVSLVVGVFVSVLQAATQIQEMTLTFVPKILSMFIALLLA 65

Query: 66 APFIGGQISSF 76
           P++  ++ +F
Sbjct: 66 FPWMMDKMLNF 76


>gi|322806977|emb|CBZ04547.1| flagellar biosynthesis protein FliQ [Clostridium botulinum H04402
          065]
          Length = 89

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IAV +
Sbjct: 1  MSENMVMGIIKDAIQTGLLISAPILTISILVGLIISIFQATTQIQEQTLTFVPKLIAVAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            +++  ++  Q+ +F   + + I
Sbjct: 61 VGLLTGSWMLHQLLAFTERIFAMI 84


>gi|77464906|ref|YP_354410.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides
          2.4.1]
 gi|126463748|ref|YP_001044862.1| export protein FliQ [Rhodobacter sphaeroides ATCC 17029]
 gi|221640827|ref|YP_002527089.1| Export protein FliQ, family 3 [Rhodobacter sphaeroides KD131]
 gi|77389324|gb|ABA80509.1| flagellar biosynthetic protein FliQ [Rhodobacter sphaeroides
          2.4.1]
 gi|126105412|gb|ABN78090.1| export protein FliQ, family 3 [Rhodobacter sphaeroides ATCC
          17029]
 gi|221161608|gb|ACM02588.1| Export protein FliQ, family 3 [Rhodobacter sphaeroides KD131]
          Length = 88

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  + +  R  +W  +  S+P+L  A+  G+ I  LQALT +QE+TLTFVPK+ A+ +
Sbjct: 1  MSELALYDALRQGLWVAVLISSPLLGVALVAGVTIGLLQALTSVQEMTLTFVPKVGAMLL 60

Query: 61 TLIISAPFIGGQISSFVT 78
             +S  F+   + +F T
Sbjct: 61 VFWVSMSFMTTTLVAFFT 78


>gi|332559804|ref|ZP_08414126.1| FliQ2 [Rhodobacter sphaeroides WS8N]
 gi|332277516|gb|EGJ22831.1| FliQ2 [Rhodobacter sphaeroides WS8N]
          Length = 88

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  + +  R  +W  +  S+P+L  A+  G+ I  LQALT +QE+TLTFVPK+ A+ +
Sbjct: 1  MSELALYDALRQGLWVAVLISSPLLGVALVAGVTIGLLQALTSVQEMTLTFVPKVGAMLL 60

Query: 61 TLIISAPFIGGQISSFVT 78
             +S  F+   + +F T
Sbjct: 61 VFWVSMSFMTTTLVAFFT 78


>gi|237753285|ref|ZP_04583765.1| flagellar biosynthetic protein [Helicobacter winghamensis ATCC
          BAA-430]
 gi|229375552|gb|EEO25643.1| flagellar biosynthetic protein [Helicobacter winghamensis ATCC
          BAA-430]
          Length = 88

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +A       L  S P+L   + +G++I+  QA TQI E+TLTFVPKI+AV + +
Sbjct: 2  EAQLMNLAIETYKITLILSLPMLLVGLVVGLMISIFQATTQINEMTLTFVPKILAVIVVI 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQSSL 88
          I + P++   +  F T + + + + L
Sbjct: 62 IFTMPWMLNMLIDFTTRIFNMMPTFL 87


>gi|42524693|ref|NP_970073.1| flagellar biosynthetic protein FliQ [Bdellovibrio bacteriovorus
          HD100]
 gi|39576903|emb|CAE78132.1| flagellar biosynthetic protein FliQ [Bdellovibrio bacteriovorus
          HD100]
          Length = 90

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ + + A+ T    +AP+L S + +G+ ++  QALTQI E TLTF+PK+I V  
Sbjct: 1  MTDELVIRLGQDALRTTAMLAAPLLISTLVVGLAVSIFQALTQINEATLTFIPKMIVVAA 60

Query: 61 TLIISAPFIGGQISSF 76
            +++ P++   +SS+
Sbjct: 61 VFVLAGPWMMDVMSSY 76


>gi|254459562|ref|ZP_05072978.1| flagellar biosynthetic protein FliQ [Rhodobacterales bacterium
          HTCC2083]
 gi|206676151|gb|EDZ40638.1| flagellar biosynthetic protein FliQ [Rhodobacteraceae bacterium
          HTCC2083]
          Length = 88

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 52/84 (61%), Gaps = 1/84 (1%)

Query: 3  EADV-LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          E D+ +E  R A W I+ ++ P+L  A+ +G++I  LQA T I E T++FVPK++ V + 
Sbjct: 2  EFDINVESLRGAYWQIIMTAGPILVVALSVGLIIGILQAATSINEATISFVPKLVVVLLA 61

Query: 62 LIISAPFIGGQISSFVTLVLSRIQ 85
          + + + F+  ++  +  ++  +I+
Sbjct: 62 MALLSTFMMREMVDYFAMIFDQIR 85


>gi|108761227|ref|YP_633785.1| putative type III secretion system protein [Myxococcus xanthus DK
          1622]
 gi|108465107|gb|ABF90292.1| putative type III secretion system protein [Myxococcus xanthus DK
          1622]
          Length = 89

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L + R A+  ++ +S P + +++ +G L +  QA TQ+QE TL+ VPK+ A  +
Sbjct: 1  MTQDVFLTLGREALLLMVMASLPPIGASLVVGFLSSLFQATTQLQESTLSVVPKLCAAVL 60

Query: 61 TLIISAPFIGGQISSF 76
           L+++ P+I GQ++ F
Sbjct: 61 ALVLAGPWIAGQLTRF 76


>gi|260893863|ref|YP_003239960.1| flagellar biosynthetic protein FliQ [Ammonifex degensii KC4]
 gi|260866004|gb|ACX53110.1| flagellar biosynthetic protein FliQ [Ammonifex degensii KC4]
          Length = 90

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 51/83 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++A  L++   A + +L  + P L  +  +G+++  LQA TQIQ+  ++FVPKI+AVF+
Sbjct: 1  MSQAMALDLVTKAFFLVLLLAGPALLVSALVGLVVGILQATTQIQDQMISFVPKIVAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
          TL +  P     + SF   +++R
Sbjct: 61 TLALCFPLFLRLMISFTQEIMAR 83


>gi|238899256|ref|YP_002924939.1| type III secretion system apparatus protein [Candidatus
          Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|75906099|gb|ABA29441.1| putative type III secretion system protein [Candidatus
          Hamiltonella defensa]
 gi|229467017|gb|ACQ68791.1| type III secretion system apparatus protein [Candidatus
          Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 89

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A ++++    +W +L  S PV+  A  +G++++  QALTQIQ+ TL F+ K++AV +
Sbjct: 1  MSNAIIIQLTTQVLWIVLILSMPVVVVASLVGLMVSLFQALTQIQDQTLQFLIKLLAVCL 60

Query: 61 TLIISAPFIGGQISSF 76
           L++S  ++G  + ++
Sbjct: 61 CLLMSYHWMGSTMLNY 76


>gi|307824490|ref|ZP_07654715.1| flagellar biosynthetic protein FliQ [Methylobacter tundripaludum
          SV96]
 gi|307734474|gb|EFO05326.1| flagellar biosynthetic protein FliQ [Methylobacter tundripaludum
          SV96]
          Length = 89

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          + + AM   +  +APVL  ++ +G++IA  QA TQI E TLTFVPK+I + I L+I  P
Sbjct: 9  VGQEAMIVAVKLTAPVLLPSLAVGLIIAMFQAATQINEATLTFVPKVIVIGIVLMIMGP 67


>gi|238757866|ref|ZP_04619048.1| Secretion system apparatus protein ssaS [Yersinia aldovae ATCC
          35236]
 gi|238703851|gb|EEP96386.1| Secretion system apparatus protein ssaS [Yersinia aldovae ATCC
          35236]
          Length = 75

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 49/74 (66%)

Query: 14 MWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQI 73
          MW +L +S PV+  A  +GI ++  QALTQIQ+ TL F+ K++AV + L+++  ++GG +
Sbjct: 1  MWLVLMTSLPVVLVASVVGIAVSLFQALTQIQDQTLQFMIKLLAVALMLMVTYHWLGGLL 60

Query: 74 SSFVTLVLSRIQSS 87
           ++   VL +I + 
Sbjct: 61 LAYTRQVLLQIGTH 74


>gi|295706269|ref|YP_003599344.1| flagellar biosynthetic protein FliQ [Bacillus megaterium DSM 319]
 gi|294803928|gb|ADF40994.1| flagellar biosynthetic protein FliQ [Bacillus megaterium DSM 319]
          Length = 89

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A   ++TIL  S P+L  A+ +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MNGEFVISLAEKGVYTILIVSGPLLLLALVVGLIISIFQATTQIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++  ++ SF   + S +
Sbjct: 61 GIVFFGPWMLSKMISFTHEIFSNL 84


>gi|254973926|ref|ZP_05270398.1| flagellar export protein [Clostridium difficile QCD-66c26]
 gi|255091313|ref|ZP_05320791.1| flagellar export protein [Clostridium difficile CIP 107932]
 gi|255305287|ref|ZP_05349459.1| flagellar export protein [Clostridium difficile ATCC 43255]
 gi|255312970|ref|ZP_05354553.1| flagellar export protein [Clostridium difficile QCD-76w55]
 gi|255515729|ref|ZP_05383405.1| flagellar export protein [Clostridium difficile QCD-97b34]
 gi|255648823|ref|ZP_05395725.1| flagellar export protein [Clostridium difficile QCD-37x79]
 gi|260682042|ref|YP_003213327.1| flagellar export protein [Clostridium difficile CD196]
 gi|260685640|ref|YP_003216773.1| flagellar export protein [Clostridium difficile R20291]
 gi|306518938|ref|ZP_07405285.1| flagellar export protein [Clostridium difficile QCD-32g58]
 gi|260208205|emb|CBA60556.1| flagellar export protein [Clostridium difficile CD196]
 gi|260211656|emb|CBE01919.1| flagellar export protein [Clostridium difficile R20291]
          Length = 89

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  ++ + +  M+T    +APVL  ++ +G+LI+  QA TQIQE TLTFVPK+IA+ +
Sbjct: 1  MSEFMIMSVLKNGMFTGAMIAAPVLIVSLVVGLLISVFQATTQIQEQTLTFVPKLIAILL 60

Query: 61 TLIISAPFIGGQISSF 76
           + I   ++   + SF
Sbjct: 61 VVAIGGSWMLHTLISF 76


>gi|238752376|ref|ZP_04613854.1| Secretion system apparatus protein ssaS [Yersinia rohdei ATCC
          43380]
 gi|238709417|gb|EEQ01657.1| Secretion system apparatus protein ssaS [Yersinia rohdei ATCC
          43380]
          Length = 89

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ +A   +W +L  S PV+  A  +G++++ LQALTQIQ+ TL F+ K++AV  
Sbjct: 1  MSNAIVVHLATQLLWIVLLLSMPVVVVASAVGLIVSLLQALTQIQDQTLQFLIKLLAVSA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+++  ++G  + ++
Sbjct: 61 TLLLTYHWMGTTLLNY 76


>gi|322421720|ref|YP_004200943.1| flagellar biosynthetic protein FliQ [Geobacter sp. M18]
 gi|320128107|gb|ADW15667.1| flagellar biosynthetic protein FliQ [Geobacter sp. M18]
          Length = 89

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 47/76 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R +   ++  SAP+L  A+ +G+LI+  QA+T I E TL F PKIIAV +
Sbjct: 1  MTPEMVVQLGRRSFEAVILLSAPLLICALVVGLLISIFQAVTSINEATLAFAPKIIAVMV 60

Query: 61 TLIISAPFIGGQISSF 76
           +++  P++   +S F
Sbjct: 61 AMVVFFPWMMMYMSDF 76


>gi|239826629|ref|YP_002949253.1| flagellar biosynthesis protein FliQ [Geobacillus sp. WCH70]
 gi|239806922|gb|ACS23987.1| flagellar biosynthetic protein FliQ [Geobacillus sp. WCH70]
          Length = 89

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 4  AD-VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          AD V+ +A   ++ IL    P+L  A+ +G++++  QA+TQIQE TL FVPKI+AV I L
Sbjct: 3  ADFVIHMAERGVYMILIVCGPLLLLALAVGLIVSIFQAMTQIQEQTLAFVPKIVAVLIGL 62

Query: 63 IISAPFIGGQISSFVTLVLSRI 84
          I   P++  ++ S+   + + +
Sbjct: 63 IFFGPWMLSRMVSYAYEIFNNL 84


>gi|183221910|ref|YP_001839906.1| flagellar biosynthetic protein FliQ [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Paris)']
 gi|189911979|ref|YP_001963534.1| endoflagellar biosynthesis pathway protein [Leptospira biflexa
          serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167776655|gb|ABZ94956.1| Endoflagellar biosynthesis pathway protein [Leptospira biflexa
          serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167780332|gb|ABZ98630.1| Flagellar biosynthetic protein FliQ [Leptospira biflexa serovar
          Patoc strain 'Patoc 1 (Paris)']
          Length = 87

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M E DV+ + R A    L  S+P+L +A+ +G+++  LQ  T IQE T+ FVPK++++F
Sbjct: 1  MTEVDVVNMMREAFIVTLKISSPILITALVVGLIVGILQTTTSIQEPTIAFVPKLVSIF 59


>gi|253573535|ref|ZP_04850878.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. oral taxon
          786 str. D14]
 gi|251847063|gb|EES75068.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. oral taxon
          786 str. D14]
          Length = 89

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++T+L  SAP+L  A+ +G+L++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSSEFIIGLAGQAVYTVLKVSAPMLVIALVVGLLVSIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L++  P+I   +  F   +L+ + S
Sbjct: 61 ALLLFGPWILTTLVDFTYGILNNLSS 86


>gi|161503486|ref|YP_001570598.1| hypothetical protein SARI_01562 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864833|gb|ABX21456.1| hypothetical protein SARI_01562 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
          Length = 88

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN++++ +     +W +L +S PV+  A  +G++++ +QALTQIQ+ TL F+ K++A+  
Sbjct: 1  MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAT 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL++S P++ G + ++   ++ RI
Sbjct: 61 TLMVSYPWLSGILLNYTRQIMLRI 84


>gi|295696129|ref|YP_003589367.1| flagellar biosynthetic protein FliQ [Bacillus tusciae DSM 2912]
 gi|295411731|gb|ADG06223.1| flagellar biosynthetic protein FliQ [Bacillus tusciae DSM 2912]
          Length = 89

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 11/88 (12%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  +VL+I +  +   L  S P L   + +G++I+  QA+TQIQE TLTF+PK++AVF 
Sbjct: 1  MSPDNVLQIGQETLRIALLLSLPFLGFTLVVGLIISIFQAVTQIQEPTLTFLPKVLAVFA 60

Query: 61 TLIISAPF-----------IGGQISSFV 77
           +++  P+           I GQ+S F+
Sbjct: 61 VILLLGPWMLHTLLDYTEGIFGQLSGFI 88


>gi|296124298|ref|YP_003632076.1| export protein FliQ family 3 [Planctomyces limnophilus DSM 3776]
 gi|296016638|gb|ADG69877.1| export protein FliQ family 3 [Planctomyces limnophilus DSM 3776]
          Length = 91

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     LE+ R A+   L    P L SAM +G++I+  QA+TQ+QE TL+FVPK++ + +
Sbjct: 1  MTSDTALELCRNAVVVALMVCLPSLMSAMLVGLIISLAQAVTQLQEQTLSFVPKLVIMLL 60

Query: 61 TLIISAPFIGGQISSF 76
            +++ P+    + S+
Sbjct: 61 VALLTLPWSMSLMDSY 76


>gi|310659026|ref|YP_003936747.1| flagellar biosynthesis protein [Clostridium sticklandii DSM 519]
 gi|308825804|emb|CBH21842.1| flagellar biosynthesis protein [Clostridium sticklandii]
          Length = 89

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ I + ++  +L  SAP+L   + +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MDMDLVVGIMQQSLTMVLLLSAPMLIIGLLVGLIVSVFQATTQIQEATLAFVPKIVAVML 60

Query: 61 TLIISAPFIGGQISSF 76
          ++++  P++   + +F
Sbjct: 61 SMVVFGPWMMSSMVNF 76


>gi|149912832|ref|ZP_01901366.1| flagellar biosynthetic protein FliQ [Roseobacter sp. AzwK-3b]
 gi|149813238|gb|EDM73064.1| flagellar biosynthetic protein FliQ [Roseobacter sp. AzwK-3b]
          Length = 89

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 44/76 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++E    +  R  +W  L  S P+L  A+  G+++   QALT IQE+TLTFVPK+ A+ +
Sbjct: 2  LDEVVFFDTMREGLWVSLIISVPILTMALLAGLIVGLFQALTSIQELTLTFVPKLGAIVL 61

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   + SF
Sbjct: 62 VFWLSMGFMTQTLVSF 77


>gi|148553143|ref|YP_001260725.1| flagellar biosynthetic protein FliQ [Sphingomonas wittichii RW1]
 gi|148498333|gb|ABQ66587.1| flagellar biosynthetic protein FliQ [Sphingomonas wittichii RW1]
          Length = 93

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 8/84 (9%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          IA+ AMW +  +SAP+L  A+  GI++  +QA T I E TL+FVPK+I V I L +    
Sbjct: 13 IAQQAMWILALASAPILIPALVAGIILGMIQAATSINEQTLSFVPKLIVVGIALAL---- 68

Query: 69 IGGQI----SSFVTLVLSRIQSSL 88
           GG I    + F   + +RI   L
Sbjct: 69 FGGAILMLLADFTREIFARIPDML 92


>gi|325288790|ref|YP_004264971.1| flagellar biosynthetic protein FliQ [Syntrophobotulus glycolicus
          DSM 8271]
 gi|324964191|gb|ADY54970.1| flagellar biosynthetic protein FliQ [Syntrophobotulus glycolicus
          DSM 8271]
          Length = 90

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 53/76 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  ++ +A+ AMWT+L    P+L  ++ +G++++  QA+TQIQE TL+F+PK++ + +
Sbjct: 1  MTQNQIIFMAKEAMWTVLLVGGPLLALSLLIGLVVSIFQAMTQIQEQTLSFIPKLVVIAV 60

Query: 61 TLIISAPFIGGQISSF 76
           L++  P++   ++S+
Sbjct: 61 ALLLLGPWMLNIMTSY 76


>gi|296133032|ref|YP_003640279.1| flagellar biosynthetic protein FliQ [Thermincola sp. JR]
 gi|296031610|gb|ADG82378.1| flagellar biosynthetic protein FliQ [Thermincola potens JR]
          Length = 89

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M    ++ I R A+ T+L  S P+L +++ +G++I+  QA T IQE TLTFVPKI+ + 
Sbjct: 1  MTPETIIGIGRDALITVLLISTPILATSLLIGVIISVFQAATHIQEQTLTFVPKILGIL 59


>gi|319764504|ref|YP_004128441.1| flagellar biosynthetic protein fliq [Alicycliphilus denitrificans
          BC]
 gi|317119065|gb|ADV01554.1| flagellar biosynthetic protein FliQ [Alicycliphilus denitrificans
          BC]
          Length = 89

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL + R A+  +L  + PVL   M +G+L++  QA+TQI E TL FVPK+IA  +   I+
Sbjct: 6  VLTMGRDALTLLLMIAMPVLGVVMAVGLLVSIFQAVTQIHEATLAFVPKLIAAMVVFAIA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++   IS+ V  +   I+S
Sbjct: 66 GPWM---ISTLVDFLRRTIES 83


>gi|242281273|ref|YP_002993402.1| flagellar biosynthetic protein FliQ [Desulfovibrio salexigens DSM
          2638]
 gi|242124167|gb|ACS81863.1| flagellar biosynthetic protein FliQ [Desulfovibrio salexigens DSM
          2638]
          Length = 89

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  A+ ++   L+ + P+L   + +GI ++ +QA TQIQE+TLTFVPKI+++F+
Sbjct: 1  MTPEFVIGFAKQSIELALTLALPMLMVGLVVGIFVSVIQAATQIQEMTLTFVPKIVSMFL 60

Query: 61 TLIISAPFIGGQISSF 76
           L+ + P+I  ++  F
Sbjct: 61 ALLFAFPWIMDKMIDF 76


>gi|295111381|emb|CBL28131.1| flagellar biosynthetic protein FliQ [Synergistetes bacterium
          SGP1]
          Length = 91

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 5/71 (7%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQ 72
          ++WT+L  S PVL  AM +G+LI  LQ  T IQE TL F+PKI+AVFI +I+ +P++G +
Sbjct: 15 SIWTMLVVSLPVLLVAMSVGLLIGILQTATSIQEQTLIFIPKILAVFICIILLSPWMGQR 74

Query: 73 ISSFVTLVLSR 83
          +     LV++R
Sbjct: 75 M-----LVMTR 80


>gi|33593239|ref|NP_880883.1| putative type III secretion protein [Bordetella pertussis Tohama
          I]
 gi|29603235|emb|CAC79580.1| bscS [Bordetella pertussis Tohama I]
 gi|33563614|emb|CAE42515.1| putative type III secretion protein [Bordetella pertussis Tohama
          I]
 gi|332382648|gb|AEE67495.1| putative type III secretion protein [Bordetella pertussis CS]
          Length = 88

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++     A++ +L  S P +     +G L + LQALTQ+QE TL+F  K+IAVF 
Sbjct: 1  MQTQDLVSFMTQALYLVLWLSLPPIAVVAIVGTLFSLLQALTQVQEQTLSFAVKLIAVFA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+++A +I  +I +F
Sbjct: 61 TLMLAARWISAEIYNF 76


>gi|84514805|ref|ZP_01002168.1| Flagellar protein FliQ [Loktanella vestfoldensis SKA53]
 gi|84510964|gb|EAQ07418.1| Flagellar protein FliQ [Loktanella vestfoldensis SKA53]
          Length = 88

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E  RAA W I+ +S P+L  A+ +G++I  LQA T I E+TL+FVPK++ V   +   +
Sbjct: 7  IESLRAAFWQIIIASGPILGVALTVGLIIGILQAATSINEMTLSFVPKLVIVLAAMAALS 66

Query: 67 PFIGGQISSFVTLVLSRIQ 85
           F+  +++ +   +  +I+
Sbjct: 67 SFMMQEMTDYFASIFEQIR 85


>gi|225850262|ref|YP_002730496.1| flagellar biosynthetic protein FliQ [Persephonella marina EX-H1]
 gi|225645466|gb|ACO03652.1| flagellar biosynthetic protein FliQ [Persephonella marina EX-H1]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 47/84 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     + + +  ++T L    PV+  A  +G+LI+  QA TQI E+TLTF+PKI+A  +
Sbjct: 1  MTVDQAINLMQGMLFTSLMVGGPVILIAFIVGLLISIFQAATQIHEMTLTFIPKIVATIV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           LII   ++  Q+  +   VL  I
Sbjct: 61 ALIIFGSWMFRQLVEYTQEVLKNI 84


>gi|330826720|ref|YP_004390023.1| flagellar biosynthetic protein FliQ [Alicycliphilus denitrificans
          K601]
 gi|329312092|gb|AEB86507.1| flagellar biosynthetic protein FliQ [Alicycliphilus denitrificans
          K601]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL + R A+  +L  + PVL   M +G+L++  QA+TQI E TL FVPK+IA  +   I+
Sbjct: 6  VLTMGRDALTLLLMIALPVLGVVMAVGLLVSIFQAVTQIHEATLAFVPKLIAAMVVFAIA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++   IS+ V  +   I+S
Sbjct: 66 GPWM---ISTLVDFLRRTIES 83


>gi|288573012|ref|ZP_06391369.1| export protein FliQ family 3 [Dethiosulfovibrio peptidovorans DSM
          11002]
 gi|288568753|gb|EFC90310.1| export protein FliQ family 3 [Dethiosulfovibrio peptidovorans DSM
          11002]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 18 LSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFV 77
          L +S P+L  AM +G+++  LQ  T IQE TL+FVPKIIA+   L++  P+I G +    
Sbjct: 18 LMASLPILIVAMVVGLIVGILQTATSIQEQTLSFVPKIIAIMGALVVMGPWIFGVVRKLA 77

Query: 78 TLVLSRIQ 85
            +L ++ 
Sbjct: 78 VDLLGQLD 85


>gi|238793339|ref|ZP_04636965.1| Secretion system apparatus protein ssaS [Yersinia intermedia ATCC
          29909]
 gi|238727308|gb|EEQ18836.1| Secretion system apparatus protein ssaS [Yersinia intermedia ATCC
          29909]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ +A   +W +L  S PV+  A  +G++++ LQALTQIQ+ TL F+ K++AV  
Sbjct: 1  MSNAIVVHLATQLLWIVLLLSMPVVVVASVVGLIVSLLQALTQIQDQTLQFLIKLLAVSA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+I+  ++G  + ++
Sbjct: 61 TLLITYHWMGATLLNY 76


>gi|225619291|ref|YP_002720517.1| flagellar biosynthetic protein FliQ [Brachyspira hyodysenteriae
          WA1]
 gi|296125239|ref|YP_003632491.1| flagellar biosynthetic protein FliQ [Brachyspira murdochii DSM
          12563]
 gi|225214110|gb|ACN82844.1| flagellar biosynthetic protein (fliQ) [Brachyspira hyodysenteriae
          WA1]
 gi|296017055|gb|ADG70292.1| flagellar biosynthetic protein FliQ [Brachyspira murdochii DSM
          12563]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++  ++ + +  +W  +  SAPVL  ++ +G++I+ LQA T IQE TLTFVPK+IA+  
Sbjct: 1  MSDTSIIVLVQETLWVFMLLSAPVLGVSIIVGLIISILQATTSIQEQTLTFVPKMIAMLA 60

Query: 61 TLIISAPFIGGQISSF 76
           + + A ++    S+F
Sbjct: 61 VIYMLASWMLNYTSAF 76


>gi|227820526|ref|YP_002824497.1| type III secretion component, RhcS [Sinorhizobium fredii NGR234]
 gi|227339525|gb|ACP23744.1| type III secretion component, RhcS [Sinorhizobium fredii NGR234]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 49/78 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++   L   + AM T+L +SAP L  A+ +G+ +  +QALTQIQ+ TL    K++AV +
Sbjct: 1  MDQTAFLAQMQKAMLTVLIASAPALAIAIVIGVSVGLIQALTQIQDQTLPQAVKLVAVML 60

Query: 61 TLIISAPFIGGQISSFVT 78
           L++  P +  Q+++F +
Sbjct: 61 ALVVLGPALAMQVANFAS 78


>gi|255021383|ref|ZP_05293431.1| Flagellar biosynthesis protein fliQ [Acidithiobacillus caldus
          ATCC 51756]
 gi|254969246|gb|EET26760.1| Flagellar biosynthesis protein fliQ [Acidithiobacillus caldus
          ATCC 51756]
          Length = 90

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +  I++ A+WT L  SAP+L  A+ +G+L++  QA TQI E+TL+FVPK++A+ +
Sbjct: 1  MSPESIASISQHALWTALLLSAPLLGVALVVGVLVSVFQAATQINEMTLSFVPKVLAMAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           LII  P++ G I  F   +   I
Sbjct: 61 VLIIGGPWMLGLIMHFTIQLFHNI 84


>gi|291519581|emb|CBK74802.1| flagellar biosynthetic protein FliQ [Butyrivibrio fibrisolvens
          16/4]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 52/78 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  VL+I R A++T+L +S P+L  ++ +G+ I+  Q +T IQE TLTF+PKI+ VF 
Sbjct: 1  MTEGQVLDIIRDAVYTLLITSLPLLLVSLIVGLAISIFQTVTSIQEQTLTFIPKIVGVFA 60

Query: 61 TLIISAPFIGGQISSFVT 78
           L+   P++   ++ ++T
Sbjct: 61 ALLFFGPWMLTVLTEYIT 78


>gi|57434471|emb|CAI43888.1| EscS protein [Escherichia coli]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++    +W I   S P + +A  LGI+I+ +QA+TQ+Q+ TL F+ KIIAVF 
Sbjct: 1  METGYFVQLCVQTLWIIFILSLPTVIAASVLGIIISLVQAITQLQDQTLPFLLKIIAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  I +F +++   I
Sbjct: 61 TLALTYHWMGTTIINFSSIIFEMI 84


>gi|222112239|ref|YP_002554503.1| flagellar biosynthetic protein fliq [Acidovorax ebreus TPSY]
 gi|221731683|gb|ACM34503.1| flagellar biosynthetic protein FliQ [Acidovorax ebreus TPSY]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + R A+  +L  S PVL   M +G+L++  QA+TQI E TL FVPK+IA  +
Sbjct: 1  MTSQFVLTMGRDALTLLLMISMPVLGVVMAVGLLVSIFQAVTQIHEATLAFVPKLIAAVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
             I+ P++   +  F+   +  I S
Sbjct: 61 VFAIAGPWMLTTLVDFLRRTIEAIPS 86


>gi|114762162|ref|ZP_01441630.1| flagellar biosynthetic protein FliQ [Pelagibaca bermudensis
          HTCC2601]
 gi|114545186|gb|EAU48189.1| flagellar biosynthetic protein FliQ [Roseovarius sp. HTCC2601]
          Length = 89

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++E    +  R  +W    +S P+L +A+  G+ +   QALT +QE+TLTFVPK++A+ +
Sbjct: 2  LSETIFYDTLRQGLWVATITSVPILTAALLAGVGVGLFQALTSVQEMTLTFVPKLLAIVV 61

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   +  F
Sbjct: 62 VFWMSMSFMSETLVGF 77


>gi|241763644|ref|ZP_04761694.1| flagellar biosynthetic protein FliQ [Acidovorax delafieldii 2AN]
 gi|241367119|gb|EER61485.1| flagellar biosynthetic protein FliQ [Acidovorax delafieldii 2AN]
          Length = 89

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +   A+  +L  + PVL   M +G+L++  QA+TQIQE TL FVPK+IA  +
Sbjct: 1  MTSQLVLTMGSEALTLLLMIAMPVLGVVMAVGLLVSIFQAVTQIQEATLAFVPKLIAAMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
             I+ P++   +  ++  V+  I S
Sbjct: 61 VFAIAGPWMISTLVDYIRRVIESIPS 86


>gi|218549274|ref|YP_002383065.1| flagellar biosynthesis protein FliQ [Escherichia fergusonii ATCC
          35469]
 gi|218356815|emb|CAQ89443.1| flagellar biosynthesis protein [Escherichia fergusonii ATCC
          35469]
 gi|324114208|gb|EGC08181.1| flagellar biosynthetic protein FliQ [Escherichia fergusonii B253]
 gi|325497691|gb|EGC95550.1| flagellar biosynthesis protein FliQ [Escherichia fergusonii
          ECD227]
          Length = 89

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 40/55 (72%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+ LQA TQI E+TL+F+PKI+AVFI +I++ P++   +  +V  + S I S
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLSLLLDYVRTLFSNIPS 86


>gi|90415341|ref|ZP_01223275.1| Flagellar biosynthesis/type III secretory pathway protein [marine
          gamma proteobacterium HTCC2207]
 gi|90332664|gb|EAS47834.1| Flagellar biosynthesis/type III secretory pathway protein [marine
          gamma proteobacterium HTCC2207]
          Length = 89

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+++ R A+W  +  ++P+L  A+ +G+++   QA T IQE+TL+F+PK+  + +
Sbjct: 1  MDPALVIDLGREALWVAVMVASPLLGVALGVGLIVGIFQAATSIQEMTLSFIPKLGIMVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+I   +  G +  ++  +  RI +
Sbjct: 61 ALLIFGSWQIGVMVDYIQRIYERIPA 86


>gi|284007638|emb|CBA73295.1| type III secretion protein EscS,SsaS,YscS [Arsenophonus nasoniae]
          Length = 74

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (64%)

Query: 14 MWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQI 73
          +W +L  S P++  A   G+L++ LQALTQIQ+ TL F+ K++AV ITL +S  ++G  +
Sbjct: 2  LWIVLLLSLPIVIVASITGLLVSILQALTQIQDQTLQFLIKLVAVCITLAVSYHWMGSAL 61

Query: 74 SSFVTLVLSRI 84
           ++  L   +I
Sbjct: 62 LNYAILSFDQI 72


>gi|83646793|ref|YP_435228.1| flagellar biosynthetic protein FliQ [Hahella chejuensis KCTC
          2396]
 gi|83634836|gb|ABC30803.1| flagellar biosynthetic protein FliQ [Hahella chejuensis KCTC
          2396]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 40/58 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          MN    + +    +WT +  +AP+L  ++ +G++I+ LQ +TQIQE+TLTFVPKI AV
Sbjct: 1  MNADLAMMLTEDMLWTAVLVAAPILIVSLVVGLIISILQVVTQIQEMTLTFVPKIGAV 58


>gi|221069287|ref|ZP_03545392.1| flagellar biosynthetic protein FliQ [Comamonas testosteroni KF-1]
 gi|264676605|ref|YP_003276511.1| flagellar biosynthetic protein FliQ [Comamonas testosteroni
          CNB-2]
 gi|299531250|ref|ZP_07044660.1| flagellar biosynthetic protein FliQ [Comamonas testosteroni S44]
 gi|220714310|gb|EED69678.1| flagellar biosynthetic protein FliQ [Comamonas testosteroni KF-1]
 gi|262207117|gb|ACY31215.1| flagellar biosynthetic protein FliQ [Comamonas testosteroni
          CNB-2]
 gi|298720657|gb|EFI61604.1| flagellar biosynthetic protein FliQ [Comamonas testosteroni S44]
          Length = 89

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (54%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL   R A+  +L  S PVL   M +G+L++  QA+TQ+ E TL FVPK+IA  +
Sbjct: 1  MTSQFVLTFGREALTLLLMISMPVLGVVMGVGLLVSVFQAVTQVHEATLAFVPKLIAAVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
             ++ P++   +  F+   +  I  S+
Sbjct: 61 VFAVAGPWMLSTLVDFIRRTIESIPGSV 88


>gi|294679033|ref|YP_003579648.1| flagellar biosynthetic protein FliQ [Rhodobacter capsulatus SB
          1003]
 gi|294477853|gb|ADE87241.1| flagellar biosynthetic protein FliQ [Rhodobacter capsulatus SB
          1003]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          R  +W  +  SAP+L  A+  G+ I   QALT +QE+TLTFVPK+ A+ +   +S  F+ 
Sbjct: 11 REGLWIAVMISAPMLVVALVAGVAIGLFQALTSVQEMTLTFVPKVGAMLVVYWVSMSFMS 70

Query: 71 GQISSFVT 78
            +  F T
Sbjct: 71 ETLVDFFT 78


>gi|152965633|ref|YP_001361417.1| export protein FliQ family 3 [Kineococcus radiotolerans SRS30216]
 gi|151360150|gb|ABS03153.1| export protein FliQ family 3 [Kineococcus radiotolerans SRS30216]
          Length = 92

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 52/88 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ I   A+      SAP+L +A+ +G  I+  Q++TQ+QE T+ FVPK +AV I
Sbjct: 1  MTDVTVIHIGMTALVLAAKLSAPMLLTALAVGFGISLFQSVTQLQEQTIAFVPKAVAVGI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++   ++  +++ F + +  +I S L
Sbjct: 61 AIVVCGKWMLHELTGFTSTLYGQIPSLL 88


>gi|227873534|ref|ZP_03991779.1| flagellar biosynthesis protein FliQ [Oribacterium sinus F0268]
 gi|227840624|gb|EEJ51009.1| flagellar biosynthesis protein FliQ [Oribacterium sinus F0268]
          Length = 88

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 47/84 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++ A++L+I        L  + P L  +M LGI+IA  QA T I E TLTFVPK+IA+ I
Sbjct: 2  LDSAEILDIMNQTFMLSLRIAMPFLLVSMILGIVIAIFQAATSINEQTLTFVPKLIAIII 61

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L +    +   +  F T+++  +
Sbjct: 62 MLTVLGGTLLKTMQDFFTMIMKMV 85


>gi|296274403|ref|YP_003657034.1| export protein FliQ family 3 [Arcobacter nitrofigilis DSM 7299]
 gi|296098577|gb|ADG94527.1| export protein FliQ family 3 [Arcobacter nitrofigilis DSM 7299]
          Length = 90

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 50/74 (67%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
            D++ IA++ +  IL  + P L  +M +G+LI+  QA+TQI +  L+FVPK+I V I +
Sbjct: 2  NMDLMGIAQSTVKIILLLALPSLLVSMVIGLLISVFQAVTQISDAALSFVPKVIFVSIFI 61

Query: 63 IISAPFIGGQISSF 76
          +IS P+IG  +S++
Sbjct: 62 LISLPWIGDNVSTY 75


>gi|83647845|ref|YP_436280.1| flagellar biosynthesis protein FliQ [Hahella chejuensis KCTC
          2396]
 gi|83635888|gb|ABC31855.1| flagellar biosynthetic protein FliQ [Hahella chejuensis KCTC
          2396]
          Length = 89

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL+I R A+W I++    ++  ++ +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPEVVLDIFREALWLIVTLVTLIVAPSLVVGLIVSIFQAATQINEQTLSFLPRLLVTLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +II+ P++  Q+  +  ++++ I  
Sbjct: 61 VIIIAGPWMLTQLMEYTDMLITSIPD 86


>gi|290475715|ref|YP_003468604.1| flagellar biosynthesis protein [Xenorhabdus bovienii SS-2004]
 gi|289175037|emb|CBJ81840.1| flagellar biosynthesis [Xenorhabdus bovienii SS-2004]
          Length = 89

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 42/55 (76%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+ LQA TQI E+TL+F+PKI+AVF+T++I+ P++   +  ++ ++ S I +
Sbjct: 32 GLVISLLQAATQINEMTLSFIPKILAVFVTIVIAGPWMLNLLLDYMRVLFSSIPT 86


>gi|283786651|ref|YP_003366516.1| T3SS structural protein EscS [Citrobacter rodentium ICC168]
 gi|15723908|gb|AAL06355.1|AF311901_7 EscS [Citrobacter rodentium]
 gi|282950105|emb|CBG89740.1| T3SS structural protein EscS [Citrobacter rodentium ICC168]
          Length = 89

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++    +W I   S P + +A  +GI+I+ +QA+TQ+Q+ TL F+ KIIAVF 
Sbjct: 1  MGTGYFVQLCVQTLWIIFILSLPTVIAASVIGIIISLIQAITQLQDQTLPFLLKIIAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  I +F +++   I
Sbjct: 61 TLALTYHWMGTTIINFSSIIFEMI 84


>gi|291285070|ref|YP_003501888.1| EscS [Escherichia coli O55:H7 str. CB9615]
 gi|290764943|gb|ADD58904.1| EscS [Escherichia coli O55:H7 str. CB9615]
          Length = 90

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +++     W I   S P + +A  +GI+I+ +QA+TQ+Q+ TL F+ KIIAVF 
Sbjct: 2  MDTGYFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQDQTLPFLLKIIAVFA 61

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  I +F +++   I
Sbjct: 62 TLALTYHWMGTTIINFSSIIFEMI 85


>gi|148261122|ref|YP_001235249.1| export protein FliQ [Acidiphilium cryptum JF-5]
 gi|326404523|ref|YP_004284605.1| flagellar biosynthetic protein FliQ [Acidiphilium multivorum
          AIU301]
 gi|146402803|gb|ABQ31330.1| export protein FliQ, family 3 [Acidiphilium cryptum JF-5]
 gi|325051385|dbj|BAJ81723.1| flagellar biosynthetic protein FliQ [Acidiphilium multivorum
          AIU301]
          Length = 88

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (69%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          SAP L +A+  G++I+ LQA+TQI E T+ F+PK+ AV  TL+I   F+ G +S F
Sbjct: 21 SAPPLLAALVAGVVISLLQAVTQINEATIVFLPKMAAVAGTLMIMGSFLLGTLSQF 76


>gi|260778659|ref|ZP_05887551.1| type III secretion protein YscS [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260604823|gb|EEX31118.1| type III secretion protein YscS [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 89

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEA ++      +W +L  S PV+  A  +GIL++  QALTQIQ+ +L F+ K++AV I
Sbjct: 1  MNEAVIIHFTSELLWLVLILSLPVVVVASAVGILVSLFQALTQIQDQSLQFLIKLVAVCI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL +S  ++G  + ++  L   +I
Sbjct: 61 TLAVSYHWMGSTLLNYAGLAFDQI 84


>gi|15804243|ref|NP_290282.1| hypothetical protein Z5134 [Escherichia coli O157:H7 EDL933]
 gi|15833836|ref|NP_312609.1| EscS [Escherichia coli O157:H7 str. Sakai]
 gi|168748641|ref|ZP_02773663.1| EscS [Escherichia coli O157:H7 str. EC4113]
 gi|168753532|ref|ZP_02778539.1| EscS [Escherichia coli O157:H7 str. EC4401]
 gi|168766129|ref|ZP_02791136.1| EscS [Escherichia coli O157:H7 str. EC4486]
 gi|168772322|ref|ZP_02797329.1| EscS [Escherichia coli O157:H7 str. EC4196]
 gi|168785597|ref|ZP_02810604.1| EscS [Escherichia coli O157:H7 str. EC869]
 gi|195936265|ref|ZP_03081647.1| EscS [Escherichia coli O157:H7 str. EC4024]
 gi|208820696|ref|ZP_03261016.1| EscS [Escherichia coli O157:H7 str. EC4042]
 gi|215488993|ref|YP_002331424.1| T3SS structure protein EscS [Escherichia coli O127:H6 str.
          E2348/69]
 gi|254795657|ref|YP_003080494.1| LEE-encoded type III secretion system factor [Escherichia coli
          O157:H7 str. TW14359]
 gi|260869700|ref|YP_003236102.1| T3SS structure protein EscS [Escherichia coli O111:H- str. 11128]
 gi|261225801|ref|ZP_05940082.1| LEE-encoded type III secretion system factor [Escherichia coli
          O157:H7 str. FRIK2000]
 gi|261258846|ref|ZP_05951379.1| T3SS structure protein EscS [Escherichia coli O157:H7 str.
          FRIK966]
 gi|12518476|gb|AAG58846.1|AE005597_4 escS [Escherichia coli O157:H7 str. EDL933]
 gi|2865277|gb|AAC38370.1| EscS [Escherichia coli]
 gi|3414916|gb|AAC31527.1| L0048 [Escherichia coli]
 gi|13364057|dbj|BAB38005.1| type III secretion system EscS protein [Escherichia coli O157:H7
          str. Sakai]
 gi|54311601|emb|CAG17516.1| EscS protein [Escherichia coli]
 gi|187771589|gb|EDU35433.1| EscS [Escherichia coli O157:H7 str. EC4196]
 gi|188016981|gb|EDU55103.1| EscS [Escherichia coli O157:H7 str. EC4113]
 gi|189359091|gb|EDU77510.1| EscS [Escherichia coli O157:H7 str. EC4401]
 gi|189364420|gb|EDU82839.1| EscS [Escherichia coli O157:H7 str. EC4486]
 gi|189374337|gb|EDU92753.1| EscS [Escherichia coli O157:H7 str. EC869]
 gi|195957533|gb|ACG59644.1| type III secretion system protein EscS [Escherichia coli O157:H7]
 gi|195957592|gb|ACG59702.1| type III secretion system protein EscS [Escherichia coli]
 gi|195957649|gb|ACG59758.1| EscS [Escherichia coli]
 gi|208740819|gb|EDZ88501.1| EscS [Escherichia coli O157:H7 str. EC4042]
 gi|215267065|emb|CAS11510.1| T3SS structure protein EscS [Escherichia coli O127:H6 str.
          E2348/69]
 gi|221361439|emb|CAX18592.1| Type III secretion system, LEE associated [Escherichia coli]
 gi|221361496|emb|CAX18667.1| Type III secretion system, LEE associated [Escherichia coli]
 gi|221361557|emb|CAX18747.1| Type III secretion system, LEE associated [Escherichia coli]
 gi|254595057|gb|ACT74418.1| LEE-encoded type III secretion system factor [Escherichia coli
          O157:H7 str. TW14359]
 gi|255348330|gb|ACU09472.1| hypothetical protein [Escherichia coli]
 gi|257766056|dbj|BAI37551.1| T3SS structure protein EscS [Escherichia coli O111:H- str. 11128]
 gi|320639372|gb|EFX08987.1| EscS [Escherichia coli O157:H7 str. G5101]
 gi|320644816|gb|EFX13852.1| EscS [Escherichia coli O157:H- str. 493-89]
 gi|320650080|gb|EFX18576.1| EscS [Escherichia coli O157:H- str. H 2687]
 gi|320655427|gb|EFX23362.1| EscS [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320661053|gb|EFX28489.1| EscS [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666179|gb|EFX33185.1| EscS [Escherichia coli O157:H7 str. LSU-61]
 gi|323178896|gb|EFZ64472.1| type III secretion protein, HrpO family protein [Escherichia coli
          1180]
          Length = 89

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +++     W I   S P + +A  +GI+I+ +QA+TQ+Q+ TL F+ KIIAVF 
Sbjct: 1  MDTGYFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQDQTLPFLLKIIAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  I +F +++   I
Sbjct: 61 TLALTYHWMGTTIINFSSIIFEMI 84


>gi|85706169|ref|ZP_01037264.1| flagellar biosynthetic protein FliQ [Roseovarius sp. 217]
 gi|85669333|gb|EAQ24199.1| flagellar biosynthetic protein FliQ [Roseovarius sp. 217]
          Length = 89

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          +NE    +  R A+W  +  S P+L  A+  G+++   QALT IQE+TLTFVPK+ A+ +
Sbjct: 2  LNEVLFFDTLREALWISVIISFPILTVALLAGLVVGLFQALTSIQELTLTFVPKLGAIIV 61

Query: 61 TLIISAPFI 69
             ++  F+
Sbjct: 62 VFWVTMGFM 70


>gi|42525571|ref|NP_970669.1| flagellar biosynthetic protein FliQ [Treponema denticola ATCC
          35405]
 gi|13122807|gb|AAK12643.1|AF232219_2 FliQ [Treponema denticola]
 gi|41815582|gb|AAS10550.1| flagellar biosynthetic protein FliQ [Treponema denticola ATCC
          35405]
 gi|325475309|gb|EGC78494.1| FliQ [Treponema denticola F0402]
          Length = 89

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M    ++ + R  +  IL  SAP+L +A+ +G+++A  QA T IQE TLTFVPKI+ + 
Sbjct: 1  MTTGTIVTLMREGIGIILMLSAPILVAALLVGLIVAIFQATTSIQEQTLTFVPKILTIL 59


>gi|58039959|ref|YP_191923.1| flagellar biosynthetic protein FliQ [Gluconobacter oxydans 621H]
 gi|58002373|gb|AAW61267.1| Flagellar biosynthetic protein FliQ [Gluconobacter oxydans 621H]
          Length = 90

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D+  I        L  SAP L +A+ +G+L++ +QA+TQ+ E TL+FVPK++A+  
Sbjct: 1  MQAIDLGAILEQTFLVALKLSAPALLTALGVGLLVSLVQAVTQLNEATLSFVPKVLAIGA 60

Query: 61 TLIISAPFIGGQISSF 76
           ++++  F+   + SF
Sbjct: 61 VMVMAGSFMTATLISF 76


>gi|237731997|ref|ZP_04562478.1| flagellar biosynthetic protein FliQ [Citrobacter sp. 30_2]
 gi|226907536|gb|EEH93454.1| flagellar biosynthetic protein FliQ [Citrobacter sp. 30_2]
          Length = 89

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+AVFI +I++ P++   +  +V  + S I
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNI 84


>gi|315140249|gb|ADT81119.1| RscS [Pseudomonas fluorescens]
          Length = 84

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 46/69 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLVVLLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIGGQI 73
          +  +IGG++
Sbjct: 62 TGRWIGGEL 70


>gi|170766904|ref|ZP_02901357.1| EscS protein [Escherichia albertii TW07627]
 gi|170124342|gb|EDS93273.1| EscS protein [Escherichia albertii TW07627]
          Length = 89

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++    +W I   S P + +A  +GI+I+ +QA+TQ+Q+ TL F+ KIIAVF 
Sbjct: 1  METGYFVQLCVQTLWIIFILSLPTVIAASVIGIIISLIQAITQLQDQTLPFLLKIIAVFS 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  I +F +++   I
Sbjct: 61 TLALTYHWMGTTIINFSSIIFEMI 84


>gi|121596083|ref|YP_987979.1| flagellar biosynthetic protein FliQ [Acidovorax sp. JS42]
 gi|120608163|gb|ABM43903.1| flagellar biosynthetic protein FliQ [Acidovorax sp. JS42]
          Length = 89

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + R A+  +L  + PVL   M +G+L++  QA+TQI E TL FVPK+IA  +
Sbjct: 1  MTSQFVLTMGRDALTLLLMIAMPVLGVVMAVGLLVSIFQAVTQIHEATLAFVPKLIAAVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
             I+ P++   +  F+   +  I S
Sbjct: 61 VFAIAGPWMLTTLVDFLRRTIEAIPS 86


>gi|95929865|ref|ZP_01312606.1| flagellar biosynthetic protein FliQ [Desulfuromonas acetoxidans
          DSM 684]
 gi|95134161|gb|EAT15819.1| flagellar biosynthetic protein FliQ [Desulfuromonas acetoxidans
          DSM 684]
          Length = 89

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 49/64 (76%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++ R A+ T+L  S+P+L S + +G+L++  QA TQI E T+TF+PKI+AV ++LI+ 
Sbjct: 6  VIDLGRNAVKTVLLISSPMLLSGLIIGLLVSIFQAATQINEQTMTFIPKIVAVLVSLILF 65

Query: 66 APFI 69
          AP+I
Sbjct: 66 APWI 69


>gi|193062068|ref|ZP_03043164.1| EscS protein [Escherichia coli E22]
 gi|194426251|ref|ZP_03058806.1| EscS protein [Escherichia coli B171]
 gi|260845711|ref|YP_003223489.1| T3SS structure protein EscS [Escherichia coli O103:H2 str. 12009]
 gi|260858248|ref|YP_003232139.1| T3SS structure protein EscS [Escherichia coli O26:H11 str. 11368]
 gi|13447702|gb|AAK26701.1|AF200363_9 EscS [Escherichia coli]
 gi|18034506|gb|AAL57528.1|AF453441_12 EscS [Escherichia coli]
 gi|17384636|emb|CAC81848.1| EscS protein [Escherichia coli]
 gi|192932288|gb|EDV84886.1| EscS protein [Escherichia coli E22]
 gi|194415559|gb|EDX31826.1| EscS protein [Escherichia coli B171]
 gi|195183212|dbj|BAG66757.1| T3SS structure protein EscS [Escherichia coli O111:H-]
 gi|254692326|emb|CAR47967.1| EscS protein [Escherichia coli]
 gi|254692394|emb|CAR48037.1| EscS protein [Escherichia coli]
 gi|257756897|dbj|BAI28399.1| T3SS structure protein EscS [Escherichia coli O26:H11 str. 11368]
 gi|257760858|dbj|BAI32355.1| T3SS structure protein EscS [Escherichia coli O103:H2 str. 12009]
 gi|323163023|gb|EFZ48856.1| type III secretion protein, HrpO family protein [Escherichia coli
          E128010]
          Length = 89

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++    +W I   S P + +A  +GI+I+ +QA+TQ+Q+ TL F+ KIIAVF 
Sbjct: 1  METGYFVQLCVQTLWIIFILSLPTVIAASVVGIIISLVQAITQLQDQTLPFLLKIIAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  I +F +++   I
Sbjct: 61 TLALTYHWMGTTIINFSSIIFEMI 84


>gi|260886650|ref|ZP_05897913.1| flagellar biosynthetic protein FliQ [Selenomonas sputigena ATCC
          35185]
 gi|330839519|ref|YP_004414099.1| flagellar biosynthetic protein FliQ [Selenomonas sputigena ATCC
          35185]
 gi|260863793|gb|EEX78293.1| flagellar biosynthetic protein FliQ [Selenomonas sputigena ATCC
          35185]
 gi|329747283|gb|AEC00640.1| flagellar biosynthetic protein FliQ [Selenomonas sputigena ATCC
          35185]
          Length = 89

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +++I + A+W +L  SAP+L   + +G+L++  QA T IQE TL F+PKIIAVF+
Sbjct: 1  MSSDLIIQIGQNALWIVLLVSAPMLGLGLAVGLLVSVFQATTSIQEATLAFIPKIIAVFV 60

Query: 61 TLIISAPFI 69
           ++I  P++
Sbjct: 61 AILIFGPWM 69


>gi|51598534|ref|YP_072722.1| flagellar biosynthesis protein [Borrelia garinii PBi]
 gi|51573105|gb|AAU07130.1| flagellar biosynthesis protein [Borrelia garinii PBi]
          Length = 87

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 57/86 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L + R ++  I+  SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +
Sbjct: 1  MTAGHILYLIRISIENIMILSAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T++I  P+I  ++  F  ++ +++Q+
Sbjct: 61 TIVIFGPWILNKLMQFTYMIFNQLQN 86


>gi|328496286|gb|AEB21290.1| FliQ [Yersinia ruckeri]
          Length = 89

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+L++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 32 GLLVSLLQAATQINEMTLSFIPKILAVFATMVIAGPWM 69


>gi|238755316|ref|ZP_04616659.1| Flagellar biosynthetic protein FliQ [Yersinia ruckeri ATCC 29473]
 gi|238706452|gb|EEP98826.1| Flagellar biosynthetic protein FliQ [Yersinia ruckeri ATCC 29473]
          Length = 83

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+L++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 26 GLLVSLLQAATQINEMTLSFIPKILAVFATMVIAGPWM 63


>gi|51587311|emb|CAE53688.1| putative HrcS [Pseudomonas fluorescens bv. III]
 gi|321399618|emb|CBJ44629.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTE-48-102]
 gi|321399622|emb|CBJ44632.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTE-48-104]
 gi|321399642|emb|CBJ44647.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-25-521]
 gi|321399666|emb|CBJ44665.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-621]
 gi|321399670|emb|CBJ44668.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-622]
 gi|321399674|emb|CBJ44671.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-623]
          Length = 84

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 46/69 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLVVLLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIGGQI 73
          +  +IGG++
Sbjct: 62 TGRWIGGEL 70


>gi|294500923|ref|YP_003564623.1| flagellar biosynthetic protein FliQ [Bacillus megaterium QM
          B1551]
 gi|294350860|gb|ADE71189.1| flagellar biosynthetic protein FliQ [Bacillus megaterium QM
          B1551]
          Length = 89

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A   ++TIL  S P+L  A+ +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MNGEFVISLAEKGVYTILIVSGPLLLLALVIGLIISIFQATTQIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++  ++ SF   + S +
Sbjct: 61 GIVFFGPWMLSKMISFTYEIFSNL 84


>gi|149203127|ref|ZP_01880098.1| export protein FliQ, family 3 [Roseovarius sp. TM1035]
 gi|149143673|gb|EDM31709.1| export protein FliQ, family 3 [Roseovarius sp. TM1035]
          Length = 89

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          +NE    +  R ++W  +  S P+L  A+  G+++   QALT IQE+TLTFVPK+ A+ +
Sbjct: 2  LNEVLFFDTLRESLWISVIISFPILAVALLAGLVVGLFQALTSIQELTLTFVPKLGAIIV 61

Query: 61 TLIISAPFIGGQISSF 76
             I+  F+   + +F
Sbjct: 62 VFWITMGFMTQTLVTF 77


>gi|195953031|ref|YP_002121321.1| flagellar biosynthetic protein FliQ [Hydrogenobaculum sp.
          Y04AAS1]
 gi|195932643|gb|ACG57343.1| flagellar biosynthetic protein FliQ [Hydrogenobaculum sp.
          Y04AAS1]
          Length = 89

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M++  VL I    +   +  SAP+L +   +G+LI+ LQ+ TQIQE+TL+++PKI+A F
Sbjct: 1  MSQDQVLTITENMLKMTVLLSAPILLTTFIVGLLISILQSATQIQEMTLSYIPKILAAF 59


>gi|319790412|ref|YP_004152045.1| flagellar biosynthetic protein FliQ [Thermovibrio ammonificans
          HB-1]
 gi|317114914|gb|ADU97404.1| flagellar biosynthetic protein FliQ [Thermovibrio ammonificans
          HB-1]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    ++ + R  +   L   APVL    F+GI I+ LQA TQI E+TLTF+PKI+A F+
Sbjct: 1  MTVEQIIFLGRQMLEVALLVGAPVLLITFFVGIAISVLQAATQIHEMTLTFIPKILAAFV 60

Query: 61 TLII 64
           + I
Sbjct: 61 AIFI 64


>gi|300722651|ref|YP_003711941.1| flagellar biosynthesis protein [Xenorhabdus nematophila ATCC
          19061]
 gi|297629158|emb|CBJ89754.1| flagellar biosynthesis [Xenorhabdus nematophila ATCC 19061]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 34/38 (89%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQ+ E+TL+F+PKI+AVF+T++I+ P++
Sbjct: 32 GLIISLLQAATQVNEMTLSFIPKILAVFVTIVIAGPWM 69


>gi|296534148|ref|ZP_06896644.1| flagellar biosynthetic protein FliQ [Roseomonas cervicalis ATCC
          49957]
 gi|296265524|gb|EFH11653.1| flagellar biosynthetic protein FliQ [Roseomonas cervicalis ATCC
          49957]
          Length = 92

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 1  MNEADVLEIA-RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          M E+DV+ +A + A+WT L    P+L   + +G++IA LQALTQ+QE  L FVPK
Sbjct: 1  MVESDVIALAGQQALWTALLVGGPLLGILLAVGLVIAILQALTQVQEAALAFVPK 55


>gi|149928151|ref|ZP_01916397.1| flagellar biosynthetic protein FliQ [Limnobacter sp. MED105]
 gi|149823136|gb|EDM82374.1| flagellar biosynthetic protein FliQ [Limnobacter sp. MED105]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 49/69 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VL + ++A+  +L  S P+L  A+ +G+L++ LQA TQI E+TL+F+PKI+ +F 
Sbjct: 1  MNSQTVLNLGQSALEVMLMVSGPLLVVALVVGLLVSILQAATQINEMTLSFIPKILGIFA 60

Query: 61 TLIISAPFI 69
          TL++  P++
Sbjct: 61 TLLLLGPWM 69


>gi|307293815|ref|ZP_07573659.1| flagellar biosynthetic protein FliQ [Sphingobium chlorophenolicum
          L-1]
 gi|306879966|gb|EFN11183.1| flagellar biosynthetic protein FliQ [Sphingobium chlorophenolicum
          L-1]
          Length = 90

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 1  MNEADV-LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M  AD  + +A+ A+W    ++AP+L  A+  G+LI  +QA T I E TL F+PKII V 
Sbjct: 1  MENADFFMGLAQQALWITALAAAPILIPALVAGVLIGMVQAATSINEQTLAFIPKIIVVG 60

Query: 60 ITLIISAPFIGGQISSFVTLVLSRIQSSL 88
            L++    I   I+ F   +  RI   L
Sbjct: 61 AMLVLFGGSIMVLIADFTREIFERIPDLL 89


>gi|301165897|emb|CBW25470.1| flagellar biosynthetic protein FliQ [Bacteriovorax marinus SJ]
          Length = 91

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (66%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I   A+   L  ++P+L  ++ +GIL++  QA+TQI E TL+F+PKI+ +   L+I AP
Sbjct: 8  DITNNAVKIALMIASPMLVGSLVMGILVSIFQAVTQINEQTLSFIPKILVIVGALVIFAP 67

Query: 68 FIGGQISSF 76
          ++   +++F
Sbjct: 68 WMSDTLTTF 76


>gi|299068761|emb|CBJ40001.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum CMR15]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  T+I++
Sbjct: 6  VLNMARQAMQVAMMVGAPMLLVSLVVGLLVAVFQAATQLNEQTLSFIPKLLAVAATMILA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++ G I  +   VL+ I +
Sbjct: 66 GPWVLGVIVDYTRDVLTNIPN 86


>gi|320107034|ref|YP_004182624.1| export protein FliQ family 3 [Terriglobus saanensis SP1PR4]
 gi|319925555|gb|ADV82630.1| export protein FliQ family 3 [Terriglobus saanensis SP1PR4]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V EIAR  +   +  SAPVL ++  + ++++ LQ LT IQ+ TLT VP+++ VF+
Sbjct: 1  MNPDQVAEIARHLLMEAMLLSAPVLIASCLVSVILSLLQTLTSIQDQTLTAVPRLLVVFV 60

Query: 61 TLIISAPF 68
             ++ P+
Sbjct: 61 AGTLTMPW 68


>gi|238782831|ref|ZP_04626860.1| Flagellar biosynthetic protein fliQ [Yersinia bercovieri ATCC
          43970]
 gi|238716254|gb|EEQ08237.1| Flagellar biosynthetic protein fliQ [Yersinia bercovieri ATCC
          43970]
          Length = 89

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   A+   L  +AP+LF+A+F G++++ LQA TQI E+TL+F+PKI+ +  
Sbjct: 1  MTPESVMAMGFQAIKVGLMIAAPLLFAALFTGLIVSVLQASTQINEMTLSFIPKILVIIA 60

Query: 61 TLIISAPFI 69
            II  P++
Sbjct: 61 VGIILGPWM 69


>gi|189023202|ref|YP_001932943.1| Flagellar biosynthesis protein FliQ [Brucella abortus S19]
 gi|306840130|ref|ZP_07472915.1| flagellar biosynthesis protein FliQ [Brucella sp. NF 2653]
 gi|189021776|gb|ACD74497.1| Flagellar biosynthesis protein FliQ [Brucella abortus S19]
 gi|306404775|gb|EFM61069.1| flagellar biosynthesis protein FliQ [Brucella sp. NF 2653]
          Length = 42

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 30/41 (73%)

Query: 48 TLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TLTFVPKII +F+ L ++APF+G QI++F  L  SRI+   
Sbjct: 2  TLTFVPKIIVIFVVLALTAPFVGAQINAFTLLAYSRIEKGF 42


>gi|157145257|ref|YP_001452576.1| flagellar biosynthesis protein FliQ [Citrobacter koseri ATCC
          BAA-895]
 gi|157082462|gb|ABV12140.1| hypothetical protein CKO_00994 [Citrobacter koseri ATCC BAA-895]
          Length = 89

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ I   AM   L+ +AP+L  A+F G++I+ LQA TQI E+TL+F+PKI+AVF 
Sbjct: 1  MTPESVMMIGTEAMKVALALAAPLLLVALFTGLIISILQAATQINEMTLSFIPKIVAVFT 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           +I++ P++   +  +V  + S +
Sbjct: 61 AIIVAGPWMLNLLLDYVRTLFSNL 84


>gi|27904582|ref|NP_777708.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. Bp
          (Baizongia pistaciae)]
 gi|38372221|sp|Q89AZ1|FLIQ_BUCBP RecName: Full=Flagellar biosynthetic protein FliQ
 gi|27903979|gb|AAO26813.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. Bp
          (Baizongia pistaciae)]
          Length = 90

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  S P+L SA+  G++++  QA TQI E TL+F+PKI AV +
Sbjct: 1  MTIESVMSLFYDAMKVTLMISLPLLLSALCCGLIVSIFQAATQINEQTLSFIPKIAAVLV 60

Query: 61 TLIISAPFI 69
          +++I  P++
Sbjct: 61 SIVIFGPWM 69


>gi|283832656|ref|ZP_06352397.1| flagellar biosynthetic protein FliQ [Citrobacter youngae ATCC
          29220]
 gi|291072330|gb|EFE10439.1| flagellar biosynthetic protein FliQ [Citrobacter youngae ATCC
          29220]
          Length = 83

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+AVFI +I++ P++   +  +V  + S +
Sbjct: 26 GLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNL 78


>gi|160939625|ref|ZP_02086973.1| hypothetical protein CLOBOL_04517 [Clostridium bolteae ATCC
          BAA-613]
 gi|158437416|gb|EDP15180.1| hypothetical protein CLOBOL_04517 [Clostridium bolteae ATCC
          BAA-613]
          Length = 87

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+EI + AM      + P+L  ++ +G+L+A  QA TQI E TLTFVPK+I + +
Sbjct: 1  MSAEQVMEIMKEAMLVAFEIAGPLLIISIAVGLLVAIFQAATQIHEQTLTFVPKLIVIAL 60

Query: 61 TLIISAPFIGGQISSFV 77
           L+    ++   ++ FV
Sbjct: 61 VLLALGSWMSKVMNEFV 77


>gi|254486554|ref|ZP_05099759.1| flagellar biosynthetic protein FliQ [Roseobacter sp. GAI101]
 gi|214043423|gb|EEB84061.1| flagellar biosynthetic protein FliQ [Roseobacter sp. GAI101]
          Length = 89

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          ++E    +  R  +W  L  S P+L  A+  G+ I  +QALT IQE+TLTFVPK+  +  
Sbjct: 2  IDEVIFYDTLRQGLWVALIISVPILTVALITGVTIGLVQALTSIQEMTLTFVPKLAGIGA 61

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   + SF
Sbjct: 62 VFWVSMSFMTETLVSF 77


>gi|213025464|ref|ZP_03339911.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. 404ty]
          Length = 82

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+AVFI +I++ P++   +  +V  + S +
Sbjct: 25 GLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNL 77


>gi|123442775|ref|YP_001006752.1| flagellar biosynthesis protein FliQ [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|332161331|ref|YP_004297908.1| flagellar biosynthesis protein FliQ [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|122089736|emb|CAL12589.1| flagellar biosynthetic protein FliQ [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|318605252|emb|CBY26750.1| flagellar biosynthesis protein FliQ [Yersinia enterocolitica
          subsp. palearctica Y11]
 gi|325665561|gb|ADZ42205.1| flagellar biosynthesis protein FliQ [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|330861095|emb|CBX71362.1| flagellar biosynthetic protein fliQ [Yersinia enterocolitica
          W22703]
          Length = 89

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF TL+I+ P++
Sbjct: 32 GLIVSLLQAATQINEMTLSFIPKILAVFATLVIAGPWM 69


>gi|16760924|ref|NP_456541.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. CT18]
 gi|16765318|ref|NP_460933.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|29141384|ref|NP_804726.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56413107|ref|YP_150182.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62180555|ref|YP_216972.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|161502898|ref|YP_001570010.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161613451|ref|YP_001587416.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|167552787|ref|ZP_02346538.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA29]
 gi|167993555|ref|ZP_02574649.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234153|ref|ZP_02659211.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Kentucky str. CDC 191]
 gi|168239220|ref|ZP_02664278.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. SL480]
 gi|168244831|ref|ZP_02669763.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL486]
 gi|168462478|ref|ZP_02696409.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Newport str. SL317]
 gi|168823023|ref|ZP_02835023.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Weltevreden str. HI_N05-537]
 gi|194449608|ref|YP_002046031.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194472466|ref|ZP_03078450.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Kentucky str. CVM29188]
 gi|194735991|ref|YP_002115014.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197251669|ref|YP_002146043.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197263534|ref|ZP_03163608.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA23]
 gi|197362033|ref|YP_002141670.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|198244495|ref|YP_002215106.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|200390543|ref|ZP_03217154.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Virchow str. SL491]
 gi|204931093|ref|ZP_03221919.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Javiana str. GA_MM04042433]
 gi|207856507|ref|YP_002243158.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|213163375|ref|ZP_03349085.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. E00-7866]
 gi|213417181|ref|ZP_03350325.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. E01-6750]
 gi|213424994|ref|ZP_03357744.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. E02-1180]
 gi|213584780|ref|ZP_03366606.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
 gi|213612734|ref|ZP_03370560.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213650742|ref|ZP_03380795.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213855267|ref|ZP_03383507.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|238912447|ref|ZP_04656284.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Tennessee str. CDC07-0191]
 gi|289829472|ref|ZP_06547084.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-3139]
 gi|61224040|sp|P0A1L5|FLIQ_SALTY RecName: Full=Flagellar biosynthetic protein FliQ
 gi|61224042|sp|P0A1L6|FLIQ_SALTI RecName: Full=Flagellar biosynthetic protein FliQ
 gi|25303008|pir||AE0753 flagellar biosynthetic protein FliQ [imported] - Salmonella
          enterica subsp. enterica serovar Typhi (strain CT18)
 gi|1066864|gb|AAB81320.1| fliQ [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16420515|gb|AAL20892.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|16503221|emb|CAD05728.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29137011|gb|AAO68575.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56127364|gb|AAV76870.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62128188|gb|AAX65891.1| flagellar biosynthesis [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|160864245|gb|ABX20868.1| hypothetical protein SARI_00957 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
 gi|161362815|gb|ABX66583.1| hypothetical protein SPAB_01168 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194407912|gb|ACF68131.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194458830|gb|EDX47669.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Kentucky str. CVM29188]
 gi|194711493|gb|ACF90714.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|195634231|gb|EDX52583.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Newport str. SL317]
 gi|197093510|emb|CAR58971.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197215372|gb|ACH52769.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197241789|gb|EDY24409.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA23]
 gi|197288043|gb|EDY27430.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. SL480]
 gi|197939011|gb|ACH76344.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|199602988|gb|EDZ01534.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Virchow str. SL491]
 gi|204320137|gb|EDZ05342.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Javiana str. GA_MM04042433]
 gi|205322628|gb|EDZ10467.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Saintpaul str. SARA29]
 gi|205328382|gb|EDZ15146.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331874|gb|EDZ18638.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Kentucky str. CDC 191]
 gi|205336377|gb|EDZ23141.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL486]
 gi|205340674|gb|EDZ27438.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Weltevreden str. HI_N05-537]
 gi|206708310|emb|CAR32613.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|261247146|emb|CBG24969.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267993969|gb|ACY88854.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 14028S]
 gi|301158494|emb|CBW18004.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312912970|dbj|BAJ36944.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|321224625|gb|EFX49688.1| Flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. TN061786]
 gi|322616973|gb|EFY13881.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322618212|gb|EFY15104.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322625883|gb|EFY22702.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322626335|gb|EFY23145.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322632750|gb|EFY29495.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322639092|gb|EFY35785.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322640408|gb|EFY37064.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647231|gb|EFY43730.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649921|gb|EFY46342.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322655529|gb|EFY51837.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322662988|gb|EFY59195.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322668173|gb|EFY64332.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674068|gb|EFY70162.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322675580|gb|EFY71654.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322683009|gb|EFY79025.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322686703|gb|EFY82681.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|322715031|gb|EFZ06602.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. A50]
 gi|323130259|gb|ADX17689.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 4/74]
 gi|323198063|gb|EFZ83180.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323204465|gb|EFZ89471.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323207555|gb|EFZ92503.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323211006|gb|EFZ95866.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323220727|gb|EGA05171.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323226686|gb|EGA10883.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323231562|gb|EGA15675.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323236005|gb|EGA20084.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323240575|gb|EGA24618.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323245467|gb|EGA29467.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323247585|gb|EGA31536.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2009159199]
 gi|323255520|gb|EGA39281.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323262118|gb|EGA45681.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323266241|gb|EGA49731.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|323270650|gb|EGA54091.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008287]
 gi|326622854|gb|EGE29199.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Dublin str. 3246]
 gi|332988869|gb|AEF07852.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Typhimurium str. UK-1]
          Length = 89

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+AVFI +I++ P++   +  +V  + S +
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNL 84


>gi|149377874|ref|ZP_01895603.1| flagellar biosynthetic protein FliQ [Marinobacter algicola DG893]
 gi|149357816|gb|EDM46309.1| flagellar biosynthetic protein FliQ [Marinobacter algicola DG893]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 48/73 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  ++ ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWMIVLLASLIIGPGLVIGLVVSTFQAATQINEQTLSFLPRLLVTLI 60

Query: 61 TLIISAPFIGGQI 73
          T+I++ P++  Q+
Sbjct: 61 TIIVAGPWMLTQL 73


>gi|118581841|ref|YP_903091.1| flagellar biosynthetic protein FliQ [Pelobacter propionicus DSM
          2379]
 gi|118504551|gb|ABL01034.1| flagellar biosynthetic protein FliQ [Pelobacter propionicus DSM
          2379]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++AR +    L  SAP+L  ++ +G+LI+  QA+T I E TL F PKI+AV +
Sbjct: 1  MTPELVIQLARRSFEATLLLSAPLLIFSLAVGLLISIFQAVTSINEATLAFAPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           ++I  P++   +  F   + S
Sbjct: 61 AMVIFFPWMMTYMCDFTREIYS 82


>gi|284007165|emb|CBA72449.1| flagellar biosynthesis protein FliQ [Arsenophonus nasoniae]
          Length = 84

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKIIAVFIT +++ P++
Sbjct: 27 GLIISLLQAATQINEMTLSFIPKIIAVFITAVVAGPWM 64


>gi|87307409|ref|ZP_01089554.1| probable flagellar biosynthetic protein fliQ [Blastopirellula
          marina DSM 3645]
 gi|87290149|gb|EAQ82038.1| probable flagellar biosynthetic protein fliQ [Blastopirellula
          marina DSM 3645]
          Length = 91

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 51/88 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +++ R AM   L  +AP L + M +G+ I  LQALTQIQ+ T+ FVPK +A+  
Sbjct: 1  MDVTTTVDLTREAMMVALWIAAPALVTGMLVGLAIGLLQALTQIQDQTVAFVPKFLAMAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++ + P++  ++  +   +++ I   L
Sbjct: 61 AMLFALPWVLQRLMVYTETLVTHIPDRL 88


>gi|238764401|ref|ZP_04625351.1| Flagellar biosynthetic protein FliQ [Yersinia kristensenii ATCC
          33638]
 gi|238697427|gb|EEP90194.1| Flagellar biosynthetic protein FliQ [Yersinia kristensenii ATCC
          33638]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF TL+I+ P++
Sbjct: 32 GLIVSLLQAATQINEMTLSFIPKILAVFATLVIAGPWM 69


>gi|153003616|ref|YP_001377941.1| export protein FliQ [Anaeromyxobacter sp. Fw109-5]
 gi|152027189|gb|ABS24957.1| export protein FliQ family 3 [Anaeromyxobacter sp. Fw109-5]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A +L + R A+  +L  SAP L +A+ +G++   LQA TQIQE T+  VP++ AV +
Sbjct: 1  MDPA-LLHVGREALLVVLVVSAPPLLAALAVGLVTGVLQAATQIQEPTVGVVPRLGAVLV 59

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           L ++AP+IG +++      L 
Sbjct: 60 ALAVAAPWIGARVAQLARTCLD 81


>gi|110677661|ref|YP_680668.1| flagellar biosynthetic protein FliQ [Roseobacter denitrificans
          OCh 114]
 gi|163733141|ref|ZP_02140585.1| flagellar biosynthetic protein FliQ [Roseobacter litoralis Och
          149]
 gi|109453777|gb|ABG29982.1| flagellar biosynthetic protein FliQ [Roseobacter denitrificans
          OCh 114]
 gi|161393676|gb|EDQ18001.1| flagellar biosynthetic protein FliQ [Roseobacter litoralis Och
          149]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          R  +W  +  S PVL +A+  G+ I  +QALT IQE+TLTFVPK+ A+ +   +S  F+ 
Sbjct: 12 RHGLWIAVLISIPVLTAALVTGVSIGLVQALTSIQEMTLTFVPKLAAIVLVFWMSMGFMT 71

Query: 71 GQISSF 76
            + SF
Sbjct: 72 QTLVSF 77


>gi|163856447|ref|YP_001630745.1| flagellar biosynthesis protein FliQ [Bordetella petrii DSM 12804]
 gi|163260175|emb|CAP42477.1| flagellar biosynthesis protein FliQ [Bordetella petrii]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   A+   L+ + P+L   + +G++IA  QA TQI E+TL+F+PK++A+  
Sbjct: 1  MTAETVMSMTYQALKIALAMAGPLLLVTLAVGLVIAVFQAATQINEMTLSFIPKLLAMCG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++ G ++ ++  ++ +I
Sbjct: 61 VLVLMGPWLLGLMTDYIRQLIGQI 84


>gi|329901846|ref|ZP_08272934.1| type III secretion protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327548983|gb|EGF33599.1| type III secretion protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 87

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          AD +   +  +W I+  SAP L  A+  G  I+ +QA+TQIQ+ TL +V K++ V ITL 
Sbjct: 2  ADTINFFQQGLWMIILLSAPPLLVAVLCGTAISLIQAVTQIQDQTLPYVVKLMGVSITLT 61

Query: 64 ISAPFIGGQI 73
          +   +IG ++
Sbjct: 62 LMGRWIGSEL 71


>gi|224583521|ref|YP_002637319.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|224468048|gb|ACN45878.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|322660307|gb|EFY56545.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|323195409|gb|EFZ80589.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323217540|gb|EGA02259.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323253952|gb|EGA37776.1| flagellar biosynthesis protein [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
          Length = 83

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+AVFI +I++ P++   +  +V  + S +
Sbjct: 26 GLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNL 78


>gi|15895418|ref|NP_348767.1| flagellar biosynthesis protein FliQ [Clostridium acetobutylicum
          ATCC 824]
 gi|15025141|gb|AAK80107.1|AE007715_12 Flagellar biosynthesis protein FliQ [Clostridium acetobutylicum
          ATCC 824]
 gi|325509564|gb|ADZ21200.1| Flagellar biosynthesis protein FliQ [Clostridium acetobutylicum
          EA 2018]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 42/58 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M+E  +++I + A+ T L  SAP+L  ++ +G+ I+  QA TQIQE TLTF+PK++A+
Sbjct: 1  MSENMIIKIMKDAITTGLIVSAPMLIVSIIIGLFISIFQATTQIQEQTLTFLPKLLAI 58


>gi|26991043|ref|NP_746468.1| flagellar biosynthesis protein FliQ [Pseudomonas putida KT2440]
 gi|24986075|gb|AAN69932.1|AE016632_3 flagellar biosynthetic protein FliQ [Pseudomonas putida KT2440]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 49/77 (63%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + ITLII+ P
Sbjct: 8  DLFRDALWLTTLMVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLITLIIAGP 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++  +   ++T + + I
Sbjct: 68 WLVQKFMEYITTLYTNI 84


>gi|115379094|ref|ZP_01466218.1| flagellar biosynthetic protein FliQ [Stigmatella aurantiaca
          DW4/3-1]
 gi|310823553|ref|YP_003955911.1| export protein fliq, family 3 [Stigmatella aurantiaca DW4/3-1]
 gi|115363877|gb|EAU62988.1| flagellar biosynthetic protein FliQ [Stigmatella aurantiaca
          DW4/3-1]
 gi|309396625|gb|ADO74084.1| export protein FliQ, family 3 [Stigmatella aurantiaca DW4/3-1]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  +L + R A+  ++ +S P + +++ +G L++  QA TQ+QE TL+ VPK+ A  +
Sbjct: 1  MTQDLLLAVGREALLLMVLASLPPVGASLVVGFLMSLFQATTQLQESTLSVVPKLGASVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+++ P+I  Q++ F   +L+ I
Sbjct: 61 ALVLAGPWIAAQLTLFTRQLLTLI 84


>gi|5921673|gb|AAD56297.1| FliQ [Pseudomonas putida]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R+A+W      A ++  ++ +G+L+A  QA TQI E TL+F+P+++ + I
Sbjct: 1  MTPEVAVDLFRSALWLTTLMVAVLVVPSLLVGLLVAIFQAATQINEQTLSFLPRLLVMLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TLI+  P++  +   ++T + S I
Sbjct: 61 TLIVGGPWLVQKFMEYMTGLYSSI 84


>gi|332981450|ref|YP_004462891.1| flagellar biosynthetic protein FliQ [Mahella australiensis 50-1
          BON]
 gi|332699128|gb|AEE96069.1| flagellar biosynthetic protein FliQ [Mahella australiensis 50-1
          BON]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++A VL I R A++ ++  SAP+    + +GI+++  QA+TQI E TL F+PKIIA+ +
Sbjct: 1  MSQAQVLSIVRNALYMVILLSAPMAIFGLVVGIIVSIFQAVTQINEQTLVFIPKIIAIIV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           LI+  P+I   +  F   +   I S
Sbjct: 61 ALILFGPWILNTMVDFTNDIFHSILS 86


>gi|206890429|ref|YP_002249865.1| flagellar biosynthetic protein FliQ [Thermodesulfovibrio
          yellowstonii DSM 11347]
 gi|206742367|gb|ACI21424.1| flagellar biosynthetic protein FliQ [Thermodesulfovibrio
          yellowstonii DSM 11347]
          Length = 89

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 49/68 (72%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          I++    TIL    PVL  ++ +G++I   QA+TQ+QE+T++FVPK+IAVF+TL+++ P+
Sbjct: 9  ISKQTFETILLVGGPVLLVSLLVGLIIGLFQAITQLQEMTISFVPKVIAVFLTLLLTIPW 68

Query: 69 IGGQISSF 76
          +   ++ F
Sbjct: 69 MVNIMTKF 76


>gi|15639704|ref|NP_219154.1| flagellar biosynthetic protein (fliQ) [Treponema pallidum subsp.
          pallidum str. Nichols]
 gi|189025942|ref|YP_001933714.1| flagellar biosynthetic protein [Treponema pallidum subsp.
          pallidum SS14]
 gi|3023764|sp|P74931|FLIQ_TREPA RecName: Full=Flagellar biosynthetic protein FliQ
 gi|973198|gb|AAB00547.1| FliQ [Treponema pallidum]
 gi|3323019|gb|AAC65683.1| flagellar biosynthetic protein (fliQ) [Treponema pallidum subsp.
          pallidum str. Nichols]
 gi|189018517|gb|ACD71135.1| flagellar biosynthetic protein [Treponema pallidum subsp.
          pallidum SS14]
 gi|291060081|gb|ADD72816.1| flagellar biosynthetic protein FliQ [Treponema pallidum subsp.
          pallidum str. Chicago]
          Length = 94

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 40/59 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M +  VL + R  ++ ++   APVL +A+ +G+++A  QA+T IQE TLTFVPK++ + 
Sbjct: 2  MTQGAVLGLIREGVFQVVLLVAPVLCTALVVGLIVAIFQAVTSIQEQTLTFVPKMLTIL 60


>gi|317492419|ref|ZP_07950848.1| flagellar biosynthetic protein FliQ [Enterobacteriaceae bacterium
          9_2_54FAA]
 gi|316919758|gb|EFV41088.1| flagellar biosynthetic protein FliQ [Enterobacteriaceae bacterium
          9_2_54FAA]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 32 GLVISLLQAATQINEMTLSFIPKILAVFATMVIAGPWM 69


>gi|30248476|ref|NP_840546.1| family 3 exporter FliQ [Nitrosomonas europaea ATCC 19718]
 gi|30138362|emb|CAD84371.1| Bacterial export proteins, family 3 (FliQ) [Nitrosomonas europaea
          ATCC 19718]
          Length = 91

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN    + I R A+    + +AP+L +A+  G++I+  QA TQI E+TL+F+PK++A+FI
Sbjct: 1  MNPEQAMTIGRQALEVTFTIAAPLLLAALVTGLVISIFQAATQINEMTLSFIPKLLAIFI 60

Query: 61 TLIISAPFI 69
          TL ++ P+I
Sbjct: 61 TLTLAGPWI 69


>gi|22126370|ref|NP_669793.1| flagellar biosynthesis protein FliQ [Yersinia pestis KIM 10]
 gi|45441391|ref|NP_992930.1| flagellar biosynthesis protein FliQ [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51596028|ref|YP_070219.1| flagellar biosynthesis protein FliQ [Yersinia pseudotuberculosis
          IP 32953]
 gi|108807191|ref|YP_651107.1| flagellar biosynthesis protein FliQ [Yersinia pestis Antiqua]
 gi|108812465|ref|YP_648232.1| flagellar biosynthesis protein FliQ [Yersinia pestis Nepal516]
 gi|145598593|ref|YP_001162669.1| flagellar biosynthesis protein FliQ [Yersinia pestis Pestoides F]
 gi|149366233|ref|ZP_01888268.1| flagellar biosynthetic protein FliQ [Yersinia pestis CA88-4125]
 gi|153949470|ref|YP_001401272.1| flagellar biosynthesis protein FliQ [Yersinia pseudotuberculosis
          IP 31758]
 gi|165925897|ref|ZP_02221729.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165938709|ref|ZP_02227264.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166010877|ref|ZP_02231775.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166211004|ref|ZP_02237039.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167401174|ref|ZP_02306677.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167420108|ref|ZP_02311861.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167425867|ref|ZP_02317620.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167467509|ref|ZP_02332213.1| flagellar biosynthetic protein FliQ [Yersinia pestis FV-1]
 gi|170024628|ref|YP_001721133.1| flagellar biosynthesis protein FliQ [Yersinia pseudotuberculosis
          YPIII]
 gi|186895133|ref|YP_001872245.1| flagellar biosynthesis protein FliQ [Yersinia pseudotuberculosis
          PB1/+]
 gi|218928940|ref|YP_002346815.1| flagellar biosynthesis protein FliQ [Yersinia pestis CO92]
 gi|229896264|ref|ZP_04511434.1| flagellar biosynthetic protein FliQ [Yersinia pestis Pestoides A]
 gi|229897201|ref|ZP_04512357.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229897928|ref|ZP_04513079.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229902841|ref|ZP_04517958.1| flagellar biosynthetic protein FliQ [Yersinia pestis Nepal516]
 gi|270486628|ref|ZP_06203702.1| flagellar biosynthetic protein FliQ [Yersinia pestis KIM D27]
 gi|21959355|gb|AAM86044.1|AE013852_6 flagellar biosynthesis protein [Yersinia pestis KIM 10]
 gi|45436251|gb|AAS61807.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51589310|emb|CAH20931.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          IP 32953]
 gi|108776113|gb|ABG18632.1| flagellar biosynthetic protein FliQ [Yersinia pestis Nepal516]
 gi|108779104|gb|ABG13162.1| flagellar biosynthetic protein FliQ [Yersinia pestis Antiqua]
 gi|115347551|emb|CAL20460.1| flagellar biosynthetic protein FliQ [Yersinia pestis CO92]
 gi|145210289|gb|ABP39696.1| flagellar biosynthetic protein FliQ [Yersinia pestis Pestoides F]
 gi|149292646|gb|EDM42720.1| flagellar biosynthetic protein FliQ [Yersinia pestis CA88-4125]
 gi|152960965|gb|ABS48426.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          IP 31758]
 gi|165913323|gb|EDR31945.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165922101|gb|EDR39278.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165990221|gb|EDR42522.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166208184|gb|EDR52664.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166961803|gb|EDR57824.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167049563|gb|EDR60971.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167055266|gb|EDR65063.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169751162|gb|ACA68680.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          YPIII]
 gi|186698159|gb|ACC88788.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          PB1/+]
 gi|229680288|gb|EEO76387.1| flagellar biosynthetic protein FliQ [Yersinia pestis Nepal516]
 gi|229688969|gb|EEO81034.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229693538|gb|EEO83587.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229701187|gb|EEO89216.1| flagellar biosynthetic protein FliQ [Yersinia pestis Pestoides A]
 gi|270335132|gb|EFA45909.1| flagellar biosynthetic protein FliQ [Yersinia pestis KIM D27]
 gi|320015443|gb|ADV99014.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 32 GLIVSLLQAATQINEMTLSFIPKILAVFTTMVIAGPWM 69


>gi|238758100|ref|ZP_04619280.1| Flagellar biosynthetic protein FliQ [Yersinia aldovae ATCC 35236]
 gi|238794006|ref|ZP_04637624.1| Flagellar biosynthetic protein FliQ [Yersinia intermedia ATCC
          29909]
 gi|238703638|gb|EEP96175.1| Flagellar biosynthetic protein FliQ [Yersinia aldovae ATCC 35236]
 gi|238726638|gb|EEQ18174.1| Flagellar biosynthetic protein FliQ [Yersinia intermedia ATCC
          29909]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 32 GLIVSLLQAATQINEMTLSFIPKILAVFTTMVIAGPWM 69


>gi|148266208|ref|YP_001232914.1| flagellar biosynthetic protein FliQ [Geobacter uraniireducens
          Rf4]
 gi|146399708|gb|ABQ28341.1| flagellar biosynthetic protein FliQ [Geobacter uraniireducens
          Rf4]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++AR +    L  SAP+L  ++ +G+LI+  QA+T I E TL F PKI AV + L+I 
Sbjct: 6  VVQLARRSFEATLLLSAPLLIFSLVVGLLISIFQAVTSINEATLAFAPKIAAVMVALVIF 65

Query: 66 APFIGGQISSF 76
           P++   +  F
Sbjct: 66 FPWMMSYMGDF 76


>gi|289523555|ref|ZP_06440409.1| flagellar biosynthetic protein FliQ [Anaerobaculum
          hydrogeniformans ATCC BAA-1850]
 gi|289503247|gb|EFD24411.1| flagellar biosynthetic protein FliQ [Anaerobaculum
          hydrogeniformans ATCC BAA-1850]
          Length = 68

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 23 PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          PVL  AM +G++I  LQ  T IQE TL F+PKI+AVF+ L +  P++ G +  F   +  
Sbjct: 2  PVLLVAMVVGLVIGILQTATSIQEQTLVFIPKILAVFLLLFLLGPWMFGHVGEFAKYLFG 61

Query: 83 RIQS 86
           + S
Sbjct: 62 NLAS 65


>gi|149184189|ref|ZP_01862507.1| flagellar biosynthetic protein [Erythrobacter sp. SD-21]
 gi|148831509|gb|EDL49942.1| flagellar biosynthetic protein [Erythrobacter sp. SD-21]
          Length = 90

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 1  MNEADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV- 58
          M+E+ VL  +A   +W     +APVL +++ +G++I  +QA T + E TLTFVPK+ AV 
Sbjct: 1  MDESAVLLSLADRMLWIAAMVAAPVLIASLAIGLVIGLIQAATSVNEQTLTFVPKLAAVA 60

Query: 59 FITLIISAPFIG 70
          F+ +++ A  +G
Sbjct: 61 FVMVVLGASMMG 72


>gi|85859181|ref|YP_461383.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
 gi|85722272|gb|ABC77215.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ I   A+   L  + P+L   + +G+ I+  QA+TQ+QE+TL FVPKI+AV + L+ +
Sbjct: 6  VVGIMAEAIKVTLLVAGPLLIVGLVVGVAISLFQAVTQVQEMTLVFVPKIVAVLVALVAT 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++   + +F   + S I +
Sbjct: 66 LPWMINLLLTFTHNLYSNIPN 86


>gi|238799425|ref|ZP_04642854.1| Flagellar biosynthetic protein FliQ [Yersinia mollaretii ATCC
          43969]
 gi|238716729|gb|EEQ08616.1| Flagellar biosynthetic protein FliQ [Yersinia mollaretii ATCC
          43969]
          Length = 83

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 26 GLIVSLLQAATQINEMTLSFIPKILAVFTTMVIAGPWM 63


>gi|256830494|ref|YP_003159222.1| flagellar biosynthetic protein FliQ [Desulfomicrobium baculatum
          DSM 4028]
 gi|256579670|gb|ACU90806.1| flagellar biosynthetic protein FliQ [Desulfomicrobium baculatum
          DSM 4028]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (84%)

Query: 38 LQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          LQA TQIQE+TLTFVPKIIAVF+ L+IS P+I  ++ ++
Sbjct: 38 LQAATQIQEMTLTFVPKIIAVFLALLISFPWIMDKMITY 76


>gi|291562036|emb|CBL40852.1| Flagellar biosynthesis pathway, component FliQ
          [butyrate-producing bacterium SS3/4]
          Length = 87

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  +L+I   A    +  S P L  +M +G++IA  QA TQI E T+TFVPK++A+ +
Sbjct: 1  MTEVQILDIMYEAFQLAMKLSLPFLLISMIVGVVIAVFQAATQINEQTMTFVPKLLAIMV 60

Query: 61 TL 62
           L
Sbjct: 61 LL 62


>gi|83747644|ref|ZP_00944680.1| FliQ [Ralstonia solanacearum UW551]
 gi|207728357|ref|YP_002256751.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          MolK2]
 gi|207739725|ref|YP_002258118.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          IPO1609]
 gi|300696944|ref|YP_003747605.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum CFBP2957]
 gi|83725696|gb|EAP72838.1| FliQ [Ralstonia solanacearum UW551]
 gi|206591603|emb|CAQ57215.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          MolK2]
 gi|206593107|emb|CAQ60013.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          IPO1609]
 gi|299073668|emb|CBJ53188.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum CFBP2957]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  T++++
Sbjct: 6  VLNMARQAMQVAMMIGAPMLLVSLVVGLLVAVFQAATQLNEQTLSFIPKLLAVAATMVLA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++ G I  +   VL+ I +
Sbjct: 66 GPWVLGVIVDYTRDVLTNIPN 86


>gi|220913716|ref|YP_002489025.1| flagellar biosynthetic protein FliQ [Arthrobacter
          chlorophenolicus A6]
 gi|219860594|gb|ACL40936.1| flagellar biosynthetic protein FliQ [Arthrobacter
          chlorophenolicus A6]
          Length = 91

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I   AM      +APVL +A+ +G+ I+ LQ++TQ+QE TL+FVPK +AV I
Sbjct: 1  MDTNAVLDICLQAMIVAAKLAAPVLVTALVVGLAISLLQSITQLQEATLSFVPKAVAVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ A ++  ++ SF   + +RI
Sbjct: 61 ALVVCAHWMITEMVSFTNELFTRI 84


>gi|238751770|ref|ZP_04613258.1| Flagellar biosynthetic protein FliQ [Yersinia rohdei ATCC 43380]
 gi|238710041|gb|EEQ02271.1| Flagellar biosynthetic protein FliQ [Yersinia rohdei ATCC 43380]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 32 GLIVSLLQAATQINEMTLSFIPKILAVFTTMVIAGPWM 69


>gi|238785488|ref|ZP_04629471.1| Flagellar biosynthetic protein FliQ [Yersinia bercovieri ATCC
          43970]
 gi|238713590|gb|EEQ05619.1| Flagellar biosynthetic protein FliQ [Yersinia bercovieri ATCC
          43970]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AVF T++I+ P++
Sbjct: 32 GLIVSLLQAATQINEMTLSFIPKILAVFATMVIAGPWM 69


>gi|167034911|ref|YP_001670142.1| flagellar biosynthesis protein FliQ [Pseudomonas putida GB-1]
 gi|166861399|gb|ABY99806.1| flagellar biosynthetic protein FliQ [Pseudomonas putida GB-1]
          Length = 89

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 49/77 (63%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + ITLI++ P
Sbjct: 8  DLFRDALWLTTLMVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLITLIVAGP 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++  +   ++T + + I
Sbjct: 68 WLVQKFMEYITTLYTNI 84


>gi|259909719|ref|YP_002650075.1| hrp/hrc Type III secretion system-Hrp/hrc secretion/translocation
          pathway-hrcS protein [Erwinia pyrifoliae Ep1/96]
 gi|76152317|gb|ABA39818.1| HrcS [Erwinia pyrifoliae]
 gi|224965341|emb|CAX56873.1| hrp/hrc Type III secretion system-Hrp/hrc secretion/translocation
          pathway-hrcS protein [Erwinia pyrifoliae Ep1/96]
 gi|283479805|emb|CAY75721.1| Type III secretion protein HrcS [Erwinia pyrifoliae DSM 12163]
 gi|310766417|gb|ADP11367.1| hrp/hrc Type III secretion system-Hrp/hrc secretion/translocation
          pathway-hrcS protein [Erwinia sp. Ejp617]
          Length = 86

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 44/66 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D+L + + AM  ++  SAP L  A+ +G+L++ LQA+ Q+Q+ TL F  K++AV I L +
Sbjct: 2  DILNLFKQAMLLVVLLSAPPLLVAVIIGVLVSLLQAVMQLQDQTLPFAIKLVAVGIALAL 61

Query: 65 SAPFIG 70
          S  +IG
Sbjct: 62 SGRWIG 67


>gi|242238992|ref|YP_002987173.1| flagellar biosynthetic protein FliQ [Dickeya dadantii Ech703]
 gi|242131049|gb|ACS85351.1| flagellar biosynthetic protein FliQ [Dickeya dadantii Ech703]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 36/46 (78%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFV 77
          G++++ LQA TQI E+TL+F+PK++AVF T+II+ P++ G    +V
Sbjct: 32 GLIVSILQAATQINEMTLSFIPKVLAVFATIIIAGPWMLGVFLDYV 77


>gi|88813212|ref|ZP_01128452.1| flagellar biosynthetic protein FliQ [Nitrococcus mobilis Nb-231]
 gi|88789534|gb|EAR20661.1| flagellar biosynthetic protein FliQ [Nitrococcus mobilis Nb-231]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 43/63 (68%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E+ + A+   +  +AP+L SA+  G++I   QA TQI E T++FVPK+  + +TL ++A
Sbjct: 7  IELGKQALTVAVLIAAPILLSALAAGLIIGMFQAATQINEQTMSFVPKLAVLVLTLFVAA 66

Query: 67 PFI 69
          P++
Sbjct: 67 PWM 69


>gi|304311652|ref|YP_003811250.1| Type III secretory pathway protein [gamma proteobacterium HdN1]
 gi|301797385|emb|CBL45605.1| Type III secretory pathway protein [gamma proteobacterium HdN1]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 44/65 (67%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++ + A+W +L  SAP++  A   G++IAFLQA+TQ+QE TL F  K++ V   + ++
Sbjct: 5  VIQLTQEALWLLLMLSAPIILGAAASGLVIAFLQAVTQLQEQTLGFAVKLVVVSALIFLT 64

Query: 66 APFIG 70
          +  +G
Sbjct: 65 SGLVG 69


>gi|224372324|ref|YP_002606696.1| flagellar biosynthesis protein FliQ [Nautilia profundicola AmH]
 gi|223589746|gb|ACM93482.1| flagellar biosynthetic protein FliQ [Nautilia profundicola AmH]
          Length = 88

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 40/61 (65%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSS 87
           M +G+LI+  QA TQI E+TL+FVPKI+A+ + LI + P++  ++  F T V   I + 
Sbjct: 27 GMIVGLLISIFQATTQINEMTLSFVPKILAIAVILIFTMPWMLNEMIDFTTYVFKLIPTF 86

Query: 88 L 88
          L
Sbjct: 87 L 87


>gi|294013058|ref|YP_003546518.1| flagellar biosynthesis pathway component FliQ [Sphingobium
          japonicum UT26S]
 gi|292676388|dbj|BAI97906.1| flagellar biosynthesis pathway component FliQ [Sphingobium
          japonicum UT26S]
          Length = 90

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 1  MNEADV-LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M  AD  + +A+ A+W    ++AP+L  A+  G++I  +QA T I E TL F+PKII V 
Sbjct: 1  MENADFFMGLAQQALWITALAAAPILIPALVAGVVIGMVQAATSINEQTLAFIPKIIVVG 60

Query: 60 ITLIISAPFIGGQISSFVTLVLSRIQSSL 88
            L++    I   I+ F   +  RI   L
Sbjct: 61 AMLVLFGGSIMVLIADFTREIFERIPDLL 89


>gi|15616705|ref|NP_239917.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219681461|ref|YP_002467846.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|257471136|ref|ZP_05635135.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          LSR1 (Acyrthosiphon pisum)]
 gi|11386789|sp|P57185|FLIQ_BUCAI RecName: Full=Flagellar biosynthetic protein FliQ
 gi|25303012|pir||C84939 flagellar biosynthetic protein fliQ [imported] - Buchnera sp.
          (strain APS)
 gi|10038768|dbj|BAB12803.1| flagellar biosynthetic protein fliQ [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219624304|gb|ACL30459.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311086977|gb|ADP67057.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          JF99 (Acyrthosiphon pisum)]
 gi|311087554|gb|ADP67633.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          JF98 (Acyrthosiphon pisum)]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E+   AM   L  ++P+L +A+  G++I+ LQA TQ+ E TL+F+PKII+V  
Sbjct: 1  MTSEYVMELFYNAMKVALIIASPLLLAALISGLIISILQAATQVNEQTLSFIPKIISVLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           + I  P++ G +  ++  + + I
Sbjct: 61 VISILGPWMLGVMLDYMHNLFNNI 84


>gi|292487015|ref|YP_003529885.1| type III secretion protein HrcS [Erwinia amylovora CFBP1430]
 gi|292900600|ref|YP_003539969.1| type III secretion system protein [Erwinia amylovora ATCC 49946]
 gi|1181174|gb|AAB06006.1| HrcS [Erwinia amylovora]
 gi|291200448|emb|CBJ47577.1| type III secretion system protein [Erwinia amylovora ATCC 49946]
 gi|291552432|emb|CBA19477.1| Type III secretion protein HrcS [Erwinia amylovora CFBP1430]
 gi|312171084|emb|CBX79343.1| Type III secretion protein HrcS [Erwinia amylovora ATCC BAA-2158]
          Length = 86

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 44/66 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D+L + + AM  ++  SAP L  A+ +G+L++ LQA+ Q+Q+ TL F  K++AV I L +
Sbjct: 2  DILNLFKQAMLLVVLLSAPPLLVAVIVGVLVSLLQAVMQLQDQTLPFAIKLVAVGIALAL 61

Query: 65 SAPFIG 70
          S  +IG
Sbjct: 62 SGRWIG 67


>gi|325273553|ref|ZP_08139783.1| flagellar biosynthesis protein FliQ [Pseudomonas sp. TJI-51]
 gi|324101313|gb|EGB98929.1| flagellar biosynthesis protein FliQ [Pseudomonas sp. TJI-51]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 49/77 (63%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + ITLI++ P
Sbjct: 8  DLFRDALWLTTLMVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLITLIVAGP 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++  +   ++T + + I
Sbjct: 68 WLVQKFMEYITTLYANI 84


>gi|32471370|ref|NP_864363.1| flagellar biosynthetic protein fliQ [Rhodopirellula baltica SH 1]
 gi|32443211|emb|CAD72042.1| probable flagellar biosynthetic protein fliQ [Rhodopirellula
          baltica SH 1]
 gi|327537628|gb|EGF24340.1| Bacterial export protein FliQ, family 3 [Rhodopirellula baltica
          WH47]
          Length = 88

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          +D +++ R A+   +  + P+L   M  G++I  +QALTQIQ+ T++FVPKI+A+   LI
Sbjct: 5  SDAIDLVREALLAAVVLALPMLAVGMLAGLVIGLIQALTQIQDQTVSFVPKIMAMAAVLI 64

Query: 64 ISAPFIGGQISSFVTLV 80
             P++  ++  F   V
Sbjct: 65 ACLPWLMSRMVEFTRHV 81


>gi|219682017|ref|YP_002468401.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          Tuc7 (Acyrthosiphon pisum)]
 gi|219621750|gb|ACL29906.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          Tuc7 (Acyrthosiphon pisum)]
 gi|311085825|gb|ADP65907.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          LL01 (Acyrthosiphon pisum)]
 gi|311086398|gb|ADP66479.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str.
          TLW03 (Acyrthosiphon pisum)]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E+   AM   L  ++P+L +A+  G++I+ LQA TQ+ E TL+F+PKII+V  
Sbjct: 1  MTSEYVMELFYDAMKVALIIASPLLLAALISGLIISILQAATQVNEQTLSFIPKIISVLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           + I  P++ G +  ++  + + I
Sbjct: 61 VISILGPWMLGVMLDYMHNLFNNI 84


>gi|37525860|ref|NP_929204.1| flagellar biosynthesis protein FliQ [Photorhabdus luminescens
          subsp. laumondii TTO1]
 gi|36785289|emb|CAE14230.1| flagellar biosynthetic protein FliQ [Photorhabdus luminescens
          subsp. laumondii TTO1]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQ+ E+TL+F+PKI+AVF+T +I+ P++
Sbjct: 32 GLIVSLLQAATQVNEMTLSFIPKILAVFVTTVIAGPWM 69


>gi|78043118|ref|YP_359853.1| flagellar biosynthetic protein FliQ [Carboxydothermus
          hydrogenoformans Z-2901]
 gi|77995233|gb|ABB14132.1| flagellar biosynthetic protein FliQ [Carboxydothermus
          hydrogenoformans Z-2901]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 34/43 (79%)

Query: 22 APVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
           P L  ++ +G+++  LQA TQIQE TLTFVPK+IAVF+TL++
Sbjct: 22 GPPLIVSLVVGLIVGILQAATQIQEQTLTFVPKLIAVFLTLLL 64


>gi|87294846|gb|ABD36817.1| flagellar biosynthesis protein FliQ [Pseudomonas fluorescens]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I R A+W      A ++  ++ +G+L+A  QA TQI E TL+F+P+++ + +TLI+  P
Sbjct: 8  DIFREALWLTTMMVAILVVPSLLVGLLVAMFQAATQINEQTLSFLPRLLVMLVTLIVGGP 67

Query: 68 FI 69
          +I
Sbjct: 68 WI 69


>gi|169831897|ref|YP_001717879.1| flagellar biosynthetic protein FliQ [Candidatus Desulforudis
          audaxviator MP104C]
 gi|169638741|gb|ACA60247.1| flagellar biosynthetic protein FliQ [Candidatus Desulforudis
          audaxviator MP104C]
          Length = 87

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M ++  +E+ + A+  +L  +AP L  ++ +G++I+ LQA TQIQ+  +TFVPKI+AVF+
Sbjct: 1  MTDSLAVELTQKALMMVLLLTAPPLLVSLVVGLVISILQAATQIQDQMITFVPKIVAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L++ AP+    ++ +   +  RI
Sbjct: 61 SLLLLAPWYVRILTGYTAELFGRI 84


>gi|297584052|ref|YP_003699832.1| flagellar biosynthetic protein FliQ [Bacillus selenitireducens
          MLS10]
 gi|297142509|gb|ADH99266.1| flagellar biosynthetic protein FliQ [Bacillus selenitireducens
          MLS10]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+  A   ++T L  + P+L +A+ +G+ ++  QA TQIQE TL F+PKI  V I
Sbjct: 1  MSPEMVIGWAEQGVFTTLLIAGPLLITALAIGLAVSVFQATTQIQEQTLAFIPKIAGVLI 60

Query: 61 TLIISAPFI 69
           L+I  P++
Sbjct: 61 ALVIFGPWM 69


>gi|239628945|ref|ZP_04671976.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47_FAA]
 gi|239519091|gb|EEQ58957.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47FAA]
          Length = 87

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          MN   V+EI + AM      + P+L  ++ +G+L+A  QA TQI E TLTFVPK
Sbjct: 1  MNAEQVMEIMKEAMLVAFELAGPLLIVSIAVGLLVAIFQAATQIHEQTLTFVPK 54


>gi|222100862|ref|YP_002535430.1| Flagellar biosynthetic protein FliQ [Thermotoga neapolitana DSM
          4359]
 gi|221573252|gb|ACM24064.1| Flagellar biosynthetic protein FliQ [Thermotoga neapolitana DSM
          4359]
          Length = 91

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 48/77 (62%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L+I ++ +  IL    P L  ++ +G++I+  QA+TQI E TL F P++I +F+TL+  +
Sbjct: 10 LDIMKSGIGLILEIIVPPLVVSLIVGLIISIFQAVTQIHEQTLMFAPRVIVMFLTLLFLS 69

Query: 67 PFIGGQISSFVTLVLSR 83
           ++  +I  F T +L R
Sbjct: 70 GWMAQKILDFFTELLQR 86


>gi|268316331|ref|YP_003290050.1| flagellar biosynthetic protein FliQ [Rhodothermus marinus DSM
          4252]
 gi|262333865|gb|ACY47662.1| flagellar biosynthetic protein FliQ [Rhodothermus marinus DSM
          4252]
          Length = 89

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 50/76 (65%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          + A+ T L    P+L  A+ +G++++ LQA+T +QE+TL+++PKI+AV   L++ AP++ 
Sbjct: 11 QEALKTALLLVGPLLAVALIVGLIVSLLQAITSVQEMTLSYIPKILAVGFVLLLLAPWML 70

Query: 71 GQISSFVTLVLSRIQS 86
            ++ F   VL  I +
Sbjct: 71 QMLTDFAVQVLQFIPN 86


>gi|126734105|ref|ZP_01749852.1| flagellar biosynthetic protein FliQ [Roseobacter sp. CCS2]
 gi|126716971|gb|EBA13835.1| flagellar biosynthetic protein FliQ [Roseobacter sp. CCS2]
          Length = 89

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK---IIA 57
          M+E    +  R  +W     S P+L  A+  G+L+   QALT IQE+TLTFVPK   IIA
Sbjct: 1  MSETLFYDTLRQGLWVAFVISIPILSVALASGLLVGLFQALTSIQEMTLTFVPKLAAIIA 60

Query: 58 VF 59
          VF
Sbjct: 61 VF 62


>gi|218887502|ref|YP_002436823.1| type III secretion protein, HrpO family [Desulfovibrio vulgaris
          str. 'Miyazaki F']
 gi|218758456|gb|ACL09355.1| type III secretion protein, HrpO family [Desulfovibrio vulgaris
          str. 'Miyazaki F']
          Length = 86

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E+  +  A  A++ +L  S P +  A  +GILI+ +QA+TQ+QE TLTF  K+IAV +TL
Sbjct: 2  ESMAMTYAVKALYLVLMLSMPPIVVASVIGILISLVQAITQLQEQTLTFGVKLIAVVLTL 61

Query: 63 IISAPFIGGQISSFVTLVLSR 83
           +   + G ++  F   +  R
Sbjct: 62 FLMGGWFGAELLRFADEIFVR 82


>gi|330808229|ref|YP_004352691.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327376337|gb|AEA67687.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 89

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W   +  A ++  ++ +G+L+A  QA TQI E TL+F+P+++ + +
Sbjct: 1  MTPEVAVDLFREALWLTTTMVAILVIPSLLVGLLVAMFQAATQINEQTLSFLPRLLVMLV 60

Query: 61 TLIISAPFI 69
          TLI++ P++
Sbjct: 61 TLIVAGPWL 69


>gi|203287734|ref|YP_002222749.1| flagellar biosynthesis protein [Borrelia recurrentis A1]
 gi|201084954|gb|ACH94528.1| flagellar biosynthesis protein [Borrelia recurrentis A1]
          Length = 87

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L +A+ +G+L++  QA+T IQ+ TL+F+PKII + + L+I  P+I  +I  F  LV
Sbjct: 21 SAPILITALIVGLLVSIFQAVTSIQDQTLSFIPKIIIILLVLVIFGPWILKKIMQFTFLV 80

Query: 81 LSRIQS 86
           ++IQ+
Sbjct: 81 FNQIQN 86


>gi|317407762|gb|EFV87689.1| BscS protein [Achromobacter xylosoxidans C54]
          Length = 88

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ +D++     +++ +L  S P + +A  +G L +  QALTQIQE TL+F  K+I VF 
Sbjct: 1  MSTSDLVSYMTQSLYLVLWLSLPPIAAAAIIGTLFSLFQALTQIQEQTLSFAIKMIVVFG 60

Query: 61 TLIISAPFIGGQISSF 76
           ++++A ++G ++ +F
Sbjct: 61 VILLTARWVGTELYNF 76


>gi|107025867|ref|YP_623378.1| Type III secretion protein HrpO [Burkholderia cenocepacia AU
          1054]
 gi|116692949|ref|YP_838482.1| HrpO family type III secretion protein [Burkholderia cenocepacia
          HI2424]
 gi|170737786|ref|YP_001779046.1| HrpO family type III secretion protein [Burkholderia cenocepacia
          MC0-3]
 gi|206563897|ref|YP_002234660.1| type III secretion system protein [Burkholderia cenocepacia
          J2315]
 gi|254250195|ref|ZP_04943515.1| Type III secretory pathway, component EscS [Burkholderia
          cenocepacia PC184]
 gi|18092667|gb|AAL59396.1| BcscS [Burkholderia cenocepacia]
 gi|28394248|gb|AAO31723.1| BcscS [Burkholderia cenocepacia]
 gi|105895241|gb|ABF78405.1| Type III secretion protein HrpO [Burkholderia cenocepacia AU
          1054]
 gi|116650949|gb|ABK11589.1| type III secretion protein, HrpO family [Burkholderia cenocepacia
          HI2424]
 gi|124876696|gb|EAY66686.1| Type III secretory pathway, component EscS [Burkholderia
          cenocepacia PC184]
 gi|169819974|gb|ACA94556.1| type III secretion protein, HrpO family [Burkholderia cenocepacia
          MC0-3]
 gi|198039937|emb|CAR55915.1| type III secretion system protein [Burkholderia cenocepacia
          J2315]
          Length = 92

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQDANIGIAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++GG++  F    L R+
Sbjct: 61 ALVLLSGWLGGEVLRFAQQALERM 84


>gi|167750711|ref|ZP_02422838.1| hypothetical protein EUBSIR_01689 [Eubacterium siraeum DSM 15702]
 gi|167656390|gb|EDS00520.1| hypothetical protein EUBSIR_01689 [Eubacterium siraeum DSM 15702]
          Length = 96

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E+  AA+   L    PVL +A+ +G++IA LQA TQ+ E TL+F PK I V I L++  
Sbjct: 13 MEVFTAALVLALKLGLPVLIAAVVIGLIIAILQAATQVHEQTLSFAPKAIVVAIVLLLFG 72

Query: 67 PFI 69
          P++
Sbjct: 73 PWM 75


>gi|229544409|ref|ZP_04433467.1| flagellar biosynthetic protein FliQ [Bacillus coagulans 36D1]
 gi|229324894|gb|EEN90571.1| flagellar biosynthetic protein FliQ [Bacillus coagulans 36D1]
          Length = 89

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ +A   +        P+L  A+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSEEMVISLAEKGIMVTFMVCGPLLLIALVVGMIVSIFQAATQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++   + ++   +LS +
Sbjct: 61 GLVLLGPWMLSHMLTYTKEILSNL 84


>gi|303246799|ref|ZP_07333076.1| flagellar biosynthetic protein FliQ [Desulfovibrio fructosovorans
          JJ]
 gi|302491816|gb|EFL51696.1| flagellar biosynthetic protein FliQ [Desulfovibrio fructosovorans
          JJ]
          Length = 89

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 58/83 (69%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ +AR A+ T L  + P+L  ++ +G++I+ LQA TQIQE+TLTFVPKI+++FI L+++
Sbjct: 6  VVALARQAIETALFLALPMLGVSLVVGVVISVLQAATQIQEMTLTFVPKILSMFIALLVA 65

Query: 66 APFIGGQISSFVTLVLSRIQSSL 88
           P++  ++ +F   +   I + L
Sbjct: 66 FPWMMDKMINFTKELFMNIPNYL 88


>gi|188532665|ref|YP_001906462.1| HrcS protein (hrp cluster) [Erwinia tasmaniensis Et1/99]
 gi|188027707|emb|CAO95560.1| HrcS protein (hrp cluster) [Erwinia tasmaniensis Et1/99]
          Length = 86

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 44/66 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D+L + + AM  ++  SAP L  A+ +G+L++ LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 2  DILNLFKQAMLLVVLLSAPPLLVAVIVGVLVSLLQAVMQLQDQTLPFAIKLVAVGVALAL 61

Query: 65 SAPFIG 70
          S  +IG
Sbjct: 62 SGRWIG 67


>gi|94495440|ref|ZP_01302020.1| flagellar biosynthetic protein [Sphingomonas sp. SKA58]
 gi|94424828|gb|EAT09849.1| flagellar biosynthetic protein [Sphingomonas sp. SKA58]
          Length = 90

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 1  MNEADV-LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M  AD  L +A+ A+W    ++AP+L  A+  G++I  +QA T I E TL+F+PK+I V 
Sbjct: 1  MENADFFLGLAQQALWITALAAAPILIPALISGLIIGMIQAATSINEQTLSFIPKLIVVG 60

Query: 60 ITLIISAPFIGGQISSFVTLVLSRIQSSL 88
            L++    I   ++ F   +  RI   L
Sbjct: 61 AMLVLFGGSIMVLVADFTREIFERIPDLL 89


>gi|120554900|ref|YP_959251.1| flagellar biosynthesis protein FliQ [Marinobacter aquaeolei VT8]
 gi|120324749|gb|ABM19064.1| flagellar biosynthetic protein FliQ [Marinobacter aquaeolei VT8]
          Length = 89

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  SA ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWLIVLLSAVIIGPGLVIGLVVSTFQAATQINEQTLSFLPRLLITLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           +I + P++   +      ++SRI
Sbjct: 61 VIIAAGPWMLTTLLDHANGLISRI 84


>gi|163781852|ref|ZP_02176852.1| flagellar biosynthesis protein FliQ [Hydrogenivirga sp.
          128-5-R1-1]
 gi|159883072|gb|EDP76576.1| flagellar biosynthesis protein FliQ [Hydrogenivirga sp.
          128-5-R1-1]
          Length = 89

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 23 PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          PVL +   +G++++  QA TQIQE+TL ++PKI+A  +T+ +   ++ G++  F   VL 
Sbjct: 23 PVLLATFIVGLVVSIFQAATQIQEMTLAYIPKIVAAMVTIFVLGGWMMGKLVDFTKEVLI 82

Query: 83 RI 84
           I
Sbjct: 83 NI 84


>gi|167588262|ref|ZP_02380650.1| type III secretion protein, HrpO family [Burkholderia ubonensis
          Bu]
          Length = 92

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  L    ++IAV +
Sbjct: 1  MTGSTILDLTRQALMLVLLLSLPIVAIATVTGLVVAILQAVTQVQDANLGMAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++GG++  F    L R+
Sbjct: 61 ALVLLSGWLGGEVLRFAQQALERM 84


>gi|325529066|gb|EGD06067.1| hypothetical protein B1M_03247 [Burkholderia sp. TJI49]
          Length = 92

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQDANIGIAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++GG++  F    L R+
Sbjct: 61 ALVLLSGWLGGEVLRFAQQALERM 84


>gi|167770201|ref|ZP_02442254.1| hypothetical protein ANACOL_01544 [Anaerotruncus colihominis DSM
          17241]
 gi|167667523|gb|EDS11653.1| hypothetical protein ANACOL_01544 [Anaerotruncus colihominis DSM
          17241]
          Length = 87

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 48/77 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ I + A+      + P+L  ++ +G++IA  QA TQI E TLTFVPKI+A+ +
Sbjct: 1  MTQEQVMGIFQQAIILAFKLAGPLLAVSIIIGLVIAIFQAATQIHEQTLTFVPKIVAIAL 60

Query: 61 TLIISAPFIGGQISSFV 77
           +++  P++   +S F+
Sbjct: 61 MMLLLGPWMITMLSDFM 77


>gi|323143900|ref|ZP_08078562.1| surface presentation of antigens protein SpaQ [Succinatimonas
          hippei YIT 12066]
 gi|322416327|gb|EFY06999.1| surface presentation of antigens protein SpaQ [Succinatimonas
          hippei YIT 12066]
          Length = 87

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 48/74 (64%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          +A+V++I     + +L  S P +  A  +G+L++ +QA+TQ+QE TL+F  K+IAV ITL
Sbjct: 2  DAEVVDIISQCFYLVLILSLPPILVASVVGVLLSLIQAITQLQEQTLSFGIKLIAVCITL 61

Query: 63 IISAPFIGGQISSF 76
           ++A +   ++  F
Sbjct: 62 FLTAGWFSNELLRF 75


>gi|15596889|ref|NP_250383.1| translocation protein in type III secretion [Pseudomonas
          aeruginosa PAO1]
 gi|107101124|ref|ZP_01365042.1| hypothetical protein PaerPA_01002156 [Pseudomonas aeruginosa
          PACS2]
 gi|116049642|ref|YP_791553.1| putative translocation protein in type III secretion [Pseudomonas
          aeruginosa UCBPP-PA14]
 gi|218892352|ref|YP_002441219.1| putative translocation protein in type III secretion [Pseudomonas
          aeruginosa LESB58]
 gi|254234791|ref|ZP_04928114.1| hypothetical protein PACG_00661 [Pseudomonas aeruginosa C3719]
 gi|254240037|ref|ZP_04933359.1| hypothetical protein PA2G_00674 [Pseudomonas aeruginosa 2192]
 gi|296389924|ref|ZP_06879399.1| putative translocation protein in type III secretion [Pseudomonas
          aeruginosa PAb1]
 gi|313110378|ref|ZP_07796267.1| putative translocation protein in type III secretion [Pseudomonas
          aeruginosa 39016]
 gi|9947665|gb|AAG05081.1|AE004596_7 probable translocation protein in type III secretion [Pseudomonas
          aeruginosa PAO1]
 gi|115584863|gb|ABJ10878.1| putative translocation protein in type III secretion [Pseudomonas
          aeruginosa UCBPP-PA14]
 gi|126166722|gb|EAZ52233.1| hypothetical protein PACG_00661 [Pseudomonas aeruginosa C3719]
 gi|126193415|gb|EAZ57478.1| hypothetical protein PA2G_00674 [Pseudomonas aeruginosa 2192]
 gi|218772578|emb|CAW28361.1| probable translocation protein in type III secretion [Pseudomonas
          aeruginosa LESB58]
 gi|310882769|gb|EFQ41363.1| putative translocation protein in type III secretion [Pseudomonas
          aeruginosa 39016]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L      +W +L  S P +  A  +G L++ +QALTQIQE TL FV K++AV +
Sbjct: 1  MSSADILHFTNQTLWLVLVLSLPPVLVAALIGTLVSLVQALTQIQEQTLGFVAKLVAVVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L  ++ ++GG++  F  + L ++
Sbjct: 61 VLFATSGWLGGELYRFAEMTLLKV 84


>gi|309779458|ref|ZP_07674219.1| flagellar biosynthetic protein FliQ [Ralstonia sp. 5_7_47FAA]
 gi|308921699|gb|EFP67335.1| flagellar biosynthetic protein FliQ [Ralstonia sp. 5_7_47FAA]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL++AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  T++++
Sbjct: 6  VLDMARQAMQVAMMVGAPMLLVSLVVGLLVAVFQAATQLNEQTLSFIPKLLAVAATMVLA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P+I   I  +   VL+ I +
Sbjct: 66 GPWIVAVIVDYTRGVLTNIPN 86


>gi|148546751|ref|YP_001266853.1| flagellar biosynthesis protein FliQ [Pseudomonas putida F1]
 gi|148510809|gb|ABQ77669.1| flagellar biosynthetic protein FliQ [Pseudomonas putida F1]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 46/71 (64%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + ITLII+ P
Sbjct: 8  DLFRDALWLTTLLVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLITLIIAGP 67

Query: 68 FIGGQISSFVT 78
          ++  +   ++T
Sbjct: 68 WLVQKFMEYIT 78


>gi|313497810|gb|ADR59176.1| FliQ [Pseudomonas putida BIRD-1]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 48/77 (62%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + ITLII+ P
Sbjct: 8  DLFRDALWLTTLMVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLITLIIAGP 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++  +   + T + + I
Sbjct: 68 WLVQKFMEYFTTLYTNI 84


>gi|182418348|ref|ZP_02949643.1| flagellar biosynthetic protein FliQ [Clostridium butyricum 5521]
 gi|237666892|ref|ZP_04526877.1| export protein FliQ, family 3 [Clostridium butyricum E4 str. BoNT
          E BL5262]
 gi|182377730|gb|EDT75274.1| flagellar biosynthetic protein FliQ [Clostridium butyricum 5521]
 gi|237658091|gb|EEP55646.1| export protein FliQ, family 3 [Clostridium butyricum E4 str. BoNT
          E BL5262]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIA 57
          M+E  +  + +  + T +   AP+L   + LG++I+ +QA TQIQE TLTFVPK+IA
Sbjct: 1  MSEIMLNGVVKDTVVTAIKVGAPILIVVLVLGLIISIIQATTQIQEQTLTFVPKLIA 57


>gi|159045790|ref|YP_001534584.1| flagellar biosynthetic protein FliQ [Dinoroseobacter shibae DFL
          12]
 gi|157913550|gb|ABV94983.1| flagellar biosynthetic protein FliQ [Dinoroseobacter shibae DFL
          12]
          Length = 88

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E    +  R  +W  +  SAP+L  A+  G+++   QALT +QE+TLTFVPK   +  
Sbjct: 1  MTEIIFFDTLRQGLWVSVLMSAPILTVALVAGVIVGLFQALTSVQEMTLTFVPKAALMLA 60

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   ++ F
Sbjct: 61 VFWVSMSFMTETLTDF 76


>gi|323388137|gb|ADX60333.1| type III secretion protein RscS [Pseudomonas fluorescens]
          Length = 87

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 47/77 (61%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVVVGVLTSLVQALMQIQDQTLPFGIKLVAVGITLILTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L+   I  S
Sbjct: 68 VELIQLINLMFDMIARS 84


>gi|261821162|ref|YP_003259268.1| flagellar biosynthesis protein FliQ [Pectobacterium wasabiae
          WPP163]
 gi|261605175|gb|ACX87661.1| flagellar biosynthetic protein FliQ [Pectobacterium wasabiae
          WPP163]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+ LQA TQI E+TL+F+PKI+ VF TL+I+ P++
Sbjct: 32 GLTISLLQAATQINEMTLSFIPKILTVFFTLVIAGPWM 69


>gi|77457777|ref|YP_347282.1| flagellar biosynthesis protein FliQ [Pseudomonas fluorescens
          Pf0-1]
 gi|77381780|gb|ABA73293.1| flagellar biosynthetic protein FliQ [Pseudomonas fluorescens
          Pf0-1]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 47/77 (61%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I R A+W      A ++  ++ +G+L++  QA TQI E TL+F+P+++ + +TLI++ P
Sbjct: 8  DIFREALWLTTMMVAILVVPSLLVGLLVSMFQAATQINEQTLSFLPRLLVMLVTLIVAGP 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++      ++T +   I
Sbjct: 68 WLVQTFMEYITQLYKNI 84


>gi|205352326|ref|YP_002226127.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205272107|emb|CAR36960.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|326627376|gb|EGE33719.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 9]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 38/53 (71%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+ VFI +I++ P++   +  +V  + S +
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIVTVFIAIIVAGPWMLNLLLDYVRTLFSNL 84


>gi|46562154|ref|YP_009143.1| HrpO family type III secretion protein [Desulfovibrio vulgaris
          str. Hildenborough]
 gi|120586863|ref|YP_961208.1| HrpO family type III secretion protein [Desulfovibrio vulgaris
          subsp. vulgaris DP4]
 gi|46447691|gb|AAS94357.1| type III secretion protein, HrpO family [Desulfovibrio vulgaris
          str. Hildenborough]
 gi|120564277|gb|ABM30020.1| type III secretion protein, HrpO family [Desulfovibrio vulgaris
          DP4]
 gi|311235487|gb|ADP88340.1| type III secretion protein, HrpO family [Desulfovibrio vulgaris
          RCH1]
          Length = 86

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (65%)

Query: 10 ARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A  A++ +L  S P +  A  +GI+++ +QA+TQ+QE TLTF  K+IAV +TL +   + 
Sbjct: 9  AVKALYLVLMLSMPPIIVASVVGIVLSLIQAITQLQEQTLTFGVKLIAVVLTLFLMGGWF 68

Query: 70 GGQISSF 76
          GG++  F
Sbjct: 69 GGELLRF 75


>gi|170722843|ref|YP_001750531.1| flagellar biosynthesis protein FliQ [Pseudomonas putida W619]
 gi|169760846|gb|ACA74162.1| flagellar biosynthetic protein FliQ [Pseudomonas putida W619]
          Length = 89

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 46/71 (64%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + +TLI++ P
Sbjct: 8  DLFRDALWLTTLMVAILVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLVTLIVAGP 67

Query: 68 FIGGQISSFVT 78
          ++  +   ++T
Sbjct: 68 WLTQKFMEYIT 78


>gi|329298604|ref|ZP_08255940.1| flagellar biosynthetic protein FliQ [Plautia stali symbiont]
          Length = 89

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + + AM   L  +AP+L  AM  G+LI+ LQA TQI E TL+F+PKI+AV  
Sbjct: 1  MTPESVMVMGQEAMRIALMMAAPLLLVAMVSGLLISILQAATQINEQTLSFIPKILAVAA 60

Query: 61 TLIISAPFI 69
          T +++ P++
Sbjct: 61 TAVVAGPWM 69


>gi|238927448|ref|ZP_04659208.1| flagellar biosynthesis protein FliQ [Selenomonas flueggei ATCC
          43531]
 gi|238884730|gb|EEQ48368.1| flagellar biosynthesis protein FliQ [Selenomonas flueggei ATCC
          43531]
          Length = 89

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 53/83 (63%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++A+ A+  +L  SAP+L   + +G+L+A  QA T IQE TL F+PKIIAVF+ ++I 
Sbjct: 6  VIQLAQEALMVVLLVSAPMLGLGLIVGLLVAVFQATTSIQEQTLAFIPKIIAVFVAILIF 65

Query: 66 APFIGGQISSFVTLVLSRIQSSL 88
           P++   +  +VT V   +   L
Sbjct: 66 GPWMLRIMVEYVTNVFVNLPQYL 88


>gi|160902841|ref|YP_001568422.1| flagellar biosynthetic protein FliQ [Petrotoga mobilis SJ95]
 gi|160360485|gb|ABX32099.1| flagellar biosynthetic protein FliQ [Petrotoga mobilis SJ95]
          Length = 88

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  ++EI    +   L   +P+L  ++ +G++I+  QA+TQ+ E TLTF PKII  F+
Sbjct: 1  MSEEVLIEIFENGIMLFLKVVSPILIISVAVGLIISIFQAVTQLHEQTLTFAPKIIITFL 60

Query: 61 TLIISAPFIGGQISSF 76
           L++   +I   +S F
Sbjct: 61 ALVLMFSWIMQNLSDF 76


>gi|78778199|ref|YP_394514.1| flagellar biosynthesis protein FliQ [Sulfurimonas denitrificans
          DSM 1251]
 gi|78498739|gb|ABB45279.1| Flagellar biosynthesis protein FliQ [Sulfurimonas denitrificans
          DSM 1251]
          Length = 88

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 41/64 (64%)

Query: 23 PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          P L   MF+G+ ++  QA TQI E+TL+F+PKI+ V I +I++ P++   +  F T V +
Sbjct: 22 PGLLVGMFIGLAVSIFQATTQINEMTLSFIPKIVGVAIVIILTMPWMLNVMIDFTTEVFN 81

Query: 83 RIQS 86
           + +
Sbjct: 82 MMPT 85


>gi|238796942|ref|ZP_04640446.1| Flagellar biosynthetic protein fliQ [Yersinia mollaretii ATCC
          43969]
 gi|238719202|gb|EEQ11014.1| Flagellar biosynthetic protein fliQ [Yersinia mollaretii ATCC
          43969]
          Length = 83

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 33/38 (86%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          +AP+LF+A+F G++++ LQA TQI E+TL+F+PKI+ +
Sbjct: 15 AAPLLFAALFTGLIVSILQASTQINEMTLSFIPKILTI 52


>gi|332524235|ref|ZP_08400461.1| flagellar biosynthetic protein FliQ [Rubrivivax benzoatilyticus
          JA2]
 gi|332107570|gb|EGJ08794.1| flagellar biosynthetic protein FliQ [Rubrivivax benzoatilyticus
          JA2]
          Length = 81

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 34/49 (69%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          SAP+L   M +G++++ LQA TQI E TL+FVPKI+A    L  + P++
Sbjct: 13 SAPILLVVMAIGLIVSVLQAATQINEATLSFVPKIVAAVAVLGFAGPWM 61


>gi|253688963|ref|YP_003018153.1| flagellar biosynthetic protein FliQ [Pectobacterium carotovorum
          subsp. carotovorum PC1]
 gi|251755541|gb|ACT13617.1| flagellar biosynthetic protein FliQ [Pectobacterium carotovorum
          subsp. carotovorum PC1]
          Length = 89

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+ LQA TQ+ E+TL+F+PKI+ VF TL+I+ P++
Sbjct: 32 GLTISLLQAATQVNEMTLSFIPKILTVFFTLVIAGPWM 69


>gi|293395592|ref|ZP_06639875.1| flagellar biosynthetic protein FliQ [Serratia odorifera DSM 4582]
 gi|291421911|gb|EFE95157.1| flagellar biosynthetic protein FliQ [Serratia odorifera DSM 4582]
          Length = 83

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 40/55 (72%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++++ LQA TQI E+TL+F+PKI+AV  T+II+ P++   +  ++ ++ S + +
Sbjct: 26 GLVVSLLQAATQINEMTLSFIPKILAVVATIIIAGPWMLNLLLDYMRMLFSNLPN 80


>gi|50120648|ref|YP_049815.1| flagellar biosynthesis protein FliQ [Pectobacterium atrosepticum
          SCRI1043]
 gi|49611174|emb|CAG74620.1| flagellar biosynthetic protein [Pectobacterium atrosepticum
          SCRI1043]
          Length = 89

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+ LQA TQ+ E+TL+F+PKI+ VF TL+I+ P++
Sbjct: 32 GLTISLLQAATQVNEMTLSFIPKILTVFFTLVIAGPWM 69


>gi|51587299|emb|CAE53679.1| putative HrcS [Pseudomonas fluorescens bv. V]
          Length = 87

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 47/77 (61%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV ITL+++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGITLVLTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L+   I  S
Sbjct: 68 LELIQLINLMFDMIARS 84


>gi|254254351|ref|ZP_04947668.1| Type III secretory pathway component EscS [Burkholderia dolosa
          AUO158]
 gi|124898996|gb|EAY70839.1| Type III secretory pathway component EscS [Burkholderia dolosa
          AUO158]
          Length = 92

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+ +A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLAVAILQAVTQVQDANIGIAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++GG++  F    L R+
Sbjct: 61 ALVLLSGWLGGEVLRFAQQALERM 84


>gi|259908769|ref|YP_002649125.1| Flagellar protein [Erwinia pyrifoliae Ep1/96]
 gi|224964391|emb|CAX55900.1| Flagellar protein [Erwinia pyrifoliae Ep1/96]
 gi|283478745|emb|CAY74661.1| Flagellar biosynthetic protein FliQ [Erwinia pyrifoliae DSM
          12163]
 gi|310767333|gb|ADP12283.1| Flagellar protein [Erwinia sp. Ejp617]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+LI+ LQA TQI E TL+F+PKI+AV  T+I++ P++
Sbjct: 32 GLLISLLQAATQINEQTLSFIPKILAVVTTMIVAGPWM 69


>gi|308068669|ref|YP_003870274.1| flagellar biosynthetic protein fliQ [Paenibacillus polymyxa E681]
 gi|310641560|ref|YP_003946318.1| flagellar biosynthetic protein fliq [Paenibacillus polymyxa SC2]
 gi|305857948|gb|ADM69736.1| Flagellar biosynthetic protein fliQ [Paenibacillus polymyxa E681]
 gi|309246510|gb|ADO56077.1| Flagellar biosynthetic protein FliQ [Paenibacillus polymyxa SC2]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    ++ +A  A++ +L  SAP+L   + +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MTSEFIISLAGQAVYIVLKVSAPMLILGLVVGLIISIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P+I   +  F   +L  +
Sbjct: 61 ALLLFGPWILTTLVDFTYNILDNL 84


>gi|312962262|ref|ZP_07776754.1| flagellar biosynthetic protein FliQ [Pseudomonas fluorescens WH6]
 gi|311283599|gb|EFQ62188.1| flagellar biosynthetic protein FliQ [Pseudomonas fluorescens WH6]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 42/62 (67%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+L+A  QA TQI E TL+F+P+++ + +TLI++ P
Sbjct: 8  DLFREALWLTTMMVAVLVVPSLLVGLLVAMFQAATQINEQTLSFLPRLLVMLVTLIVAGP 67

Query: 68 FI 69
          ++
Sbjct: 68 WL 69


>gi|320538197|ref|ZP_08038092.1| flagellar biosynthetic protein FliQ [Treponema phagedenis F0421]
 gi|320145014|gb|EFW36735.1| flagellar biosynthetic protein FliQ [Treponema phagedenis F0421]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M +  V+ + R  ++ ++    P+L +A+ +G+++A  QA T IQE TLTFVPKI+ + 
Sbjct: 1  MTQGTVITLMREGIFQVVILITPILLAALIVGLIVAIFQATTSIQEQTLTFVPKILTIL 59


>gi|91791410|ref|YP_561061.1| export protein FliQ [Shewanella denitrificans OS217]
 gi|91713412|gb|ABE53338.1| export protein FliQ, family 3 [Shewanella denitrificans OS217]
          Length = 82

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%)

Query: 15 WTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQIS 74
          W     + P+L +A+ +G+LI+  Q +TQIQE+TLTFVPK+I V I + + + ++   I 
Sbjct: 10 WVTSKLAMPILATALVVGLLISIFQVVTQIQEMTLTFVPKLIVVLIVVGMLSGWLLETIQ 69

Query: 75 SFVTLVLSRI 84
          ++    +S+I
Sbjct: 70 TYAITTISKI 79


>gi|292669766|ref|ZP_06603192.1| flagellar biosynthetic protein FliQ [Selenomonas noxia ATCC
          43541]
 gi|292648563|gb|EFF66535.1| flagellar biosynthetic protein FliQ [Selenomonas noxia ATCC
          43541]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 53/83 (63%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++A+ A+  +L  SAP+L   + +G+L+A  QA T IQE TL F+PKIIAVF+ ++I 
Sbjct: 6  VIQLAQEALMIVLLVSAPMLGLGLIVGLLVAVFQATTSIQEQTLAFIPKIIAVFVAILIF 65

Query: 66 APFIGGQISSFVTLVLSRIQSSL 88
           P++   +  +VT V   +   L
Sbjct: 66 GPWMLRIMVEYVTNVFVNLPQYL 88


>gi|229591839|ref|YP_002873958.1| flagellar biosynthesis protein FliQ [Pseudomonas fluorescens
          SBW25]
 gi|229363705|emb|CAY51088.1| flagellar biosynthetic protein FliQ [Pseudomonas fluorescens
          SBW25]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 42/62 (67%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+L+A  QA TQI E TL+F+P+++ + +TLI++ P
Sbjct: 8  DLFREALWLTTVMVAVLVVPSLLVGLLVAMFQAATQINEQTLSFLPRLLVMLVTLIVAGP 67

Query: 68 FI 69
          ++
Sbjct: 68 WL 69


>gi|226326423|ref|ZP_03801941.1| hypothetical protein PROPEN_00271 [Proteus penneri ATCC 35198]
 gi|225205206|gb|EEG87560.1| hypothetical protein PROPEN_00271 [Proteus penneri ATCC 35198]
          Length = 84

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 5  DVLEIARAAMW-TILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          D++  A  A++  IL S+AP+   A F+G++I  LQ +TQ+QE TL F  K+++VF+ L+
Sbjct: 2  DMVYAANKAVYLVILLSAAPIAV-ATFVGLIIGLLQTITQVQEQTLPFGIKLVSVFVCLL 60

Query: 64 ISAPFIGGQI 73
          I+  ++G +I
Sbjct: 61 ITMGWMGDKI 70


>gi|157736466|ref|YP_001489149.1| flagellar basal body protein FliQ [Arcobacter butzleri RM4018]
 gi|315635626|ref|ZP_07890889.1| flagellar biosynthetic protein FliQ [Arcobacter butzleri JV22]
 gi|157698320|gb|ABV66480.1| flagellar basal body protein FliQ [Arcobacter butzleri RM4018]
 gi|315479923|gb|EFU70593.1| flagellar biosynthetic protein FliQ [Arcobacter butzleri JV22]
          Length = 86

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 45/72 (62%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D++ IA   +  IL    P L  +M +G++I+   A+TQ+ + +L+FVPK+I V   ++I
Sbjct: 2  DLIGIAENTVKIILILGLPSLIVSMIIGLVISIFSAVTQVNDASLSFVPKMIFVSAFILI 61

Query: 65 SAPFIGGQISSF 76
          S P++G  + +F
Sbjct: 62 SLPWVGDHLETF 73


>gi|146307833|ref|YP_001188298.1| flagellar biosynthesis protein FliQ [Pseudomonas mendocina ymp]
 gi|145576034|gb|ABP85566.1| flagellar biosynthetic protein FliQ [Pseudomonas mendocina ymp]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 44/69 (63%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W I+      +  ++ +G+++A  QA TQI E TL+F+P+++ + ITLI + P
Sbjct: 8  DLFREALWLIVLIVGLAVVPSLLVGLVVAMFQAATQINEQTLSFLPRLMVMLITLIWAGP 67

Query: 68 FIGGQISSF 76
          ++  Q+  +
Sbjct: 68 WLVSQLMEY 76


>gi|56964018|ref|YP_175749.1| flagellar biosynthesis protein FliQ [Bacillus clausii KSM-K16]
 gi|56910261|dbj|BAD64788.1| flagellar biosynthetic protein FliQ [Bacillus clausii KSM-K16]
          Length = 89

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 46/70 (65%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V  +A++ +WT+L  + P+L  A+ LG++++  QA TQIQE TL F+PKI  V + L+  
Sbjct: 6  VTHLAQSGVWTVLIVAGPLLVVALALGLIVSIFQATTQIQEQTLAFIPKIAGVLLALVFF 65

Query: 66 APFIGGQISS 75
           P++  Q++ 
Sbjct: 66 GPWMLSQLTE 75


>gi|317406211|gb|EFV86459.1| flagellar biosynthesis protein FliQ [Achromobacter xylosoxidans
          C54]
          Length = 89

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L+ + P+L   + +G++I+  QA TQI E+TL+F+PK++A+  
Sbjct: 1  MTAETVMTMTYQAMKIALAMAGPLLVITLIVGLVISIFQAATQINEMTLSFIPKLLAMCG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++ G +  ++  ++ +I
Sbjct: 61 VLVLLGPWLIGIMVDYIRQLIGQI 84


>gi|300871794|ref|YP_003786667.1| putative flagellar protein FliO/FliZ [Brachyspira pilosicoli
          95/1000]
 gi|300689495|gb|ADK32166.1| putative flagellar protein FliO/FliZ [Brachyspira pilosicoli
          95/1000]
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  ++ + +  +WT +  SAPVL  ++ +G++I+ +QA T IQE TLTFVPK+IA+  
Sbjct: 1  MNDTSIIVLVQQTLWTFMLLSAPVLGVSIIVGLIISIIQATTSIQEQTLTFVPKMIAMLA 60

Query: 61 TLIISAPFIGGQISSF 76
           +   A ++   IS F
Sbjct: 61 VIYFLASWMINYISGF 76


>gi|292487981|ref|YP_003530858.1| flagellar biosynthetic protein FliQ [Erwinia amylovora CFBP1430]
 gi|292899201|ref|YP_003538570.1| flagellar biosynthetic protein FliQ [Erwinia amylovora ATCC
          49946]
 gi|291199049|emb|CBJ46160.1| flagellar biosynthetic protein FliQ [Erwinia amylovora ATCC
          49946]
 gi|291553405|emb|CBA20450.1| Flagellar biosynthetic protein FliQ [Erwinia amylovora CFBP1430]
 gi|312172106|emb|CBX80363.1| Flagellar biosynthetic protein FliQ [Erwinia amylovora ATCC
          BAA-2158]
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+LI+ LQA TQI E TL+F+PKI+AV  T++++ P++
Sbjct: 32 GLLISLLQAATQINEQTLSFIPKILAVVTTMVVAGPWM 69


>gi|238788323|ref|ZP_04632117.1| Flagellar biosynthetic protein FliQ [Yersinia frederiksenii ATCC
          33641]
 gi|238723569|gb|EEQ15215.1| Flagellar biosynthetic protein FliQ [Yersinia frederiksenii ATCC
          33641]
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 32/38 (84%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ ++ LQA TQI E+TL+F+PKI++VF T++I+ P++
Sbjct: 32 GLTVSLLQAATQINEMTLSFIPKILSVFATMVIAGPWM 69


>gi|51587303|emb|CAE53682.1| putative HrcS [Pseudomonas fluorescens]
          Length = 87

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D + + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV ITL++
Sbjct: 2  DPIMLFKQGMLLVVVLSAPPLIVAVIVGVLTSLIQALMQIQDQTLPFGIKLVAVGITLVL 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++   + L    +  S
Sbjct: 62 TGRWIGLELIQLINLTFDMVARS 84


>gi|260574403|ref|ZP_05842407.1| export protein FliQ family 3 [Rhodobacter sp. SW2]
 gi|259023299|gb|EEW26591.1| export protein FliQ family 3 [Rhodobacter sp. SW2]
          Length = 88

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E+++ +  R  +W  +  SAP+L  A+  G+++   QALT +QE+TLTFVPK+ A+ +
Sbjct: 1  MTESEIYDTLRQGLWIAVLISAPLLTVALVAGVVVGLFQALTSVQEMTLTFVPKVGAMLV 60

Query: 61 TLIISAPFIGGQISSF 76
             +S  F+   +  F
Sbjct: 61 VFWVSMSFMTSTLVGF 76


>gi|258592487|emb|CBE68796.1| Flagellar biosynthetic protein fliQ [NC10 bacterium 'Dutch
          sediment']
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVT 78
          G+LI+ LQA+T IQE TL FVPKI+ VF+ LI+  P++   + SF T
Sbjct: 32 GLLISILQAVTSIQEQTLAFVPKIVVVFVALILFLPWMMRTMLSFTT 78


>gi|51587279|emb|CAE53664.1| putative HrcS [Pseudomonas fluorescens bv. V]
 gi|51587315|emb|CAE53691.1| putative HrcS [Pseudomonas fluorescens bv. V]
          Length = 87

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL Q+Q+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVVVGVLTSLVQALMQVQDQTLPFGIKLVAVGITLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFDMIGRS 84


>gi|332297775|ref|YP_004439697.1| flagellar biosynthetic protein FliQ [Treponema brennaborense DSM
          12168]
 gi|332180878|gb|AEE16566.1| flagellar biosynthetic protein FliQ [Treponema brennaborense DSM
          12168]
          Length = 89

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          M+  D++ + R  ++ IL   APVL +A+ +G+++A  QA T IQE TLTF PK
Sbjct: 1  MSLGDIVTLIRDGIFQILILVAPVLGAALIIGLIVAIFQATTSIQEQTLTFAPK 54


>gi|203284195|ref|YP_002221935.1| flagellar biosynthesis protein [Borrelia duttonii Ly]
 gi|201083638|gb|ACH93229.1| flagellar biosynthesis protein [Borrelia duttonii Ly]
          Length = 87

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L +A+ +G+L++  QA+T IQ+ TL+F+PKII + + L+I  P+I  ++  F  LV
Sbjct: 21 SAPMLITALIVGLLVSIFQAVTSIQDQTLSFIPKIIIILLVLVIFGPWILKKLMQFTFLV 80

Query: 81 LSRIQS 86
           ++IQ+
Sbjct: 81 FNQIQN 86


>gi|330502777|ref|YP_004379646.1| flagellar biosynthesis protein FliQ [Pseudomonas mendocina NK-01]
 gi|328917063|gb|AEB57894.1| flagellar biosynthesis protein FliQ [Pseudomonas mendocina NK-01]
          Length = 89

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 47/77 (61%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W I+      +  ++ +G+++A  QA TQI E TL+F+P+++ + ITLI + P
Sbjct: 8  DLFREALWLIVLIVGLAVVPSLVVGLIVAMFQAATQINEQTLSFLPRLMVMLITLIWAGP 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++  Q+  +   ++  I
Sbjct: 68 WLVSQLMEYTQTLIQNI 84


>gi|188534131|ref|YP_001907928.1| Flagellar protein [Erwinia tasmaniensis Et1/99]
 gi|188029173|emb|CAO97045.1| Flagellar protein [Erwinia tasmaniensis Et1/99]
          Length = 89

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+LI+ LQA TQI E TL+F+PKI+AV  T++++ P++
Sbjct: 32 GLLISLLQAATQINEQTLSFIPKILAVVTTMVVAGPWM 69


>gi|313895831|ref|ZP_07829385.1| flagellar biosynthetic protein FliQ [Selenomonas sp. oral taxon
          137 str. F0430]
 gi|320529417|ref|ZP_08030505.1| flagellar biosynthetic protein FliQ [Selenomonas artemidis F0399]
 gi|312975256|gb|EFR40717.1| flagellar biosynthetic protein FliQ [Selenomonas sp. oral taxon
          137 str. F0430]
 gi|320138383|gb|EFW30277.1| flagellar biosynthetic protein FliQ [Selenomonas artemidis F0399]
          Length = 89

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 53/83 (63%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++A+ A+  +L  SAP+L   + +G+L+A  QA T IQE TL F+PKI+AVF+ ++I 
Sbjct: 6  VIQLAQEALMIVLLVSAPMLGLGLIVGLLVAVFQATTSIQEQTLAFIPKIVAVFVAILIF 65

Query: 66 APFIGGQISSFVTLVLSRIQSSL 88
           P++   +  +VT V   +   L
Sbjct: 66 GPWMLRIMVEYVTNVFVNLPQYL 88


>gi|70729044|ref|YP_258778.1| flagellar biosynthesis protein FliQ [Pseudomonas fluorescens
          Pf-5]
 gi|68343343|gb|AAY90949.1| flagellar biosynthetic protein FliQ [Pseudomonas fluorescens
          Pf-5]
          Length = 89

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 42/62 (67%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + +TLI++ P
Sbjct: 8  DLFREALWLTTMMVAVLVVPSLLVGLMVAMFQAATQINEQTLSFLPRLLVMLVTLIVAGP 67

Query: 68 FI 69
          ++
Sbjct: 68 WL 69


>gi|283785719|ref|YP_003365584.1| flagellar biosynthesis protein FliQ [Citrobacter rodentium
          ICC168]
 gi|282949173|emb|CBG88781.1| flagellar biosynthesis protein FliQ [Citrobacter rodentium
          ICC168]
          Length = 89

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+ LQA TQI E+TL+F+PKI+AVF  +II+ P++
Sbjct: 32 GLTISILQAATQINEMTLSFIPKIVAVFTAIIIAGPWM 69


>gi|51587291|emb|CAE53673.1| putative HrcS [Pseudomonas fluorescens]
          Length = 87

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 47/77 (61%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL Q+Q+ TL F  K++AV +TL+++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVIVGVLTSLVQALMQVQDQTLPFGVKLVAVGVTLVLTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L+   I  S
Sbjct: 68 VELIQLINLMFEMIARS 84


>gi|332526332|ref|ZP_08402459.1| hypothetical protein RBXJA2T_10721 [Rubrivivax benzoatilyticus
          JA2]
 gi|332110469|gb|EGJ10792.1| hypothetical protein RBXJA2T_10721 [Rubrivivax benzoatilyticus
          JA2]
          Length = 91

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ ++ +++   A+W +L  SAP +  A  +G+LIA +QA TQIQE T  +  K+ A+ +
Sbjct: 1  MSGSEAMQLTLQALWLVLLLSAPPVLVAAVVGLLIAIVQAATQIQEQTFQYAAKLFAIVL 60

Query: 61 TLIISAPFIGGQISSF 76
          T+ ++A  +GG + +F
Sbjct: 61 TIFVTAALLGGTLYAF 76


>gi|229588262|ref|YP_002870381.1| putative type III secretion membrane protein [Pseudomonas
          fluorescens SBW25]
 gi|15042143|gb|AAK81924.1|AF292566_8 RscS [Pseudomonas fluorescens]
 gi|229360128|emb|CAY46985.1| putative type III secretion membrane protein [Pseudomonas
          fluorescens SBW25]
          Length = 87

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G++ + +QAL Q+Q+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLLVAVVVGVMTSLVQALMQVQDQTLPFGIKLVAVGITLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFDMIGRS 84


>gi|312958829|ref|ZP_07773348.1| type III secretion system rscS [Pseudomonas fluorescens WH6]
 gi|311286599|gb|EFQ65161.1| type III secretion system rscS [Pseudomonas fluorescens WH6]
          Length = 87

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL Q+Q+ TL F  K++AV +TLI++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVVVGVLTSLVQALMQVQDQTLPFGVKLVAVGVTLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFEMIGRS 84


>gi|15615004|ref|NP_243307.1| flagellar biosynthesis protein FliQ [Bacillus halodurans C-125]
 gi|10175061|dbj|BAB06160.1| flagellar protein required for flagellar formation [Bacillus
          halodurans C-125]
          Length = 89

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 51/80 (63%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          ++ IA   +WT+L  + P+L  A+ LG+ ++  QA TQIQE TL F+PKI+ V ++L++ 
Sbjct: 6  IIGIAERGVWTVLLVAGPLLLVALGLGLFVSIFQATTQIQEQTLAFIPKIVGVLVSLVLF 65

Query: 66 APFIGGQISSFVTLVLSRIQ 85
           P++  Q+ +F   + + + 
Sbjct: 66 GPWMLSQLLNFAYSIFNNLH 85


>gi|77918769|ref|YP_356584.1| flagellar biosynthetic protein FliQ [Pelobacter carbinolicus DSM
          2380]
 gi|77544852|gb|ABA88414.1| flagellar biosynthetic protein FliQ [Pelobacter carbinolicus DSM
          2380]
          Length = 89

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 36/53 (67%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          +++  QA TQI E T+TF+PKI+AVF+TL+I AP++   + +F   +   I +
Sbjct: 34 MVSIFQAATQINEQTMTFIPKIVAVFVTLLICAPWMIRTLLTFTKNIFGNIPN 86


>gi|321399634|emb|CBJ44641.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTE-J5-708]
          Length = 84

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMMLVVLLSAPPLIVAVVVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|150019067|ref|YP_001311321.1| export protein FliQ [Clostridium beijerinckii NCIMB 8052]
 gi|149905532|gb|ABR36365.1| export protein FliQ, family 3 [Clostridium beijerinckii NCIMB
          8052]
          Length = 89

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIA 57
          SAP+L   + LG+ I+ +QA TQIQE TLTFVPK+IA
Sbjct: 21 SAPILIVVLVLGLAISIIQATTQIQEQTLTFVPKLIA 57


>gi|167584014|ref|ZP_02376402.1| type III secretion inner membrane protein SctS [Burkholderia
          ubonensis Bu]
          Length = 87

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  METDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          T+ I+ P+   +I  F   +LS
Sbjct: 61 TVAIAGPWAAAEILHFAQQLLS 82


>gi|296162491|ref|ZP_06845282.1| type III secretion protein, HrpO family [Burkholderia sp. Ch1-1]
 gi|295887304|gb|EFG67131.1| type III secretion protein, HrpO family [Burkholderia sp. Ch1-1]
          Length = 91

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P L  A  +G+LI  LQ++TQIQ+ +L +  KII V   LII+AP+   ++S F+  V
Sbjct: 22 SLPALAVATAVGLLIGLLQSVTQIQDQSLPYGAKIICVGGVLIITAPWANRELSRFLAHV 81

Query: 81 LSRIQSS 87
           + I + 
Sbjct: 82 FTYIAAG 88


>gi|330812429|ref|YP_004356891.1| type III secretion protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|51587295|emb|CAE53676.1| putative HrcS [Pseudomonas fluorescens bv. I]
 gi|312597802|gb|ADQ89917.1| RscS [Pseudomonas fluorescens]
 gi|315140169|gb|ADT81059.1| RscS [Pseudomonas fluorescens]
 gi|315140173|gb|ADT81062.1| RscS [Pseudomonas fluorescens]
 gi|315140177|gb|ADT81065.1| RscS [Pseudomonas fluorescens]
 gi|315140181|gb|ADT81068.1| RscS [Pseudomonas fluorescens]
 gi|315140185|gb|ADT81071.1| RscS [Pseudomonas fluorescens]
 gi|315140189|gb|ADT81074.1| RscS [Pseudomonas fluorescens]
 gi|315140197|gb|ADT81080.1| RscS [Pseudomonas fluorescens]
 gi|315140201|gb|ADT81083.1| RscS [Pseudomonas fluorescens]
 gi|315140205|gb|ADT81086.1| RscS [Pseudomonas fluorescens]
 gi|315140209|gb|ADT81089.1| RscS [Pseudomonas fluorescens]
 gi|315140213|gb|ADT81092.1| RscS [Pseudomonas fluorescens]
 gi|315140217|gb|ADT81095.1| RscS [Pseudomonas fluorescens]
 gi|315140221|gb|ADT81098.1| RscS [Pseudomonas fluorescens]
 gi|315140225|gb|ADT81101.1| RscS [Pseudomonas fluorescens]
 gi|315140229|gb|ADT81104.1| RscS [Pseudomonas fluorescens]
 gi|315140233|gb|ADT81107.1| RscS [Pseudomonas fluorescens]
 gi|315140241|gb|ADT81113.1| RscS [Pseudomonas fluorescens]
 gi|315140245|gb|ADT81116.1| RscS [Pseudomonas fluorescens]
 gi|327380537|gb|AEA71887.1| putative type III secretion protein [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
          Length = 84

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLVVLLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|51587319|emb|CAE53694.1| putative HrcS [Pseudomonas fluorescens]
          Length = 84

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLVVLLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|51587255|emb|CAE53646.1| putative HrcS [Pseudomonas salomonii]
          Length = 87

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL Q+Q+ TL F  K++AV ITL+++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVVVGVLTSLVQALMQVQDQTLPFGIKLVAVGITLVMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFEMISRS 84


>gi|312884594|ref|ZP_07744298.1| HrpO family type III secretion protein [Vibrio caribbenthicus
          ATCC BAA-2122]
 gi|309367906|gb|EFP95454.1| HrpO family type III secretion protein [Vibrio caribbenthicus
          ATCC BAA-2122]
          Length = 89

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEA ++      +W +L  S PV+  A  +GI+++  QALTQIQ+ +L F+ K++AV I
Sbjct: 1  MNEAVIVHFTSELLWLVLILSLPVVVVASVVGIMVSLFQALTQIQDQSLQFLIKLVAVCI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T+ +S  ++G  + ++  L   +I
Sbjct: 61 TIAVSYHWMGSTLLNYAGLAFDQI 84


>gi|254436897|ref|ZP_05050391.1| flagellar biosynthetic protein FliQ [Octadecabacter antarcticus
          307]
 gi|198252343|gb|EDY76657.1| flagellar biosynthetic protein FliQ [Octadecabacter antarcticus
          307]
          Length = 88

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (60%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +E  R A W I+ ++ P+L  A+ +G++I  +QA T I E+TL+FVPK++ V   +   +
Sbjct: 7  IESLRLAYWQIIIAAGPILGVALAVGLVIGIIQAATSINEMTLSFVPKLVIVLAAMAGFS 66

Query: 67 PFIGGQISSFVTLVLSRIQ 85
           F+  +++ +   +  +I+
Sbjct: 67 TFMMQEMTDYFASIFEQIR 85


>gi|311695202|gb|ADP98075.1| flagellar biosynthetic protein FliQ [marine bacterium HP15]
          Length = 89

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 44/69 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  ++ ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWMIVLLASIIIGPGLVIGLVVSTFQAATQINEQTLSFLPRLLVTLI 60

Query: 61 TLIISAPFI 69
           +I+  P++
Sbjct: 61 VIIVWGPWM 69


>gi|167585023|ref|ZP_02377411.1| flagellar biosynthesis protein FliQ [Burkholderia ubonensis Bu]
          Length = 90

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  AM   L  SAP+L  A+ +G+L++  QA TQI E TL+F+PK++AV  
Sbjct: 1  MTPEQVMTLAHHAMVVGLLVSAPLLLVALAVGLLVSLFQAATQINESTLSFIPKLLAVLA 60

Query: 61 TLIISAPFI 69
          TL+I+ P++
Sbjct: 61 TLVIAGPWM 69


>gi|82470757|gb|ABB77409.1| HrcS [Pantoea stewartii subsp. stewartii]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 44/66 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          +++ + + AM  ++  SAP L  A+ +G+L++ LQA+ Q+Q+ TL F  K++AV I L +
Sbjct: 2  EIMNLFKQAMLLVVLLSAPPLLVAVIVGVLVSLLQAVMQLQDQTLPFAIKLVAVGIALAL 61

Query: 65 SAPFIG 70
          S  +IG
Sbjct: 62 SGRWIG 67


>gi|321399614|emb|CBJ44626.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTE-25-201]
 gi|321399638|emb|CBJ44644.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-25-321]
 gi|321399646|emb|CBJ44650.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-48-521]
 gi|321399650|emb|CBJ44653.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-48-522]
 gi|321399662|emb|CBJ44662.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-522]
          Length = 84

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLVVLLSAPPLIVAVVVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|188997534|ref|YP_001931785.1| flagellar biosynthetic protein FliQ [Sulfurihydrogenibium sp.
          YO3AOP1]
 gi|188932601|gb|ACD67231.1| flagellar biosynthetic protein FliQ [Sulfurihydrogenibium sp.
          YO3AOP1]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          + PV+     +G+LI+  QA TQI E+T+TFVPKIIA  I LII   ++  ++  +   V
Sbjct: 21 AGPVILITFIVGLLISIFQAATQINEMTITFVPKIIAAVIGLIIFGSWMTTKLVDYTKEV 80

Query: 81 LSRI 84
          L  I
Sbjct: 81 LMMI 84


>gi|51894126|ref|YP_076817.1| flagellar biosynthetic protein [Symbiobacterium thermophilum IAM
          14863]
 gi|51857815|dbj|BAD41973.1| flagellar biosynthetic protein [Symbiobacterium thermophilum IAM
          14863]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L++A+ A+   L  +APV+  ++ +G++I+  QA TQ+ E +L FVPKI+A    L++  
Sbjct: 7  LDLAQEAVRVALYVAAPVIGLSLLVGLIISLFQATTQVHEPSLQFVPKILAAVAGLVVFG 66

Query: 67 PFIGGQISSFVTLVLS 82
          P++   +  F   V+ 
Sbjct: 67 PWMLTTLMDFARRVMD 82


>gi|300311364|ref|YP_003775456.1| flagellar biosynthesis protein FliQ [Herbaspirillum seropedicae
          SmR1]
 gi|300074149|gb|ADJ63548.1| flagellar biosynthetic FliQ protein [Herbaspirillum seropedicae
          SmR1]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L +A+ +G+L++  QA TQI E TL F+PK++ VF+
Sbjct: 1  MTPESVMTMGRQAMEITLLIAAPMLLTALLIGLLVSIFQAATQINEQTLAFIPKLLGVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           +I++ P+I   I  ++  + S I
Sbjct: 61 AMIVAGPWILTVIVDYMHTMFSGI 84


>gi|300310130|ref|YP_003774222.1| type III secretion HrcS protein [Herbaspirillum seropedicae SmR1]
 gi|300072915|gb|ADJ62314.1| type III secretion HrcS protein [Herbaspirillum seropedicae SmR1]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          AD +   + ++W  +  SAP L  A   G+ ++ +QA+TQIQ+ TL +V K++AV +TL 
Sbjct: 2  ADTINFFQQSLWMAIMMSAPPLLIATLCGLGVSLIQAVTQIQDQTLPYVVKLVAVAVTLA 61

Query: 64 ISAPFIG 70
              +IG
Sbjct: 62 SMGRWIG 68


>gi|269138237|ref|YP_003294937.1| type III secretion apparatus [Edwardsiella tarda EIB202]
 gi|55981989|gb|AAV69419.1| EsaS [Edwardsiella tarda]
 gi|61743014|gb|AAX55234.1| EsaS [Edwardsiella tarda]
 gi|267983897|gb|ACY83726.1| type III secretion apparatus [Edwardsiella tarda EIB202]
 gi|304558280|gb|ADM40944.1| EsaS [Edwardsiella tarda FL6-60]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 50/76 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +A ++++A   +W +L  S PV+  A  +G+L+  +QALTQIQ+ T++F  K++A  +
Sbjct: 1  MGKAQLVQLASELLWLVLILSLPVVLVASLVGVLVGLVQALTQIQDQTVSFAIKLVAASV 60

Query: 61 TLIISAPFIGGQISSF 76
          TL ++  ++G  + S+
Sbjct: 61 TLALTYHWMGSALFSY 76


>gi|304438441|ref|ZP_07398381.1| flagellar biosynthetic protein FliQ [Selenomonas sp. oral taxon
          149 str. 67H29BP]
 gi|304368524|gb|EFM22209.1| flagellar biosynthetic protein FliQ [Selenomonas sp. oral taxon
          149 str. 67H29BP]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (71%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++A+ A+  +L  SAP+L   + +G+L+A  QA T IQE TL F+PKIIAVF+ ++I 
Sbjct: 6  VIQLAQEALMIVLLVSAPMLGLGLIVGLLVAVFQATTSIQEQTLAFIPKIIAVFVAILIF 65

Query: 66 APFI 69
           P++
Sbjct: 66 GPWM 69


>gi|160896098|ref|YP_001561680.1| flagellar biosynthetic protein FliQ [Delftia acidovorans SPH-1]
 gi|160361682|gb|ABX33295.1| flagellar biosynthetic protein FliQ [Delftia acidovorans SPH-1]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL   R A+  +L  S PVL   + +G+ ++  QA+TQ+ E TL FVPK+I+  +
Sbjct: 1  MTSQYVLTFGREALTLLLMISMPVLGVVLAVGLAVSVFQAVTQVHEATLAFVPKLISAVL 60

Query: 61 TLIISAPFIGGQISSFV 77
             I+ P++   +  F+
Sbjct: 61 VFAIAGPWMLSTLVDFI 77


>gi|312148034|gb|ADQ30693.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi JD1]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLTIVIFGPWILNKLMQFTYMI 80

Query: 81 LSRIQS 86
           S++Q+
Sbjct: 81 FSQLQN 86


>gi|15594619|ref|NP_212408.1| flagellar biosynthesis protein (fliQ) [Borrelia burgdorferi B31]
 gi|195941372|ref|ZP_03086754.1| flagellar biosynthesis protein [Borrelia burgdorferi 80a]
 gi|216264187|ref|ZP_03436179.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 156a]
 gi|218249705|ref|YP_002374797.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi ZS7]
 gi|221217705|ref|ZP_03589173.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 72a]
 gi|223888945|ref|ZP_03623536.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 64b]
 gi|224533130|ref|ZP_03673730.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi
          WI91-23]
 gi|224533782|ref|ZP_03674370.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi
          CA-11.2a]
 gi|225549140|ref|ZP_03770115.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 94a]
 gi|225550226|ref|ZP_03771186.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 118a]
 gi|226320575|ref|ZP_03796135.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 29805]
 gi|226321592|ref|ZP_03797118.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi Bol26]
 gi|3023774|sp|Q44906|FLIQ_BORBU RecName: Full=Flagellar biosynthetic protein FliQ
 gi|1165259|gb|AAA85598.1| FliQ [Borrelia burgdorferi]
 gi|1185060|gb|AAB58969.1| flagellar export protein [Borrelia burgdorferi]
 gi|2688192|gb|AAC66674.1| flagellar biosynthesis protein (fliQ) [Borrelia burgdorferi B31]
 gi|215980660|gb|EEC21467.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 156a]
 gi|218164893|gb|ACK74954.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi ZS7]
 gi|221192382|gb|EEE18601.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 72a]
 gi|223885761|gb|EEF56860.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 64b]
 gi|224511857|gb|EEF82258.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi
          WI91-23]
 gi|224513075|gb|EEF83438.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi
          CA-11.2a]
 gi|225369338|gb|EEG98791.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 118a]
 gi|225370366|gb|EEG99804.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 94a]
 gi|226232781|gb|EEH31534.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi Bol26]
 gi|226233994|gb|EEH32715.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi 29805]
 gi|312149214|gb|ADQ29285.1| flagellar biosynthetic protein FliQ [Borrelia burgdorferi N40]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 47/66 (71%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + + ++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLVIVIFGPWILNKLMQFTYMI 80

Query: 81 LSRIQS 86
           S++Q+
Sbjct: 81 FSQLQN 86


>gi|171322879|ref|ZP_02911584.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MEX-5]
 gi|171091753|gb|EDT37283.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MEX-5]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 48/82 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  MDIDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          T+ I+ P+   +I  F   +LS
Sbjct: 61 TVAIAGPWAAAEILHFAQQLLS 82


>gi|15596644|ref|NP_250138.1| flagellar biosynthesis protein FliQ [Pseudomonas aeruginosa PAO1]
 gi|107100881|ref|ZP_01364799.1| hypothetical protein PaerPA_01001911 [Pseudomonas aeruginosa
          PACS2]
 gi|116049392|ref|YP_791805.1| flagellar biosynthesis protein FliQ [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|218892680|ref|YP_002441549.1| flagellar biosynthesis protein FliQ [Pseudomonas aeruginosa
          LESB58]
 gi|254234546|ref|ZP_04927869.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa
          C3719]
 gi|254239797|ref|ZP_04933119.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa 2192]
 gi|296390186|ref|ZP_06879661.1| flagellar biosynthesis protein FliQ [Pseudomonas aeruginosa PAb1]
 gi|313106446|ref|ZP_07792677.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa
          39016]
 gi|9947398|gb|AAG04836.1|AE004574_7 flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa PAO1]
 gi|115584613|gb|ABJ10628.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|126166477|gb|EAZ51988.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa
          C3719]
 gi|126193175|gb|EAZ57238.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa 2192]
 gi|218772908|emb|CAW28720.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa
          LESB58]
 gi|310879179|gb|EFQ37773.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa
          39016]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 48/84 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     L++ R A+W        ++  ++ +G+++A  QA TQI E TL+F+P+++ + +
Sbjct: 1  MTPEVALDLFREALWLTAMIVGVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLMVILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TLI+  P++  Q+  +   ++  I
Sbjct: 61 TLIVLGPWLLRQLMEYTQTLIGNI 84


>gi|74317114|ref|YP_314854.1| flagellar biosynthetic protein FliQ [Thiobacillus denitrificans
          ATCC 25259]
 gi|74056609|gb|AAZ97049.1| flagellar biosynthetic protein FliQ [Thiobacillus denitrificans
          ATCC 25259]
          Length = 84

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++AR A+W  ++ + P+L + + +   ++  QA TQI E TL FVPK++ V + L     
Sbjct: 3  DLARDALWLTVTIAGPLLVAGLLVAFAVSLFQAATQILEPTLAFVPKLLIVVLVLAALGG 62

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++  Q+  F   VL+   S L
Sbjct: 63 WMSDQLVEFARGVLTDFPSLL 83


>gi|114320139|ref|YP_741822.1| flagellar biosynthetic protein FliQ [Alkalilimnicola ehrlichii
          MLHE-1]
 gi|114226533|gb|ABI56332.1| flagellar biosynthetic protein FliQ [Alkalilimnicola ehrlichii
          MLHE-1]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +E+ + A+   +  + P+L SA+  G+LI   QA TQI E TL+FVPK+  + +
Sbjct: 1  MTPELAIELGKQALTVAVLLAGPILLSALITGLLIGLFQAATQINEQTLSFVPKLGVMAL 60

Query: 61 TLIISAPFIGGQISSF 76
           L I  P++   ++ F
Sbjct: 61 VLFIMTPWMHTILTDF 76


>gi|170737011|ref|YP_001778271.1| flagellar biosynthetic protein FliQ [Burkholderia cenocepacia
          MC0-3]
 gi|169819199|gb|ACA93781.1| flagellar biosynthetic protein FliQ [Burkholderia cenocepacia
          MC0-3]
          Length = 90

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 34/52 (65%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSR 83
          G+L+A  QA TQI E T++F+P++I   + L ++ P++ G++  +   + SR
Sbjct: 33 GVLVAIFQAATQINEQTMSFLPRLITTLVALALAGPWMTGRVMHYTVEIFSR 84


>gi|138894756|ref|YP_001125209.1| flagellar biosynthesis protein FliQ [Geobacillus
          thermodenitrificans NG80-2]
 gi|196247622|ref|ZP_03146324.1| flagellar biosynthetic protein FliQ [Geobacillus sp. G11MC16]
 gi|134266269|gb|ABO66464.1| Flagellar protein required for Flagellar formation [Geobacillus
          thermodenitrificans NG80-2]
 gi|196212406|gb|EDY07163.1| flagellar biosynthetic protein FliQ [Geobacillus sp. G11MC16]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 52/81 (64%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          ++ +A   ++ +L    P+L  ++ +G++++  QA TQIQE TLTFVPKIIAV + L++ 
Sbjct: 6  IIRLAEQGVYIVLIVCGPLLLLSLIVGLVVSIFQAATQIQEQTLTFVPKIIAVLLGLVLF 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++  ++ S+   + + + S
Sbjct: 66 GPWMLSKMVSYAHDIFNNLAS 86


>gi|213025315|ref|ZP_03339762.1| putative type III secretion protein [Salmonella enterica subsp.
          enterica serovar Typhi str. 404ty]
          Length = 57

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 40/53 (75%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++++ +QALTQIQ+ TL F+ K++A+ ITL++S P++ G + ++   ++ RI
Sbjct: 1  GVIVSLVQALTQIQDQTLQFMIKLLAIAITLMVSYPWLSGILLNYTRQIMLRI 53


>gi|260775666|ref|ZP_05884562.1| type III secretion protein HrpO [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260608082|gb|EEX34251.1| type III secretion protein HrpO [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 85

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (67%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D+L +   ++W ++  S P L  A  +G+L++ +QAL Q+Q+ TL FV K+I+V +TL++
Sbjct: 2  DILTVFAQSLWLVVVLSLPCLIVASGVGVLVSLIQALMQLQDQTLPFVIKLISVGLTLVM 61

Query: 65 SAPFI 69
          +  ++
Sbjct: 62 TGRWM 66


>gi|224826621|ref|ZP_03699722.1| flagellar biosynthetic protein FliQ [Lutiella nitroferrum 2002]
 gi|224601222|gb|EEG07404.1| flagellar biosynthetic protein FliQ [Lutiella nitroferrum 2002]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 58/81 (71%), Gaps = 3/81 (3%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+ + + A++ ++  +APVL  ++ +G+L++ LQA TQI E+TLTF+PK++A+F+TL+++
Sbjct: 6  VINLVQNALYVLIIVAAPVLLVSLLVGLLVSVLQAATQINEMTLTFIPKLLALFVTLVLA 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++   I++ V   +   QS
Sbjct: 66 GPWM---INTLVDYTVRLFQS 83


>gi|197286516|ref|YP_002152388.1| type III secretion system protein [Proteus mirabilis HI4320]
 gi|227357590|ref|ZP_03841943.1| flagellar biosynthesis protein FliQ [Proteus mirabilis ATCC
          29906]
 gi|194684003|emb|CAR45293.1| putative type III secretion system protein [Proteus mirabilis
          HI4320]
 gi|227162300|gb|EEI47304.1| flagellar biosynthesis protein FliQ [Proteus mirabilis ATCC
          29906]
          Length = 84

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 5  DVLEIARAAMW-TILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          D++  A  A++  IL S+AP+   A F+G+LI  LQ +TQIQE TL F  K++ VF+ L+
Sbjct: 2  DMVYAANKAIYLIILLSAAPIAI-ATFIGLLIGLLQTITQIQEQTLPFGVKLVGVFVCLL 60

Query: 64 ISAPFIGGQI 73
          +   ++G ++
Sbjct: 61 MMMGWMGDKL 70


>gi|50121006|ref|YP_050173.1| type III secretion system protein [Pectobacterium atrosepticum
          SCRI1043]
 gi|42560425|gb|AAS20385.1| HrcS [Pectobacterium atrosepticum]
 gi|49611532|emb|CAG74980.1| type III secretion protein [Pectobacterium atrosepticum SCRI1043]
 gi|167030915|gb|ABZ05783.1| HrcS [Pectobacterium carotovorum subsp. carotovorum]
          Length = 86

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 44/66 (66%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          +++ + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K+I+V +TL +
Sbjct: 2  EIITLFRQAMVMVVLLSAPPLLVAVIVGVLISLLQAVMQLQDQTLPFAVKLISVGLTLAL 61

Query: 65 SAPFIG 70
             +IG
Sbjct: 62 CGRWIG 67


>gi|238785154|ref|ZP_04629148.1| Secretion system apparatus protein ssaS [Yersinia bercovieri ATCC
          43970]
 gi|238713969|gb|EEQ05987.1| Secretion system apparatus protein ssaS [Yersinia bercovieri ATCC
          43970]
          Length = 89

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ +A   +W +L  S PV+  A  +G++++ LQALTQIQ+ TL F+ K++AV  
Sbjct: 1  MSNAIVIHLATQLLWIVLLLSMPVVVVASVVGLVVSLLQALTQIQDQTLQFLIKLLAVSA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+I+  ++G  + ++
Sbjct: 61 TLLITYHWMGSTLLNY 76


>gi|134294020|ref|YP_001117756.1| HrpO family type III secretion protein [Burkholderia
          vietnamiensis G4]
 gi|134137177|gb|ABO58291.1| type III secretion protein, HrpO family [Burkholderia
          vietnamiensis G4]
          Length = 92

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  +  V ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVAIATVTGLVVAILQAVTQVQDANIGIVVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++G ++  F    L R+
Sbjct: 61 ALVLLSGWLGSEVLRFAQQALERM 84


>gi|157371198|ref|YP_001479187.1| flagellar biosynthesis protein FliQ [Serratia proteamaculans 568]
 gi|157322962|gb|ABV42059.1| flagellar biosynthetic protein FliQ [Serratia proteamaculans 568]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 32/38 (84%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AV  T++I+ P++
Sbjct: 32 GLVVSLLQAATQINEMTLSFIPKILAVVATIVIAGPWM 69


>gi|226225723|ref|YP_002759829.1| flagellar biosynthetic protein FliQ [Gemmatimonas aurantiaca
          T-27]
 gi|226088914|dbj|BAH37359.1| flagellar biosynthetic protein FliQ [Gemmatimonas aurantiaca
          T-27]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++ R A+ T L  SAP+L  A+ +G++IA +Q++TQIQE TL FVPK+I V  
Sbjct: 1  MSHQIVIDLTRDAIMTALMVSAPLLLLALGVGLIIAIIQSVTQIQEQTLVFVPKLILVGG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            I+  P++   +  F T ++  I
Sbjct: 61 AFIVGLPWLMQIMIKFTTQIIRGI 84


>gi|239817148|ref|YP_002946058.1| flagellar biosynthetic protein FliQ [Variovorax paradoxus S110]
 gi|239803725|gb|ACS20792.1| flagellar biosynthetic protein FliQ [Variovorax paradoxus S110]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   A+   L   AP+L  A+ +G++I+  QA TQI E TL+F+PK++AVF 
Sbjct: 1  MTPESVMSLGSQAIHVSLLLGAPMLLVALVVGLVISIFQAATQINEATLSFIPKLLAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+++ P++  Q+  ++  + S I
Sbjct: 61 VLVLAGPWMLAQMLDYIRTLFSSI 84


>gi|51587275|emb|CAE53661.1| putative HrcS [Pseudomonas fluorescens bv. V]
 gi|51587287|emb|CAE53670.1| putative HrcS [Pseudomonas fluorescens bv. V]
 gi|226446412|gb|ACO58571.1| HrcS [Pseudomonas fluorescens]
          Length = 87

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  +AP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TLI++  +IG
Sbjct: 8  KQGMLLVVVLTAPPLMVAVVVGVLTSLVQALMQIQDQTLPFGIKLVAVGVTLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFEMIGRS 84


>gi|167841180|ref|ZP_02467864.1| type III secretion apparatus protein EscS [Burkholderia
          thailandensis MSMB43]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA + ++A   MW +L  S PV+  A  +GIL++ +QALTQ+Q+ T+ F+ K++AV +
Sbjct: 1  MSEAVITQLAAQMMWLVLLLSLPVVVVASVVGILVSLVQALTQVQDQTIQFLIKLLAVAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL  +  ++G  + ++ T   ++I
Sbjct: 61 TLAATYHWMGDVLINYATQSFNQI 84


>gi|104782807|ref|YP_609305.1| flagellar biosynthesis protein FliQ [Pseudomonas entomophila L48]
 gi|95111794|emb|CAK16518.1| flagellar biosynthetic protein FliQ [Pseudomonas entomophila L48]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 42/62 (67%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + ITLI++ P
Sbjct: 8  DLFRNALWLTTLMVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLITLIVAGP 67

Query: 68 FI 69
          ++
Sbjct: 68 WL 69


>gi|149182520|ref|ZP_01860993.1| flagellar biosynthesis protein Q [Bacillus sp. SG-1]
 gi|148849780|gb|EDL63957.1| flagellar biosynthesis protein Q [Bacillus sp. SG-1]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 51/85 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A   ++T L    P+L  A+ +G+ ++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MNAESVIALAERGVYTTLVICGPLLLLALVVGLAVSIFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           ++   P++  ++ ++ + + S + 
Sbjct: 61 GVVFFGPWMLTKLVTYASDIFSNLN 85


>gi|300717242|ref|YP_003742045.1| flagellar biosynthesis protein [Erwinia billingiae Eb661]
 gi|299063078|emb|CAX60198.1| Flagellar biosynthesis protein [Erwinia billingiae Eb661]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E TL+F+PKI+AV  T++I+ P++
Sbjct: 32 GLIISLLQAATQINEQTLSFIPKILAVVATMVIAGPWM 69


>gi|32490798|ref|NP_871052.1| hypothetical protein WGLp049 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|25166004|dbj|BAC24195.1| fliQ [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 90

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 35/44 (79%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          SA  L +AM  G++I+ LQA TQI E+TL+F+PKI++V IT++I
Sbjct: 21 SAIPLLAAMITGLIISILQASTQINEMTLSFIPKILSVIITILI 64


>gi|126665004|ref|ZP_01735987.1| flagellar biosynthesis protein Q [Marinobacter sp. ELB17]
 gi|126630374|gb|EBA00989.1| flagellar biosynthesis protein Q [Marinobacter sp. ELB17]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 44/69 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  ++ ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWMIVLLASVIITPGLIIGLVVSTFQAATQINEQTLSFLPRLLITLI 60

Query: 61 TLIISAPFI 69
           +I+  P++
Sbjct: 61 VIIVWGPWM 69


>gi|253990105|ref|YP_003041461.1| flagellar biosynthesis protein FliQ [Photorhabdus asymbiotica
          subsp. asymbiotica ATCC 43949]
 gi|253781555|emb|CAQ84718.1| flagellar biosynthetic protein fliq [Photorhabdus asymbiotica]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 31/36 (86%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          +++ LQA TQ+ E+TL+F+PKI+AVF+T +I+ P++
Sbjct: 34 IVSLLQAATQVNEMTLSFIPKILAVFVTTVIAGPWM 69


>gi|237755396|ref|ZP_04584023.1| flagellar biosynthetic protein FliQ [Sulfurihydrogenibium
          yellowstonense SS-5]
 gi|237692437|gb|EEP61418.1| flagellar biosynthetic protein FliQ [Sulfurihydrogenibium
          yellowstonense SS-5]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
            PV+     +G+LI+  QA TQI E+T+TFVPKIIA  I LII   ++  ++  +   V
Sbjct: 21 GGPVILITFIVGLLISIFQAATQINEMTITFVPKIIAAVIGLIIFGSWMTTKLVDYTKEV 80

Query: 81 LSRI 84
          L  I
Sbjct: 81 LMMI 84


>gi|85060035|ref|YP_455737.1| flagellar biosynthesis protein FliQ [Sodalis glossinidius str.
          'morsitans']
 gi|84780555|dbj|BAE75332.1| flagellar biosynthetic protein FliQ [Sodalis glossinidius str.
          'morsitans']
          Length = 89

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 39/55 (70%)

Query: 30 FLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          F G++I+ LQA TQ+ E+TL+F+PKI+AV  T+ ++ P++   I  ++  +L+ +
Sbjct: 30 FSGLIISLLQAATQVNEMTLSFIPKILAVVATITLAGPWMLNLILDYMRTLLTNL 84


>gi|238918895|ref|YP_002932409.1| EsaS [Edwardsiella ictaluri 93-146]
 gi|48256989|gb|AAT41684.1| type three secretion apparatus protein S [Edwardsiella ictaluri]
 gi|84663103|gb|ABC60085.1| EsaS [Edwardsiella ictaluri 93-146]
 gi|238868463|gb|ACR68174.1| EsaS [Edwardsiella ictaluri 93-146]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A ++++A   +W +L  S PV+  A  +G+L+  +QALTQIQ+ T++F  K++A  +
Sbjct: 1  MGTAQLVQLASELLWLVLILSLPVVLVASLVGVLVGLVQALTQIQDQTVSFAIKLVAACV 60

Query: 61 TLIISAPFIGGQISSF 76
          TL ++  ++G  + S+
Sbjct: 61 TLALTYHWMGSALFSY 76


>gi|270262392|ref|ZP_06190663.1| flagellar biosynthesis protein FliQ [Serratia odorifera 4Rx13]
 gi|270043076|gb|EFA16169.1| flagellar biosynthesis protein FliQ [Serratia odorifera 4Rx13]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 32/38 (84%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E+TL+F+PKI+AV  T++++ P++
Sbjct: 32 GLVVSLLQAATQINEMTLSFIPKILAVVATIVVAGPWM 69


>gi|225552410|ref|ZP_03773350.1| flagellar biosynthetic protein FliQ [Borrelia sp. SV1]
 gi|225371408|gb|EEH00838.1| flagellar biosynthetic protein FliQ [Borrelia sp. SV1]
          Length = 87

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLTIVIFGPWILNKLMRFTYII 80

Query: 81 LSRIQS 86
           S++Q+
Sbjct: 81 FSQLQN 86


>gi|156933431|ref|YP_001437347.1| flagellar biosynthesis protein FliQ [Cronobacter sakazakii ATCC
          BAA-894]
 gi|156531685|gb|ABU76511.1| hypothetical protein ESA_01249 [Cronobacter sakazakii ATCC
          BAA-894]
          Length = 90

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+ LQA TQI E+TL+F+PKI+AVF+ ++ + P++
Sbjct: 33 GLFISILQAATQINEMTLSFIPKILAVFVVIVAAGPWM 70


>gi|332159963|ref|YP_004296540.1| type III secretion system protein [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|318607486|emb|CBY28984.1| type III secretion inner membrane protein (YscS,homologous to
          flagellar export components) [Yersinia enterocolitica
          subsp. palearctica Y11]
 gi|325664193|gb|ADZ40837.1| type III secretion system protein [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330862412|emb|CBX72571.1| secretion system apparatus protein ssaS [Yersinia enterocolitica
          W22703]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ +A   +W +L  S PV+  A  +GI+++ LQALTQIQ+ TL F+ K++AV  
Sbjct: 1  MSNAIVVHLATQLLWIVLLLSMPVVVVASVVGIVVSLLQALTQIQDQTLQFLIKLLAVSA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+I+  ++G  + ++
Sbjct: 61 TLLITYHWMGSTLLNY 76


>gi|34498580|ref|NP_902795.1| flagellar biosynthetic protein FliQ [Chromobacterium violaceum
          ATCC 12472]
 gi|34104434|gb|AAQ60792.1| flagellar biosynthetic protein FliQ [Chromobacterium violaceum
          ATCC 12472]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 59/86 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ I + A++ ++  SAPVL +++ +G+L++ LQA TQI E+TLTF+PK++A+F+
Sbjct: 1  MSPELVISIVQNALYILIIVSAPVLLTSLLVGLLVSVLQAATQINEMTLTFIPKLLAMFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+++ P++   +  + T +   I +
Sbjct: 61 VLVLAGPWMLNTLIEYTTRLFQSIPN 86


>gi|157363489|ref|YP_001470256.1| flagellar biosynthetic protein FliQ [Thermotoga lettingae TMO]
 gi|157314093|gb|ABV33192.1| flagellar biosynthetic protein FliQ [Thermotoga lettingae TMO]
          Length = 88

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 16 TILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGG 71
          T+L    P L  ++ +G++I+  QA+TQI E TLTF PKII V +T++    F+GG
Sbjct: 16 TVLVVVTPALLISLVVGLIISIFQAVTQIHEQTLTFAPKIIVVLLTVM----FLGG 67


>gi|260598458|ref|YP_003211029.1| flagellar biosynthesis protein FliQ [Cronobacter turicensis
          z3032]
 gi|260217635|emb|CBA31935.1| Flagellar biosynthetic protein fliQ [Cronobacter turicensis
          z3032]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+ LQA TQI E+TL+F+PKI+AVF+ ++ + P++
Sbjct: 32 GLFISILQAATQINEMTLSFIPKILAVFVVIVAAGPWM 69


>gi|296103628|ref|YP_003613774.1| Flagellar biosynthetic protein fliQ [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295058087|gb|ADF62825.1| Flagellar biosynthetic protein fliQ [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 89

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M    V+ I   A+   L  SAP+L +A+  G++I+ LQA TQ+ E+T+TF+PKI+ +
Sbjct: 1  MTPESVMVIGMQAIKVGLMVSAPLLVAALVTGLIISILQAATQVNEMTMTFIPKILMI 58


>gi|254519407|ref|ZP_05131463.1| flagellar biosynthetic protein FliQ [Clostridium sp. 7_2_43FAA]
 gi|226913156|gb|EEH98357.1| flagellar biosynthetic protein FliQ [Clostridium sp. 7_2_43FAA]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 41/58 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M+E  ++ I R A++T L  + P+L  ++ +G++I+  QA TQIQE TLTFVPK+I +
Sbjct: 1  MSENLIIGIVRDALYTSLKVAGPILIVSILIGLIISIFQATTQIQEQTLTFVPKLIGI 58


>gi|157164876|ref|YP_001467585.1| flagellar biosynthesis protein FliQ [Campylobacter concisus
          13826]
 gi|112801104|gb|EAT98448.1| flagellar biosynthetic protein FliQ [Campylobacter concisus
          13826]
          Length = 88

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+L S +  G++I+  QA TQI E TL+FVPKI+ V + +I   P++   +  F T +
Sbjct: 20 SLPMLLSGLIAGLIISIFQATTQINETTLSFVPKILLVVVVIIFLMPWMISMMVEFTTRM 79

Query: 81 LSRI 84
          L  I
Sbjct: 80 LDFI 83


>gi|330809225|ref|YP_004353687.1| flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327377333|gb|AEA68683.1| Flagellar biosynthetic protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 42/64 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  +L   + A+ T    +AP+L + + +G+L++ LQ  TQIQE+TLTF+PK+I   +
Sbjct: 1  MTQDFMLYALKEALLTSAMVAAPLLLAILIVGLLVSILQVATQIQEMTLTFIPKLIVTVV 60

Query: 61 TLII 64
           L++
Sbjct: 61 MLLV 64


>gi|218887306|ref|YP_002436627.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris str.
          'Miyazaki F']
 gi|218758260|gb|ACL09159.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris str.
          'Miyazaki F']
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 52/76 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR ++   L  S P+L   + +G++++ +QA TQIQE+TL+F+PKI+++F+
Sbjct: 1  MTPEMVIAFARQSIEIALLISLPMLGVGLVVGVVVSIIQAATQIQEMTLSFIPKIVSIFL 60

Query: 61 TLIISAPFIGGQISSF 76
           L+IS P+I  ++ ++
Sbjct: 61 ALLISFPWIMDKMITY 76


>gi|332187880|ref|ZP_08389613.1| flagellar biosynthetic protein FliQ [Sphingomonas sp. S17]
 gi|332012041|gb|EGI54113.1| flagellar biosynthetic protein FliQ [Sphingomonas sp. S17]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    L +A   MW +  ++AP+L   +  G++I  +QA T I E TL+FVPK+I V I
Sbjct: 1  MDAQYFLTLANQTMWVLALAAAPILLPVLVSGLVIGMIQAATSINEQTLSFVPKLIVVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +++I    I G +S F   +  RI
Sbjct: 61 SILIFGSMIMGLLSDFTVSMFERI 84


>gi|302338094|ref|YP_003803300.1| flagellar biosynthetic protein FliQ [Spirochaeta smaragdinae DSM
          11293]
 gi|301635279|gb|ADK80706.1| flagellar biosynthetic protein FliQ [Spirochaeta smaragdinae DSM
          11293]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          M     +E+ R+A++ IL  S PVL   + +G++I+  QA T IQE TLTFVPK
Sbjct: 1  MTLGFAIELIRSAVFQILVLSGPVLLIGVGVGLIISIFQATTSIQEQTLTFVPK 54


>gi|296157443|ref|ZP_06840278.1| flagellar biosynthetic protein FliQ [Burkholderia sp. Ch1-1]
 gi|295892215|gb|EFG71998.1| flagellar biosynthetic protein FliQ [Burkholderia sp. Ch1-1]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++A+ +
Sbjct: 1  MNQESVMTLAHQAMYVGLLLAAPLLLVALVVGLVVSLFQAATQINESTLSFIPKLLAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T++I+ P++   I  ++   L+ I
Sbjct: 61 TMVIAGPWMLTTILDYLRQTLTNI 84


>gi|171915733|ref|ZP_02931203.1| putative type III secretion protein [Verrucomicrobium spinosum
          DSM 4136]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 51/82 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+A +++I   A+  +L  S P +  A  +G++++  QALTQ+QE TL+F  K+I V +
Sbjct: 1  MNQAYIIDITNKALILVLILSLPPIVVATVVGVVVSLFQALTQVQEQTLSFAVKLIVVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           +I +A + G ++ +F T +  
Sbjct: 61 VIIATASWTGAEVINFTTHIFD 82


>gi|115358978|ref|YP_776116.1| HrpO family type III secretion protein [Burkholderia ambifaria
          AMMD]
 gi|115284266|gb|ABI89782.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          AMMD]
          Length = 92

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQDANIGIAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++G ++  F    L R+
Sbjct: 61 ALVLLSGWLGSEVLRFAQQALERM 84


>gi|219684704|ref|ZP_03539647.1| flagellar biosynthetic protein FliQ [Borrelia garinii PBr]
 gi|219672066|gb|EED29120.1| flagellar biosynthetic protein FliQ [Borrelia garinii PBr]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLTIVIFGPWILNKLMQFTYMI 80

Query: 81 LSRIQS 86
           +++Q+
Sbjct: 81 FNQLQN 86


>gi|170699431|ref|ZP_02890476.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          IOP40-10]
 gi|171319945|ref|ZP_02909021.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MEX-5]
 gi|172063771|ref|YP_001811422.1| HrpO family type III secretion protein [Burkholderia ambifaria
          MC40-6]
 gi|170135687|gb|EDT03970.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          IOP40-10]
 gi|171094801|gb|EDT39839.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MEX-5]
 gi|171996288|gb|ACB67206.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MC40-6]
          Length = 92

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQDANIGIAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++G ++  F    L R+
Sbjct: 61 ALVLLSGWLGSEVLRFAQQALERM 84


>gi|83716881|ref|YP_438952.1| type III secretion inner membrane protein SctS [Burkholderia
          thailandensis E264]
 gi|167615482|ref|ZP_02384117.1| type III secretion inner membrane protein SctS [Burkholderia
          thailandensis Bt4]
 gi|257142056|ref|ZP_05590318.1| type III secretion inner membrane protein SctS [Burkholderia
          thailandensis E264]
 gi|83650706|gb|ABC34770.1| type III secretion inner membrane protein SctS [Burkholderia
          thailandensis E264]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 47/82 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  METDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          T+ I+ P+   +I  F   +L+
Sbjct: 61 TVAITGPWAAAEILHFAQQLLT 82


>gi|268680854|ref|YP_003305285.1| flagellar biosynthetic protein FliQ [Sulfurospirillum deleyianum
          DSM 6946]
 gi|268618885|gb|ACZ13250.1| flagellar biosynthetic protein FliQ [Sulfurospirillum deleyianum
          DSM 6946]
          Length = 88

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +        L  S P+L + M  G+ I+  QA+TQI E TL+FVPKI+   +  
Sbjct: 2  EAKLIGLGVETFKIALYLSLPMLLAGMIAGLAISIFQAVTQINESTLSFVPKILITIVVA 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQSSL 88
          I + P++   +  F T +   I S L
Sbjct: 62 IFTMPWMMNMMIEFTTRLFDMIPSFL 87


>gi|148976424|ref|ZP_01813130.1| flagellar biosynthesis protein Q [Vibrionales bacterium SWAT-3]
 gi|145964247|gb|EDK29503.1| flagellar biosynthesis protein Q [Vibrionales bacterium SWAT-3]
          Length = 89

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN    +E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MNPEIFVELFRDALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++ A ++   +  F   ++ R+   L
Sbjct: 61 ALMLFAHWMTQMMMEFFFELIERLPQVL 88


>gi|283782108|ref|YP_003372863.1| export protein FliQ family 3 [Pirellula staleyi DSM 6068]
 gi|283440561|gb|ADB19003.1| export protein FliQ family 3 [Pirellula staleyi DSM 6068]
          Length = 91

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D + + + AM T L   AP+L   M +G+LI   QALTQ+Q+ T+ FVPK++A+  
Sbjct: 1  MDPQDAVTLTQQAMMTALVLCAPLLLVGMLVGLLIGLAQALTQVQDQTVAFVPKLVAMVA 60

Query: 61 TLIISAPFIGGQISSFVT 78
           +++  P++  Q+  + T
Sbjct: 61 VMLLCLPWLIEQMMEYST 78


>gi|325295422|ref|YP_004281936.1| flagellar biosynthetic protein FliQ [Desulfurobacterium
          thermolithotrophum DSM 11699]
 gi|325065870|gb|ADY73877.1| flagellar biosynthetic protein FliQ [Desulfurobacterium
          thermolithotrophum DSM 11699]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%)

Query: 23 PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          PVL +   +GI+I+  QA TQI E+TLTF+PKI+A  + L I
Sbjct: 23 PVLLTTFLVGIIISIFQAATQIHEMTLTFIPKIVAALLALFI 64


>gi|161520289|ref|YP_001583716.1| HrpO family type III secretion protein [Burkholderia multivorans
          ATCC 17616]
 gi|189353533|ref|YP_001949160.1| hypothetical protein BMULJ_04777 [Burkholderia multivorans ATCC
          17616]
 gi|221200553|ref|ZP_03573595.1| type III secretion protein, HrpO family [Burkholderia multivorans
          CGD2M]
 gi|221206233|ref|ZP_03579247.1| type III secretion protein, HrpO family [Burkholderia multivorans
          CGD2]
 gi|221209589|ref|ZP_03582570.1| type III secretion protein, HrpO family [Burkholderia multivorans
          CGD1]
 gi|160344339|gb|ABX17424.1| type III secretion protein, HrpO family [Burkholderia multivorans
          ATCC 17616]
 gi|189337555|dbj|BAG46624.1| conserved hypothetical protein [Burkholderia multivorans ATCC
          17616]
 gi|221170277|gb|EEE02743.1| type III secretion protein, HrpO family [Burkholderia multivorans
          CGD1]
 gi|221174245|gb|EEE06678.1| type III secretion protein, HrpO family [Burkholderia multivorans
          CGD2]
 gi|221179894|gb|EEE12299.1| type III secretion protein, HrpO family [Burkholderia multivorans
          CGD2M]
          Length = 92

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  + +L++ R A+  +L  S P++  A   G+++A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTSSTILDLTRQALMLVLLLSLPIVLIATVTGLVVAILQAVTQVQDANIGIAVRLIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++ + ++G ++  F    L R+
Sbjct: 61 ALVLLSGWLGSEVLRFAQQALERM 84


>gi|85710190|ref|ZP_01041255.1| flagellar biosynthetic protein [Erythrobacter sp. NAP1]
 gi|85688900|gb|EAQ28904.1| flagellar biosynthetic protein [Erythrobacter sp. NAP1]
          Length = 90

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 34/54 (62%)

Query: 2  NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKI 55
          ++A +L +A   +W       PVL SA+ +G+++  +QA T + E TLTFVPK+
Sbjct: 3  DDAQLLALADQTLWVTALIVGPVLLSALAVGLIVGIIQAATSVNEQTLTFVPKL 56


>gi|330947077|gb|EGH47859.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          pisi str. 1704B]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W      A ++  ++  G+L+A  QA TQI E TL+F+P+++ + I
Sbjct: 1  MTPEVAVDLFREALWLTTVLVAILVVPSLLCGLLVAMFQAATQINEQTLSFLPRLLVMLI 60

Query: 61 TLIISAPFI 69
          TLI+  P++
Sbjct: 61 TLIVIGPWL 69


>gi|94496749|ref|ZP_01303324.1| hypothetical protein SKA58_16458 [Sphingomonas sp. SKA58]
 gi|94423762|gb|EAT08788.1| hypothetical protein SKA58_16458 [Sphingomonas sp. SKA58]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 40/64 (62%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQ 72
          A+W +L  SAP + +A  +G+L+A +QA TQ+QE TL +  K  A+  T+ ++A  + G 
Sbjct: 12 ALWLVLLLSAPPIVAASAVGLLVALVQAATQLQEQTLQYTLKFFAIVATIFLTASLLAGS 71

Query: 73 ISSF 76
          +  +
Sbjct: 72 LYQY 75


>gi|89098627|ref|ZP_01171509.1| flagellar biosynthesis protein Q [Bacillus sp. NRRL B-14911]
 gi|89086589|gb|EAR65708.1| flagellar biosynthesis protein Q [Bacillus sp. NRRL B-14911]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ IA   + ++L  S P+L  A+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSPETVISIAEQGIMSVLYISGPLLVLALVVGLIVSIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++   + S+   + S +
Sbjct: 61 GVVFFGPWMLSHMLSYTNEIFSNL 84


>gi|330972450|gb|EGH72516.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          aceris str. M302273PT]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W      A ++  ++  G+L+A  QA TQI E TL+F+P+++ + I
Sbjct: 1  MTPEVAVDLFREALWLTTVLVAILVVPSLLCGLLVAMFQAATQINEQTLSFLPRLLVMLI 60

Query: 61 TLIISAPFI 69
          TLI+  P++
Sbjct: 61 TLIVIGPWL 69


>gi|51587323|emb|CAE53697.1| putative HrcS [Pseudomonas sp. CFBP 11402]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  SAP L  A+ +G+L + +QAL QIQ  TL F  K++AV +TLI++  +IG
Sbjct: 8  KQGMLLVVVLSAPPLIVAVVVGVLTSLVQALMQIQGQTLPFGIKLVAVGVTLILTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFEMIGRS 84


>gi|238764053|ref|ZP_04625008.1| Secretion system apparatus protein ssaS [Yersinia kristensenii
          ATCC 33638]
 gi|238697724|gb|EEP90486.1| Secretion system apparatus protein ssaS [Yersinia kristensenii
          ATCC 33638]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+ +A   +W +L  S PV+  A  +G++++ LQALTQIQ+ TL F+ K++AV  
Sbjct: 1  MSTAIVVHLATQLLWIVLLLSMPVVVVASVVGLVVSLLQALTQIQDQTLQFLIKLLAVSA 60

Query: 61 TLIISAPFIGGQISSF 76
          TL+I+  ++G  + ++
Sbjct: 61 TLLITYHWMGSTLLNY 76


>gi|259417808|ref|ZP_05741727.1| flagellar biosynthetic protein FliQ [Silicibacter sp. TrichCH4B]
 gi|259346714|gb|EEW58528.1| flagellar biosynthetic protein FliQ [Silicibacter sp. TrichCH4B]
          Length = 92

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + E    +  R  +   ++ S P+L +A+ +G+ +   QALT IQE++LTFVPK+  + +
Sbjct: 2  LTEGIFYDTLRQGILAAITMSLPILITALVIGLTVGLFQALTSIQEMSLTFVPKLTGILV 61


>gi|167568049|ref|ZP_02360965.1| type III secretion apparatus protein EscS [Burkholderia
          oklahomensis EO147]
 gi|167572948|ref|ZP_02365822.1| type III secretion apparatus protein EscS [Burkholderia
          oklahomensis C6786]
          Length = 89

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA + ++A   MW +L  S PV+  A  +GIL++ +QALTQ+Q+ T+ F+ K++AV +
Sbjct: 1  MSEAVITQLAAQMMWLVLLLSLPVVVVASVVGILVSLVQALTQVQDQTIQFLIKLLAVAV 60

Query: 61 TLIISAPFIGGQISSF 76
          TL  +  ++G  + ++
Sbjct: 61 TLAATYHWMGDVLVNY 76


>gi|224531611|ref|ZP_03672243.1| flagellar biosynthetic protein FliQ [Borrelia valaisiana VS116]
 gi|224511076|gb|EEF81482.1| flagellar biosynthetic protein FliQ [Borrelia valaisiana VS116]
          Length = 87

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 48/66 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+ TL+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLTIVIFGPWILNKLIQFTYMI 80

Query: 81 LSRIQS 86
           +++Q+
Sbjct: 81 FNQLQN 86


>gi|154249382|ref|YP_001410207.1| flagellar biosynthetic protein FliQ [Fervidobacterium nodosum
          Rt17-B1]
 gi|154153318|gb|ABS60550.1| flagellar biosynthetic protein FliQ [Fervidobacterium nodosum
          Rt17-B1]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 3/82 (3%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L+IA+ A+  +L+   P L  ++ +GILI+  QA TQI E TLTF P+II VF+TL++  
Sbjct: 7  LDIAKHAIQLLLTLITPPLLVSLVVGILISIFQAATQIHEQTLTFAPRIIVVFLTLML-- 64

Query: 67 PFIGGQISSFVTLVLSRIQSSL 88
             G  I S +  V   I+  +
Sbjct: 65 -LFGWMIESMLEFVKDIIEKYI 85


>gi|84388122|ref|ZP_00991018.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
 gi|84377189|gb|EAP94059.1| flagellar biosynthesis protein [Vibrio splendidus 12B01]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN    +E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MNPEIFVELFRDALWMVLIMVCAIIIPSLLIGLVVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++ A ++   +  F   ++ R+   L
Sbjct: 61 ALMMFAHWMTQMMMEFFFELIERLPQVL 88


>gi|322833207|ref|YP_004213234.1| flagellar biosynthetic protein FliQ [Rahnella sp. Y9602]
 gi|321168408|gb|ADW74107.1| flagellar biosynthetic protein FliQ [Rahnella sp. Y9602]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++++ LQA TQI E TL+F+PKI+AV  T++I+ P++
Sbjct: 32 GLIVSLLQAATQINEQTLSFIPKILAVVATIVIAGPWM 69


>gi|51587307|emb|CAE53685.1| putative HrcS [Pseudomonas fluorescens bv. II]
          Length = 84

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M   +  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLAVLLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|167566297|ref|ZP_02359213.1| type III secretion protein, HrpO family [Burkholderia
          oklahomensis EO147]
 gi|167573399|ref|ZP_02366273.1| type III secretion protein, HrpO family [Burkholderia
          oklahomensis C6786]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 47/82 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  MEIDDLIRLTSQGMMLCLYISLPVVLVAAVSGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          T+ I+ P+   +I  F   ++S
Sbjct: 61 TVTIAGPWAAAEILHFAQQLIS 82


>gi|51587271|emb|CAE53658.1| putative HrcS [Pseudomonas fluorescens]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++   AP L  A+ +G+L + +QAL QIQ+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVVLLAPPLIVAVVVGVLTSLVQALMQIQDQTLPFGIKLVAVGITLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLINLTFEMIGRS 84


>gi|307546959|ref|YP_003899438.1| flagellar biosynthesis protein FliQ [Halomonas elongata DSM 2581]
 gi|307218983|emb|CBV44253.1| flagellar biosynthesis protein FliQ [Halomonas elongata DSM 2581]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%)

Query: 35 IAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          ++  QA TQI E+TL+F+PKI+AVF  L+++ P++   I+ F   +L  I +
Sbjct: 35 VSLFQAATQINEMTLSFIPKILAVFTVLVLAGPWLLKLITDFTRELLGNIPT 86


>gi|190694823|gb|ACE88958.1| HrcS [Pseudomonas fluorescens]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  +AP L  A+ +G++ + +QAL Q+Q+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVMLTAPPLIVAVVVGVMTSLVQALMQVQDQTLPFGIKLVAVGITLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + L    I  S
Sbjct: 68 VELIQLMNLTFDMIGRS 84


>gi|56551544|ref|YP_162383.1| export protein FliQ family 3 [Zymomonas mobilis subsp. mobilis
          ZM4]
 gi|241761181|ref|ZP_04759270.1| export protein FliQ family 3 [Zymomonas mobilis subsp. mobilis
          ATCC 10988]
 gi|260752857|ref|YP_003225750.1| export protein FliQ family 3 [Zymomonas mobilis subsp. mobilis
          NCIMB 11163]
 gi|56543118|gb|AAV89272.1| export protein FliQ family 3 [Zymomonas mobilis subsp. mobilis
          ZM4]
 gi|241374800|gb|EER64261.1| export protein FliQ family 3 [Zymomonas mobilis subsp. mobilis
          ATCC 10988]
 gi|258552220|gb|ACV75166.1| export protein FliQ family 3 [Zymomonas mobilis subsp. mobilis
          NCIMB 11163]
          Length = 91

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          +A+ AMW    + AP+L  A+ +G+ I  +QA T + E  L+F+PK++ + + L +    
Sbjct: 11 VAQQAMWITALAIAPILIPALLIGLFIGMIQAATSLNEQILSFLPKLVVIALVLALFGGS 70

Query: 69 IGGQISSFVTLVLSRIQS 86
          I G I  F+     RI  
Sbjct: 71 IFGLIVDFMHETYGRIPD 88


>gi|14588841|emb|CAA68099.2| HrcS protein [Pantoea agglomerans]
          Length = 83

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          + AM  ++  SAP L  A+ +G+L++ LQA+ Q+Q+ TL F  K++AV I L +S  +IG
Sbjct: 5  KQAMLLVVLLSAPPLLVAVIVGVLVSLLQAVMQLQDQTLPFAIKLVAVGIALALSGRWIG 64


>gi|46578460|ref|YP_009268.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120603956|ref|YP_968356.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris DP4]
 gi|46447871|gb|AAS94527.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120564185|gb|ABM29929.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris DP4]
 gi|311232388|gb|ADP85242.1| flagellar biosynthetic protein FliQ [Desulfovibrio vulgaris RCH1]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR ++   L  S P+L   + +G++++ +QA TQIQE+TL+F+PK++++FI
Sbjct: 1  MTPEFVIGFARQSIELALLISMPILGVGLAVGVVVSVIQAATQIQEMTLSFIPKVVSIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++S P+I  ++ +F   V   I + +
Sbjct: 61 AVLVSFPWIMDKMVTFTREVFLNIPNYI 88


>gi|71736593|ref|YP_273543.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. phaseolicola 1448A]
 gi|257487235|ref|ZP_05641276.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. tabaci ATCC 11528]
 gi|289623684|ref|ZP_06456638.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. aesculi str. NCPPB3681]
 gi|289647642|ref|ZP_06478985.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. aesculi str. 2250]
 gi|298485948|ref|ZP_07004023.1| type III secretion system integral membrane protein [Pseudomonas
          savastanoi pv. savastanoi NCPPB 3335]
 gi|3282782|gb|AAC25070.1| HrcS [Pseudomonas syringae pv. phaseolicola]
 gi|42562003|gb|AAS20445.1| HrcS [Pseudomonas syringae pv. phaseolicola]
 gi|71557146|gb|AAZ36357.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. phaseolicola 1448A]
 gi|238577786|gb|ACR46697.1| HrcS [Pseudomonas syringae pv. tabaci]
 gi|298159534|gb|EFI00580.1| type III secretion system integral membrane protein [Pseudomonas
          savastanoi pv. savastanoi NCPPB 3335]
 gi|320322956|gb|EFW79046.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. glycinea str. B076]
 gi|320329921|gb|EFW85909.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. glycinea str. race 4]
 gi|330871288|gb|EGH05997.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. aesculi str. 0893_23]
 gi|330874621|gb|EGH08770.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. glycinea str. race 4]
 gi|330894461|gb|EGH27122.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. mori str. 301020]
 gi|330984963|gb|EGH83066.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. lachrymans str. M301315]
 gi|331009151|gb|EGH89207.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. tabaci ATCC 11528]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G+L + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLGVAVLVGVLTSLLQALMQIQDQTLPFGIKLGAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIQFINMAFDLIARS 84


>gi|152990382|ref|YP_001356104.1| flagellar biosynthetic protein FliQ [Nitratiruptor sp. SB155-2]
 gi|151422243|dbj|BAF69747.1| flagellar biosynthetic protein FliQ [Nitratiruptor sp. SB155-2]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 6/60 (10%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P L +A  +G++I+  QA TQIQE+TLTF+PKIIA    LII   ++      FVTL+
Sbjct: 21 SLPPLATAFGVGLIISIFQAATQIQEMTLTFIPKIIATVAALIIFGSWM------FVTLI 74


>gi|167577334|ref|ZP_02370208.1| type III secretion inner membrane protein SctS [Burkholderia
          thailandensis TXDOH]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 47/82 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  METDDLIRLTLQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          T+ I+ P+   +I  F   +L+
Sbjct: 61 TVAITGPWAAAEILHFAQQLLT 82


>gi|254463558|ref|ZP_05076974.1| flagellar biosynthetic protein FliQ [Rhodobacterales bacterium
          HTCC2083]
 gi|206680147|gb|EDZ44634.1| flagellar biosynthetic protein FliQ [Rhodobacteraceae bacterium
          HTCC2083]
          Length = 71

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%)

Query: 18 LSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          ++ S P+L +A+  G+ +  LQALT +QE+TLTFVPK+ A+ +   ++  F+
Sbjct: 1  MAMSIPILSAALIAGVSVGLLQALTSVQEMTLTFVPKLCAIVVVFWMTMNFM 52


>gi|121997285|ref|YP_001002072.1| flagellar biosynthetic protein FliQ [Halorhodospira halophila
          SL1]
 gi|121588690|gb|ABM61270.1| flagellar biosynthetic protein FliQ [Halorhodospira halophila
          SL1]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 37/56 (66%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          + P+L +A+ +G+++   QA TQI E TL+FVPK++ + + L +  P++   ++ F
Sbjct: 21 AGPILLAALIIGLIVGMFQAATQINEQTLSFVPKLVGLAVVLFLLTPWMTQVLTDF 76


>gi|28869177|ref|NP_791796.1| flagellar biosynthetic protein FliQ [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|66046672|ref|YP_236513.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          syringae B728a]
 gi|71735616|ref|YP_275527.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|213967546|ref|ZP_03395694.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tomato T1]
 gi|237799249|ref|ZP_04587710.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          oryzae str. 1_6]
 gi|257484902|ref|ZP_05638943.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tabaci ATCC 11528]
 gi|289629019|ref|ZP_06461973.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          aesculi str. NCPPB3681]
 gi|289651609|ref|ZP_06482952.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          aesculi str. 2250]
 gi|289678971|ref|ZP_06499861.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          syringae FF5]
 gi|298487820|ref|ZP_07005860.1| Flagellar biosynthesis protein fliQ [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
 gi|301382883|ref|ZP_07231301.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tomato Max13]
 gi|302061093|ref|ZP_07252634.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tomato K40]
 gi|302131291|ref|ZP_07257281.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|28852417|gb|AAO55491.1| flagellar biosynthetic protein FliQ [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|63257379|gb|AAY38475.1| Flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          syringae B728a]
 gi|71556169|gb|AAZ35380.1| flagellar biosynthetic protein FliQ [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|213927847|gb|EEB61394.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tomato T1]
 gi|298157545|gb|EFH98625.1| Flagellar biosynthesis protein fliQ [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
 gi|320325128|gb|EFW81197.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          glycinea str. B076]
 gi|320329387|gb|EFW85380.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330866459|gb|EGH01168.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          aesculi str. 0893_23]
 gi|330876030|gb|EGH10179.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
 gi|330880586|gb|EGH14735.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330889046|gb|EGH21707.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          mori str. 301020]
 gi|330899442|gb|EGH30861.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          japonica str. M301072PT]
 gi|330953763|gb|EGH54023.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae Cit 7]
 gi|330964682|gb|EGH64942.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          actinidiae str. M302091]
 gi|330976009|gb|EGH76075.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          aptata str. DSM 50252]
 gi|330986503|gb|EGH84606.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          lachrymans str. M301315]
 gi|331011078|gb|EGH91134.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          tabaci ATCC 11528]
 gi|331016990|gb|EGH97046.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
 gi|331022104|gb|EGI02161.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          oryzae str. 1_6]
          Length = 89

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W      A ++  ++  G+L+A  QA TQI E TL+F+P+++ + +
Sbjct: 1  MTPEVAVDLFREALWLTTVLVAILVVPSLLCGLLVAMFQAATQINEQTLSFLPRLLVMLV 60

Query: 61 TLIISAPFI 69
          TLI+  P++
Sbjct: 61 TLIVIGPWL 69


>gi|51587263|emb|CAE53652.1| putative HrcS [Pseudomonas blatchfordae]
          Length = 87

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  +AP L  A+ +G+L + +QAL Q+Q+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVMLTAPPLIVAVVVGVLTSLVQALMQVQDQTLPFGIKLVAVGITLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + +    I  S
Sbjct: 68 VELVQLMNVTFDMIGRS 84


>gi|91785623|ref|YP_560829.1| flagellar biosynthesis protein FliQ [Burkholderia xenovorans
          LB400]
 gi|187925751|ref|YP_001897393.1| flagellar biosynthesis protein FliQ [Burkholderia phytofirmans
          PsJN]
 gi|91689577|gb|ABE32777.1| Flagellar biosynthesis protein FliQ [Burkholderia xenovorans
          LB400]
 gi|187716945|gb|ACD18169.1| flagellar biosynthetic protein FliQ [Burkholderia phytofirmans
          PsJN]
          Length = 89

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++A+ +
Sbjct: 1  MNQESVMTLAHQAMYVGLLLAAPLLLVALVVGLVVSLFQAATQINESTLSFIPKLLAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T++I+ P++   +  ++   L+ I
Sbjct: 61 TMVIAGPWMLTTMLDYLRQTLTNI 84


>gi|53716434|ref|YP_106202.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei ATCC 23344]
 gi|53722639|ref|YP_111624.1| type III secretion protein [Burkholderia pseudomallei K96243]
 gi|67639122|ref|ZP_00438022.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei GB8 horse 4]
 gi|76818200|ref|YP_335834.1| type III secretion inner membrane protein SctS [Burkholderia
          pseudomallei 1710b]
 gi|124381921|ref|YP_001025754.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei NCTC 10229]
 gi|126444326|ref|YP_001063271.1| HrpO family type III secretion protein [Burkholderia pseudomallei
          668]
 gi|126446836|ref|YP_001077839.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei NCTC 10247]
 gi|126456673|ref|YP_001076227.1| HrpO family type III secretion protein [Burkholderia pseudomallei
          1106a]
 gi|134282171|ref|ZP_01768877.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 305]
 gi|167004562|ref|ZP_02270320.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei PRL-20]
 gi|167724360|ref|ZP_02407596.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei DM98]
 gi|167820505|ref|ZP_02452185.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 91]
 gi|167828877|ref|ZP_02460348.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 9]
 gi|167850340|ref|ZP_02475848.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei B7210]
 gi|167898937|ref|ZP_02486338.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 7894]
 gi|167907265|ref|ZP_02494470.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei NCTC 13177]
 gi|167923470|ref|ZP_02510561.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei BCC215]
 gi|226198427|ref|ZP_03793995.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pakistan 9]
 gi|237509767|ref|ZP_04522482.1| type III secretion inner membrane protein SctS [Burkholderia
          pseudomallei MSHR346]
 gi|242312858|ref|ZP_04811875.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106b]
 gi|254176181|ref|ZP_04882839.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei ATCC 10399]
 gi|254185082|ref|ZP_04891671.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1655]
 gi|254186947|ref|ZP_04893463.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pasteur 52237]
 gi|254194408|ref|ZP_04900840.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei S13]
 gi|254201083|ref|ZP_04907448.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei FMH]
 gi|254205048|ref|ZP_04911401.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei JHU]
 gi|254264758|ref|ZP_04955623.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1710a]
 gi|254301372|ref|ZP_04968816.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 406e]
 gi|254359169|ref|ZP_04975441.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei 2002721280]
 gi|52213053|emb|CAH39091.1| putative type III secretion protein [Burkholderia pseudomallei
          K96243]
 gi|52422404|gb|AAU45974.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei ATCC 23344]
 gi|76582673|gb|ABA52147.1| type III secretion inner membrane protein SctS [Burkholderia
          pseudomallei 1710b]
 gi|126223817|gb|ABN87322.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 668]
 gi|126230441|gb|ABN93854.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106a]
 gi|126239690|gb|ABO02802.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei NCTC 10247]
 gi|134246700|gb|EBA46788.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 305]
 gi|147748695|gb|EDK55770.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei FMH]
 gi|147754634|gb|EDK61698.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei JHU]
 gi|148028356|gb|EDK86316.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei 2002721280]
 gi|157811426|gb|EDO88596.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 406e]
 gi|157934631|gb|EDO90301.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pasteur 52237]
 gi|160697223|gb|EDP87193.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei ATCC 10399]
 gi|169651159|gb|EDS83852.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei S13]
 gi|184215674|gb|EDU12655.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1655]
 gi|225929484|gb|EEH25503.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pakistan 9]
 gi|235001972|gb|EEP51396.1| type III secretion inner membrane protein SctS [Burkholderia
          pseudomallei MSHR346]
 gi|238519667|gb|EEP83136.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei GB8 horse 4]
 gi|242136097|gb|EES22500.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106b]
 gi|243060177|gb|EES42363.1| type III secretion inner membrane protein SctS [Burkholderia
          mallei PRL-20]
 gi|254215760|gb|EET05145.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1710a]
 gi|261826563|gb|ABM99331.2| type III secretion inner membrane protein SctS [Burkholderia
          mallei NCTC 10229]
          Length = 87

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 47/82 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  MEIDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          T+ I+ P+   +I  F   ++S
Sbjct: 61 TVAIAGPWAAAEILHFAQQLMS 82


>gi|149908446|ref|ZP_01897109.1| flagellar biosynthesis protein [Moritella sp. PE36]
 gi|149808609|gb|EDM68544.1| flagellar biosynthesis protein [Moritella sp. PE36]
          Length = 89

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          ++I R A+WT+L     V+   + +G++++  QA T I E TL+F+P++IA  + LI  A
Sbjct: 7  VDIFRQALWTVLLLVCAVVVPGLIVGLVVSVFQAATSINEQTLSFLPRLIATLLALIYGA 66

Query: 67 PFIGGQISSFVT 78
           +  G++  F T
Sbjct: 67 HWGFGRLMEFFT 78


>gi|303326582|ref|ZP_07357025.1| flagellar biosynthetic protein FliQ [Desulfovibrio sp. 3_1_syn3]
 gi|302864498|gb|EFL87429.1| flagellar biosynthetic protein FliQ [Desulfovibrio sp. 3_1_syn3]
          Length = 89

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 51/76 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+   R A+   L  + P+L   + +G++++ +QA TQIQE+TLTF+PKI+ +FI
Sbjct: 1  MSPDFVIGFGRQAIELCLMMALPMLGVGLGVGVVVSVIQAATQIQEMTLTFIPKIVCMFI 60

Query: 61 TLIISAPFIGGQISSF 76
           L+++ P++  ++ +F
Sbjct: 61 ALLLALPWLMERMITF 76


>gi|197120184|ref|YP_002140611.1| flagellar biogenesis protein FliQ [Geobacter bemidjiensis Bem]
 gi|253702493|ref|YP_003023682.1| flagellar biosynthetic protein FliQ [Geobacter sp. M21]
 gi|197089544|gb|ACH40815.1| flagellar biogenesis protein FliQ [Geobacter bemidjiensis Bem]
 gi|251777343|gb|ACT19924.1| flagellar biosynthetic protein FliQ [Geobacter sp. M21]
          Length = 89

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 46/71 (64%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          V+++ R +   ++  SAP+L  A+ +G+LI+  QA+T I E TL F PKI+AV + +++ 
Sbjct: 6  VVQLGRRSFEAVILLSAPLLICALVVGLLISIFQAVTSINEATLAFAPKIVAVMVAMVVF 65

Query: 66 APFIGGQISSF 76
           P++   +S F
Sbjct: 66 FPWMMMYMSDF 76


>gi|167840283|ref|ZP_02466967.1| type III secretion inner membrane protein SctS [Burkholderia
          thailandensis MSMB43]
          Length = 87

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S P++  A   G+ I+FLQA+T +QE ++++  K+IAV +
Sbjct: 1  MEIDDLIRLTSQGMMLCLYISLPIVLVAAASGLAISFLQAITSLQEQSISYGVKLIAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
          T+ I+ P+   +I  F   +L+ 
Sbjct: 61 TVAIAGPWAAAEILHFAQQLLTE 83


>gi|266621914|ref|ZP_06114849.1| flagellar biosynthetic protein FliQ [Clostridium hathewayi DSM
          13479]
 gi|288866387|gb|EFC98685.1| flagellar biosynthetic protein FliQ [Clostridium hathewayi DSM
          13479]
          Length = 87

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          M    V+E+ + AM      + P+L  ++ +G+++A  QA TQI E TLTFVPK
Sbjct: 1  MTADQVMEVMKEAMMVAFEIAGPLLIISIVVGLIVAIFQAATQIHEQTLTFVPK 54


>gi|328948399|ref|YP_004365736.1| flagellar biosynthetic protein FliQ [Treponema succinifaciens DSM
          2489]
 gi|328448723|gb|AEB14439.1| flagellar biosynthetic protein FliQ [Treponema succinifaciens DSM
          2489]
          Length = 89

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
           + R  +  +    AP+L +A+ +G+++A  QA T IQE TLTF+PK    F+T++    
Sbjct: 8  NLVRGGILQVFLMCAPILGAALLVGLIVAIFQATTSIQEQTLTFLPK----FLTILFVIA 63

Query: 68 FIGG 71
           +GG
Sbjct: 64 LLGG 67


>gi|304311111|ref|YP_003810709.1| Flagellar biosynthesis protein FliQ [gamma proteobacterium HdN1]
 gi|301796844|emb|CBL45056.1| Flagellar biosynthesis protein FliQ [gamma proteobacterium HdN1]
          Length = 89

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 50/86 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  ++ ++ R A++ I+     +L  ++ +G++++  QA TQI E TL+F P+++  F 
Sbjct: 1  MSPDNIADLMREAVFLIVLMVTVILVPSLIVGLIVSIFQAATQINEQTLSFFPRLVVTFG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TLII   ++  ++  F   ++  I S
Sbjct: 61 TLIIFGGWLASELIDFTLKIIHEIPS 86


>gi|82795279|gb|ABB91648.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          tagetis]
          Length = 88

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLGVAVLVGVITSLLQALMQIQDQTLPFGIKLAAVGMTLAV 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIQFINMAFDLIARS 84


>gi|99082802|ref|YP_614956.1| export protein FliQ [Ruegeria sp. TM1040]
 gi|99039082|gb|ABF65694.1| Flagellar biosynthetic protein fliQ [Ruegeria sp. TM1040]
          Length = 92

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          + E    +  R  +   ++ S P+L +A+ +G+ +   QALT IQE++LTFVPK+  + +
Sbjct: 2  LTEGIFYDTLRQGILAAITMSLPILIAALVIGLTVGLFQALTSIQEMSLTFVPKLAGILV 61


>gi|294636881|ref|ZP_06715211.1| flagellar biosynthetic protein FliQ [Edwardsiella tarda ATCC
          23685]
 gi|291089911|gb|EFE22472.1| flagellar biosynthetic protein FliQ [Edwardsiella tarda ATCC
          23685]
          Length = 83

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 27/31 (87%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E+TL+F+PKI+AVF TL+++ P++
Sbjct: 33 QAATQINEMTLSFIPKILAVFATLVVAGPWM 63


>gi|227114167|ref|ZP_03827823.1| type III secretion protein [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|227328490|ref|ZP_03832514.1| type III secretion protein [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
 gi|34500878|gb|AAQ73906.1| HrcS [Pectobacterium carotovorum subsp. carotovorum]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          +++ + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K+I+V + L +
Sbjct: 2  EIITLFRQAMVMVVLLSAPPLLVAVIVGVLISLLQAVMQLQDQTLPFAVKLISVGLALAL 61

Query: 65 SAPFIG 70
             +IG
Sbjct: 62 CGRWIG 67


>gi|94986991|ref|YP_594924.1| translocation protein in type III secretion [Lawsonia
          intracellularis PHE/MN1-00]
 gi|94731240|emb|CAJ54603.1| probable translocation protein in type III secretion [Lawsonia
          intracellularis PHE/MN1-00]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E   +     A++ +L  S P +  A  +G+ ++ +QA+TQ+QE TL F  K++AV +TL
Sbjct: 2  ETTTMTYTAKALYLVLVLSMPPILVASLVGLFVSLIQAITQLQEQTLAFGIKLLAVVLTL 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQ 85
               ++ G++  +   + +R  
Sbjct: 62 FFMGGWLTGELYRYAEEIFNRFH 84


>gi|238920322|ref|YP_002933837.1| flagellar biosynthetic protein FliQ, [Edwardsiella ictaluri
          93-146]
 gi|238869891|gb|ACR69602.1| flagellar biosynthetic protein FliQ, putative [Edwardsiella
          ictaluri 93-146]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 27/31 (87%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E+TL+F+PKI+AVF TL+++ P++
Sbjct: 39 QAATQINEMTLSFIPKILAVFATLVVAGPWM 69


>gi|302878288|ref|YP_003846852.1| flagellar biosynthetic protein FliQ [Gallionella
          capsiferriformans ES-2]
 gi|302581077|gb|ADL55088.1| flagellar biosynthetic protein FliQ [Gallionella
          capsiferriformans ES-2]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 36/54 (66%)

Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          +G++++  QA TQI E TL+F+PK++ +F+ L+I+ P++   +  F+  +   I
Sbjct: 31 IGLVVSIFQAATQINEQTLSFIPKLVGIFVVLVIAGPWMVTMMVDFIRRLYGNI 84


>gi|253688598|ref|YP_003017788.1| type III secretion protein, HrpO family [Pectobacterium
          carotovorum subsp. carotovorum PC1]
 gi|251755176|gb|ACT13252.1| type III secretion protein, HrpO family [Pectobacterium
          carotovorum subsp. carotovorum PC1]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          +++ + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K+I+V + L +
Sbjct: 2  EIITLFRQAMVMVVLLSAPPLLVAVIVGVLISLLQAVMQLQDQTLPFAVKLISVGLALAL 61

Query: 65 SAPFIG 70
             +IG
Sbjct: 62 CGRWIG 67


>gi|313901465|ref|ZP_07834921.1| flagellar biosynthetic protein FliQ [Thermaerobacter subterraneus
          DSM 13965]
 gi|313468271|gb|EFR63729.1| flagellar biosynthetic protein FliQ [Thermaerobacter subterraneus
          DSM 13965]
          Length = 90

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +A VL + R A+WT L  +APVL   + +G+ I+ LQA TQ+ E TL FVPKI+A   
Sbjct: 2  MTDAMVLTVGREALWTGLLVAAPVLLLTVAVGVAISILQAATQVTEQTLVFVPKILAAAA 61

Query: 61 TLIISAPFI 69
           L++  P++
Sbjct: 62 ALLLFGPWM 70


>gi|269139498|ref|YP_003296199.1| flagellar biosynthesis pathway, component FliQ [Edwardsiella
          tarda EIB202]
 gi|267985159|gb|ACY84988.1| flagellar biosynthesis pathway, component FliQ [Edwardsiella
          tarda EIB202]
 gi|304559387|gb|ADM42051.1| Flagellar biosynthesis protein FliQ [Edwardsiella tarda FL6-60]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 27/31 (87%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E+TL+F+PKI+AVF TL+++ P++
Sbjct: 39 QAATQINEMTLSFIPKILAVFATLVVAGPWM 69


>gi|83589639|ref|YP_429648.1| flagellar biosynthetic protein FliQ [Moorella thermoacetica ATCC
          39073]
 gi|83572553|gb|ABC19105.1| flagellar biosynthetic protein FliQ [Moorella thermoacetica ATCC
          39073]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +AR A+ T L  +AP L  ++ +G+ I+ LQA TQIQE TLTFVPKIIAV +
Sbjct: 1  MTQEFVIHLAREALTTALLLAAPALSLSLLVGVGISILQATTQIQEQTLTFVPKIIAVIL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +++   ++   +  F T +   + S
Sbjct: 61 GMLLLGSWMLNTLIQFTTDIFGNLGS 86


>gi|281411925|ref|YP_003346004.1| flagellar biosynthetic protein FliQ [Thermotoga naphthophila
          RKU-10]
 gi|281373028|gb|ADA66590.1| flagellar biosynthetic protein FliQ [Thermotoga naphthophila
          RKU-10]
          Length = 88

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 48/77 (62%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L+I ++ +  +L    P L  ++ +G++I+  QA+TQI E TL F P+II +F+T++  +
Sbjct: 7  LDIMKSGISLLLKIIVPPLVVSLIVGLVISIFQAVTQIHEQTLMFAPRIIVLFLTILFLS 66

Query: 67 PFIGGQISSFVTLVLSR 83
           ++  +I  F + +L +
Sbjct: 67 GWMAQKILDFFSEMLQK 83


>gi|295678048|ref|YP_003606572.1| flagellar biosynthetic protein FliQ [Burkholderia sp. CCGE1002]
 gi|295437891|gb|ADG17061.1| flagellar biosynthetic protein FliQ [Burkholderia sp. CCGE1002]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++A+  
Sbjct: 1  MTPEAVMTLAHHAMYIGLMMAAPLLLVALVVGLVVSLFQAATQINESTLSFIPKLLAIAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+I+ P++   +  ++   L+ I +
Sbjct: 61 TLVIAGPWMLTTMLDYLRQTLTSIPT 86


>gi|315140193|gb|ADT81077.1| RscS [Pseudomonas fluorescens]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +     ++  SAP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGTLLVVLLSAPPLIVAVIVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|293605017|ref|ZP_06687412.1| flagellar biosynthetic protein FliQ [Achromobacter piechaudii
          ATCC 43553]
 gi|292816586|gb|EFF75672.1| flagellar biosynthetic protein FliQ [Achromobacter piechaudii
          ATCC 43553]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  AM  +L+ + P+L   + +G++I+  QA TQI E+TL+F+PK++A+  
Sbjct: 1  MTAETVMTMAYQAMKIVLAMAGPLLLVVLVVGLVISIFQAATQINEMTLSFIPKLLAMCG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++ G +  ++  ++ +I
Sbjct: 61 VLVLLGPWLIGVMVDYIRQLIGQI 84


>gi|326315332|ref|YP_004233004.1| type III secretion protein, HrpO family [Acidovorax avenae subsp.
          avenae ATCC 19860]
 gi|89111160|dbj|BAE80250.1| HrcS [Acidovorax avenae subsp. avenae]
 gi|89111193|dbj|BAE80282.1| HrcS [Acidovorax avenae subsp. avenae]
 gi|323372168|gb|ADX44437.1| type III secretion protein, HrpO family [Acidovorax avenae subsp.
          avenae ATCC 19860]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 47/76 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN  +++++   A+   L  S P +  A  +G+L+A +QA+T +Q+ +++   K+I V +
Sbjct: 1  MNHDNIVQLTSEALMLCLLLSLPAVAVAAIVGLLVALVQAVTSLQDQSISQGIKLICVTV 60

Query: 61 TLIISAPFIGGQISSF 76
          T+ +SAP++G  +  F
Sbjct: 61 TVAVSAPWVGSTVLQF 76


>gi|15643460|ref|NP_228506.1| flagellar biosynthesis protein FliQ [Thermotoga maritima MSB8]
 gi|148269378|ref|YP_001243838.1| flagellar biosynthetic protein FliQ [Thermotoga petrophila RKU-1]
 gi|170288036|ref|YP_001738274.1| flagellar biosynthetic protein FliQ [Thermotoga sp. RQ2]
 gi|4981220|gb|AAD35779.1|AE001741_12 flagellar biosynthesis protein FliQ [Thermotoga maritima MSB8]
 gi|147734922|gb|ABQ46262.1| flagellar biosynthetic protein FliQ [Thermotoga petrophila RKU-1]
 gi|170175539|gb|ACB08591.1| flagellar biosynthetic protein FliQ [Thermotoga sp. RQ2]
          Length = 88

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 48/77 (62%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L+I ++ +  +L    P L  ++ +G++I+  QA+TQI E TL F P+II +F+T++  +
Sbjct: 7  LDIMKSGISLLLEIIVPPLVVSLIVGLVISIFQAVTQIHEQTLMFAPRIIVLFLTILFLS 66

Query: 67 PFIGGQISSFVTLVLSR 83
           ++  +I  F + +L +
Sbjct: 67 GWMAQKILDFFSEMLQK 83


>gi|330876193|gb|EGH10342.1| type III secretion component [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
 gi|330963709|gb|EGH63969.1| type III secretion component [Pseudomonas syringae pv. actinidiae
          str. M302091]
          Length = 89

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQALTQIQ+ TL  V K++AV +
Sbjct: 1  MGQDVFLSLMNKALMTVLLLSAPALIVAIVVGLSVGLLQALTQIQDQTLPQVVKLVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           ++   P + GQ++    LVL  
Sbjct: 61 VIVFVGPLLAGQVAELGNLVLDN 83


>gi|321399658|emb|CBJ44659.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-521]
          Length = 83

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  +L S AP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL++
Sbjct: 2  DALTLFKEGMLLVLLS-APPLIVAVVVGVLTSLVQALMQIQDQTLPFGIKLVAVGLTLLV 60

Query: 65 SAPFIG 70
          +  ++G
Sbjct: 61 TGRWVG 66


>gi|313681179|ref|YP_004058917.1| flagellar biosynthetic protein fliq [Sulfuricurvum kujiense DSM
          16994]
 gi|313154039|gb|ADR32717.1| flagellar biosynthetic protein FliQ [Sulfuricurvum kujiense DSM
          16994]
          Length = 89

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (67%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          S P L   MFLG+ ++  QA TQI E+TL+F+PKII + + +I++ P++  ++  F
Sbjct: 21 SLPALLVGMFLGLAVSIFQATTQINEMTLSFIPKIIGIVVVIILTMPWMMNEMQDF 76


>gi|34557827|ref|NP_907642.1| flagellar biosynthesis protein FliQ [Wolinella succinogenes DSM
          1740]
 gi|34483545|emb|CAE10542.1| FLAGELLAR BIOSYNTHETIC PROTEIN [Wolinella succinogenes]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 49/84 (58%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +A       L  S P+L + + +G+LI+  QA TQI E TLTFVPKI+ V + +
Sbjct: 2  EAKLMALAIETYKITLILSLPMLMAGLVVGLLISIFQATTQINEQTLTFVPKILVVIVVV 61

Query: 63 IISAPFIGGQISSFVTLVLSRIQS 86
          I++ P++   +  F T ++  I  
Sbjct: 62 ILTMPWMMNMLIDFTTRLIKMIPD 85


>gi|114332026|ref|YP_748248.1| flagellar biosynthetic protein FliQ [Nitrosomonas eutropha C91]
 gi|114309040|gb|ABI60283.1| flagellar biosynthetic protein FliQ [Nitrosomonas eutropha C91]
          Length = 91

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+ I+  QA TQI E+TL+F+PK++A+F+TL ++ P++
Sbjct: 32 GLAISIFQAATQINEMTLSFIPKLLAIFLTLALAGPWM 69


>gi|212702656|ref|ZP_03310784.1| hypothetical protein DESPIG_00684 [Desulfovibrio piger ATCC
          29098]
 gi|212673928|gb|EEB34411.1| hypothetical protein DESPIG_00684 [Desulfovibrio piger ATCC
          29098]
          Length = 85

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 48/77 (62%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          ++ A  A++ ++  S P +  A  +GI+++ +QA+TQ+QE TL F  K++AV +TL +  
Sbjct: 5  IDYAVKALYLVMILSLPPIIVASVVGIVLSLIQAITQLQEQTLAFGVKLLAVGLTLFLMG 64

Query: 67 PFIGGQISSFVTLVLSR 83
           ++ G+I  +   + +R
Sbjct: 65 KWLSGEILRYSEDIFNR 81


>gi|28868602|ref|NP_791221.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|213968265|ref|ZP_03396409.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          T1]
 gi|301381806|ref|ZP_07230224.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          Max13]
 gi|302061997|ref|ZP_07253538.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          K40]
 gi|302135079|ref|ZP_07261069.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          NCPPB 1108]
 gi|11276517|gb|AAG33885.1| HrcS [Pseudomonas syringae pv. tomato]
 gi|28851840|gb|AAO54916.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|213926903|gb|EEB60454.1| type III secretion protein HrcS [Pseudomonas syringae pv. tomato
          T1]
 gi|330872919|gb|EGH07068.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
 gi|330963056|gb|EGH63316.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          actinidiae str. M302091]
 gi|331015104|gb|EGH95160.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLGVAVLVGVITSLLQALMQIQDQTLPFGIKLAAVGMTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIQFINMAFDLIARS 84


>gi|167560942|ref|ZP_02353858.1| flagellar biosynthesis protein FliQ [Burkholderia oklahomensis
          EO147]
 gi|167568201|ref|ZP_02361075.1| flagellar biosynthesis protein FliQ [Burkholderia oklahomensis
          C6786]
          Length = 90

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 57/86 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++AV  
Sbjct: 1  MTPENVMTLAHQAMYIGLLLAAPLLLVALAVGLVVSLFQAATQINEATLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T++I+ P++   ++ ++  +L R+ +
Sbjct: 61 TMVIAGPWMLSTMTDYLREILLRVAT 86


>gi|317048610|ref|YP_004116258.1| flagellar biosynthetic protein FliQ [Pantoea sp. At-9b]
 gi|316950227|gb|ADU69702.1| flagellar biosynthetic protein FliQ [Pantoea sp. At-9b]
          Length = 89

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQ+ E TL+F+PKI+AV  T +I+ P++   I  ++  + S +
Sbjct: 32 GLIISLLQAATQVNEQTLSFIPKILAVAATAVIAGPWMLNLILDYMRTLFSNL 84


>gi|292493586|ref|YP_003529025.1| flagellar biosynthetic protein FliQ [Nitrosococcus halophilus
          Nc4]
 gi|291582181|gb|ADE16638.1| flagellar biosynthetic protein FliQ [Nitrosococcus halophilus
          Nc4]
          Length = 89

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 31/38 (81%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+L++  QA TQI E+TL+F+PK++A+ +T+ ++ P++
Sbjct: 32 GLLVSMFQAATQINEMTLSFIPKLLAILLTMALAGPWM 69


>gi|219685768|ref|ZP_03540579.1| flagellar biosynthetic protein FliQ [Borrelia garinii Far04]
 gi|219672707|gb|EED29735.1| flagellar biosynthetic protein FliQ [Borrelia garinii Far04]
          Length = 87

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 47/66 (71%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L  A+ +G+LI+  QA+T IQ+  L+F+PKII + +T++I  P+I  ++  F  ++
Sbjct: 21 SAPMLIIALIVGLLISIFQAITSIQDQALSFIPKIIVILLTIVIFGPWILNKLMQFTYMI 80

Query: 81 LSRIQS 86
           +++Q+
Sbjct: 81 FNQLQN 86


>gi|307731353|ref|YP_003908577.1| flagellar biosynthetic protein FliQ [Burkholderia sp. CCGE1003]
 gi|323527703|ref|YP_004229856.1| flagellar biosynthetic protein FliQ [Burkholderia sp. CCGE1001]
 gi|307585888|gb|ADN59286.1| flagellar biosynthetic protein FliQ [Burkholderia sp. CCGE1003]
 gi|323384705|gb|ADX56796.1| flagellar biosynthetic protein FliQ [Burkholderia sp. CCGE1001]
          Length = 89

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++A+ +
Sbjct: 1  MNSESVMTLAHQAMYVGLLLAAPLLLVALVVGLVVSLFQAATQINESTLSFIPKLLAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T++I+ P++   +  ++   L+ I
Sbjct: 61 TMVIAGPWMLTTMLDYLRQTLTNI 84


>gi|304398866|ref|ZP_07380736.1| flagellar biosynthetic protein FliQ [Pantoea sp. aB]
 gi|308187301|ref|YP_003931432.1| flagellar biosynthetic protein fliQ [Pantoea vagans C9-1]
 gi|304353570|gb|EFM17947.1| flagellar biosynthetic protein FliQ [Pantoea sp. aB]
 gi|308057811|gb|ADO09983.1| Probable flagellar biosynthetic protein fliQ [Pantoea vagans
          C9-1]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 30/38 (78%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G+LI+ +QA TQ+ E TL+F+PKI+AV  T II+ P++
Sbjct: 32 GLLISLIQAATQVNEQTLSFIPKILAVATTGIIAGPWM 69


>gi|302185376|ref|ZP_07262049.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          syringae 642]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W      A ++  ++  G+L+A  QA TQI E TL+F+P+++ + I
Sbjct: 1  MTPEVAVDLFREALWLTTVLVAILVVPSLLCGLLVAMFQAATQINEQTLSFLPRLLVMLI 60

Query: 61 TLIISAPFI 69
          TLI   P++
Sbjct: 61 TLIAIGPWL 69


>gi|254469622|ref|ZP_05083027.1| type III secretion protein, HrpO family [Pseudovibrio sp. JE062]
 gi|211961457|gb|EEA96652.1| type III secretion protein, HrpO family [Pseudovibrio sp. JE062]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D +     AM  ++  S P +  A  +G+ ++ LQALTQ+QE T+ F  K+IAV +
Sbjct: 1  MSPEDAVYRISEAMILVMMLSLPPIIVASLVGLAVSLLQALTQMQEQTIQFGVKLIAVAL 60

Query: 61 TLIISAPFIGGQISSF 76
          TL + + F+G +   F
Sbjct: 61 TLFMMSSFLGSETIGF 76


>gi|51587283|emb|CAE53667.1| putative HrcS [Pseudomonas fluorescens bv. I]
          Length = 87

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 46/77 (59%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +  M  ++  +AP L  A+ +G++ + +QAL Q+Q+ TL F  K++AV ITLI++  +IG
Sbjct: 8  KQGMLLVVMLTAPPLIVAVVVGVMTSLVQALMQVQDQTLPFGIKLVAVGITLIMTGRWIG 67

Query: 71 GQISSFVTLVLSRIQSS 87
           ++   + +    I  S
Sbjct: 68 VELIQLMNVTFDMIGRS 84


>gi|73532642|dbj|BAE19879.1| type III secretion apparatus [Edwardsiella tarda]
          Length = 67

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 44/65 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +A ++++A   +W +L  S PV+  A  +G+L+  +QALTQIQ+ T++F  K++A  +
Sbjct: 1  MGKAQLVQLASELLWLVLILSLPVVLVASLVGVLVGLVQALTQIQDQTVSFAIKLVAASV 60

Query: 61 TLIIS 65
          TL ++
Sbjct: 61 TLALT 65


>gi|56419770|ref|YP_147088.1| flagellar biosynthesis protein FliQ [Geobacillus kaustophilus
          HTA426]
 gi|261419435|ref|YP_003253117.1| flagellar biosynthesis protein FliQ [Geobacillus sp. Y412MC61]
 gi|297530590|ref|YP_003671865.1| flagellar biosynthetic protein FliQ [Geobacillus sp. C56-T3]
 gi|319766250|ref|YP_004131751.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y412MC52]
 gi|56379612|dbj|BAD75520.1| flagellar protein required for flagellar formation [Geobacillus
          kaustophilus HTA426]
 gi|261375892|gb|ACX78635.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y412MC61]
 gi|297253842|gb|ADI27288.1| flagellar biosynthetic protein FliQ [Geobacillus sp. C56-T3]
 gi|317111116|gb|ADU93608.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y412MC52]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 50/81 (61%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          ++ +A   ++ +L    P+L  ++ +G++++  QA TQIQE TL FVPKI+AV + L+  
Sbjct: 6  IIRLAEQGVYIVLVVCGPLLLLSLAVGLVVSIFQAATQIQEQTLAFVPKIVAVLLGLVFF 65

Query: 66 APFIGGQISSFVTLVLSRIQS 86
           P++  ++ S+   + + + S
Sbjct: 66 GPWMLSKMVSYAHDIFNNLAS 86


>gi|225849158|ref|YP_002729322.1| flagellar biosynthetic protein FliQ [Sulfurihydrogenibium
          azorense Az-Fu1]
 gi|225643097|gb|ACN98147.1| flagellar biosynthetic protein FliQ [Sulfurihydrogenibium
          azorense Az-Fu1]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S PV+     +G++I+  +A TQI E+T+TFVPKI+A  I LII   ++  ++  +   +
Sbjct: 21 STPVILLIFIVGLIISIFEAATQINEMTITFVPKIVAAVIGLIIFGSWMTTELVDYTRQM 80

Query: 81 LSRI 84
          L  I
Sbjct: 81 LETI 84


>gi|51103000|gb|AAT96147.1| HrcS [Pseudomonas viridiflava]
 gi|51103055|gb|AAT96201.1| HrcS [Pseudomonas viridiflava]
 gi|330957487|gb|EGH57747.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. maculicola str. ES4326]
          Length = 88

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLAVAVLVGVITSLLQALMQIQDQTLPFGIKLGAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIQFINMAFDLIARS 84


>gi|218706361|ref|YP_002413880.1| surface presentation of antigens protein [Escherichia coli UMN026]
 gi|218433458|emb|CAR14360.1| surface presentation of antigens protein [Escherichia coli UMN026]
          Length = 115

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%)

Query: 2   NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
           N  D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I 
Sbjct: 29  NMDDIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSIC 88

Query: 62  LIISAPFIGGQISSF 76
             + + + G ++ SF
Sbjct: 89  FFLMSGWYGEKLYSF 103


>gi|126174199|ref|YP_001050348.1| HrpO family type III secretion protein [Shewanella baltica OS155]
 gi|304408582|ref|ZP_07390203.1| type III secretion protein, HrpO family [Shewanella baltica
          OS183]
 gi|307305410|ref|ZP_07585158.1| type III secretion protein, HrpO family [Shewanella baltica
          BA175]
 gi|125997404|gb|ABN61479.1| type III secretion protein, HrpO family [Shewanella baltica
          OS155]
 gi|304352403|gb|EFM16800.1| type III secretion protein, HrpO family [Shewanella baltica
          OS183]
 gi|306911713|gb|EFN42138.1| type III secretion protein, HrpO family [Shewanella baltica
          BA175]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 36/51 (70%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          L++ +QALTQIQ+ TL F+ K+IAV +TL++   ++G  + ++ ++   +I
Sbjct: 34 LVSLIQALTQIQDQTLQFLIKLIAVCVTLVVCYHWMGSSLLNYASMAFDQI 84


>gi|120609151|ref|YP_968829.1| HrpO family type III secretion protein [Acidovorax citrulli
          AAC00-1]
 gi|58700624|gb|AAW81015.1| HrcS [Acidovorax citrulli]
 gi|120587615|gb|ABM31055.1| type III secretion protein, HrpO family [Acidovorax citrulli
          AAC00-1]
          Length = 87

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN  +++++   A+   L  S P +  A  +G+L+A +QA+T +Q+  ++   K+I V +
Sbjct: 1  MNHDNIVQLTSEALMLCLLLSLPAVAVAAIVGLLVALVQAVTSLQDQAISQGIKLICVTV 60

Query: 61 TLIISAPFIGGQISSF 76
          T+ +SAP++G  +  F
Sbjct: 61 TVAVSAPWVGSTVLQF 76


>gi|29840694|ref|NP_829800.1| type III secretion inner membrane protein SctS [Chlamydophila
          caviae GPIC]
 gi|29835044|gb|AAP05678.1| type III secretion inner membrane protein SctS [Chlamydophila
          caviae GPIC]
          Length = 94

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 4/82 (4%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          ++ + E +  ++  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL
Sbjct: 9  KSMLFEYSYQSLLLILIISAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTL 68

Query: 63 IISAPFIGGQISSFVTLVLSRI 84
          +IS    GG +SS +    S+I
Sbjct: 69 MIS----GGWLSSMIFRFASQI 86


>gi|119476306|ref|ZP_01616657.1| flagellar biosynthetic protein FliQ [marine gamma proteobacterium
          HTCC2143]
 gi|119450170|gb|EAW31405.1| flagellar biosynthetic protein FliQ [marine gamma proteobacterium
          HTCC2143]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 52/86 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R A+  I+   + ++  ++ +G++I+  QA TQI E TL+F+P++I    
Sbjct: 1  MTPGVVIDLFREALLLIILLVSIMVVPSLIVGLVISVFQAATQINEQTLSFLPRLITTLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           LI++ P++  ++  F T ++S I +
Sbjct: 61 MLILAGPYLLNELIDFTTRLVSTIPT 86


>gi|291276806|ref|YP_003516578.1| flagellar biosynthetic protein [Helicobacter mustelae 12198]
 gi|290964000|emb|CBG39839.1| flagellar biosynthetic protein [Helicobacter mustelae 12198]
          Length = 83

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 44/66 (66%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+LF  + +G++++  QA TQI E+TL+FVPKI+AV   +I + P++   +  + T +
Sbjct: 15 SLPILFVGLVVGLVVSIFQATTQINEMTLSFVPKILAVIGVIIFTMPWMLNMLMDYTTRL 74

Query: 81 LSRIQS 86
          ++ I S
Sbjct: 75 INLIPS 80


>gi|299822253|ref|ZP_07054139.1| flagellar biosynthetic protein FliQ [Listeria grayi DSM 20601]
 gi|299815782|gb|EFI83020.1| flagellar biosynthetic protein FliQ [Listeria grayi DSM 20601]
          Length = 90

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 51/86 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+E+ +   ++ L+   PV    + + IL+A + A+ QIQ+ +LTF+PKIIA  +
Sbjct: 1  MNLTPVMEVFQKFFYSGLTIILPVSIVCLVVVILVAIIMAMMQIQDQSLTFLPKIIAFVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L I  P++ G ++  +  + ++I +
Sbjct: 61 ALFILGPWMFGHMTDLIVSIFAKIPT 86


>gi|83814167|ref|YP_446685.1| flagellar biosynthetic protein FliQ [Salinibacter ruber DSM
          13855]
 gi|294508621|ref|YP_003572680.1| flagellar biosynthetic protein fliQ [Salinibacter ruber M8]
 gi|83755561|gb|ABC43674.1| flagellar biosynthetic protein FliQ [Salinibacter ruber DSM
          13855]
 gi|294344950|emb|CBH25728.1| Flagellar biosynthetic protein fliQ [Salinibacter ruber M8]
          Length = 89

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 40/65 (61%)

Query: 22 APVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVL 81
           P+L  A+  GI+++  QA+T +QE+TL+F+PK+IA+ +      P++   ++ F   + 
Sbjct: 22 GPMLGMALLAGIVVSLFQAVTSMQEMTLSFIPKLIAIAVVFFFMMPWMIQMMTDFTAEIF 81

Query: 82 SRIQS 86
          + I S
Sbjct: 82 AAIPS 86


>gi|34498063|ref|NP_902278.1| type III secretion apparatus protein EscS [Chromobacterium
          violaceum ATCC 12472]
 gi|34103918|gb|AAQ60278.1| type III secretion apparatus protein EscS [Chromobacterium
          violaceum ATCC 12472]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 56/84 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+EA + ++A   MW +L  S PV+  A F+G+L++ +QALTQ+Q+ T+ F+ K++AV +
Sbjct: 1  MSEAMIAQLATQMMWLVLLLSLPVVVVASFVGVLVSLVQALTQVQDQTVQFLVKLLAVSV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL ++  ++G  + ++  L   +I
Sbjct: 61 TLAMTYHWMGDVLLNYAGLAFDQI 84


>gi|317051544|ref|YP_004112660.1| flagellar biosynthetic protein FliQ [Desulfurispirillum indicum
          S5]
 gi|316946628|gb|ADU66104.1| flagellar biosynthetic protein FliQ [Desulfurispirillum indicum
          S5]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 40/56 (71%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          ++P+L   + +G+ I+ +QA T +QE+TLTF+PKI+ V + L+   P++  ++++F
Sbjct: 21 ASPMLVLGLIVGVAISIVQAATSVQEMTLTFIPKIVIVVLGLMYFLPWMIAKLTAF 76


>gi|260772333|ref|ZP_05881249.1| flagellar biosynthesis protein FliQ [Vibrio metschnikovii CIP
          69.14]
 gi|260611472|gb|EEX36675.1| flagellar biosynthesis protein FliQ [Vibrio metschnikovii CIP
          69.14]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L+I A 
Sbjct: 8  ELFREALWLVLIMVCAIIVPSLIIGLVVAVFQAATSINEQTLSFLPRLIVTLLALMIFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMLMEFFFAMIERLPQVL 88


>gi|254506873|ref|ZP_05119012.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus 16]
 gi|219550158|gb|EED27144.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus 16]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++ A 
Sbjct: 8  ELFRDALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMMMEFFFGIIERLPQVL 88


>gi|89897882|ref|YP_514992.1| type III secretion flagellar biosynthesis inner membrane protein
          [Chlamydophila felis Fe/C-56]
 gi|89331254|dbj|BAE80847.1| type III secretion flagellar biosynthesis inner membrane protein
          [Chlamydophila felis Fe/C-56]
          Length = 94

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          ++ + E +  ++  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL
Sbjct: 9  KSVLFEYSYQSLLLILIISAPPIILASIVGIVVAIFQAATQIQEQTFAFAIKLVVIFGTL 68

Query: 63 IISAPFIGGQISSFVTLVLSR 83
          IIS  ++   I  F + +   
Sbjct: 69 IISGGWLSNMIFRFASQIFQN 89


>gi|224417762|ref|ZP_03655768.1| flagellar biosynthesis protein FliQ [Helicobacter canadensis MIT
          98-5491]
 gi|253827105|ref|ZP_04869990.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
          98-5491]
 gi|313141303|ref|ZP_07803496.1| flagellar biosynthesis protein FliQ [Helicobacter canadensis MIT
          98-5491]
 gi|253510511|gb|EES89170.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
          98-5491]
 gi|313130334|gb|EFR47951.1| flagellar biosynthesis protein FliQ [Helicobacter canadensis MIT
          98-5491]
          Length = 88

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +A       L  S P+L   + +G+LI+  QA TQI E+TLTFVPKI+AV + +
Sbjct: 2  EAQLMNLAIETYKITLILSLPMLLVGLVVGLLISIFQATTQINEMTLTFVPKILAVIVVI 61

Query: 63 IISAPFIGGQISSF 76
          I + P++   +  F
Sbjct: 62 IFTMPWMLNMLIDF 75


>gi|160875391|ref|YP_001554707.1| HrpO family type III secretion protein [Shewanella baltica OS195]
 gi|160860913|gb|ABX49447.1| type III secretion protein, HrpO family [Shewanella baltica
          OS195]
 gi|315267591|gb|ADT94444.1| type III secretion protein, HrpO family [Shewanella baltica
          OS678]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 36/51 (70%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          L++ +QALTQIQ+ TL F+ K+IAV +TL++   ++G  + ++ ++   +I
Sbjct: 34 LVSLIQALTQIQDQTLQFLIKLIAVCVTLVVCYHWMGSSLLNYASMAFDQI 84


>gi|330961234|gb|EGH61494.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          maculicola str. ES4326]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 41/69 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W      A ++  ++  G+L+A  QA TQI E TL+F+P+++ + +
Sbjct: 1  MTPEVAVDLFREALWLTTVLVAILVVPSLLCGLLVAMFQAATQINEQTLSFLPRLLVMLV 60

Query: 61 TLIISAPFI 69
          TLI   P++
Sbjct: 61 TLIAIGPWL 69


>gi|323496544|ref|ZP_08101598.1| flagellar biosynthesis protein FliQ [Vibrio sinaloensis DSM
          21326]
 gi|323318388|gb|EGA71345.1| flagellar biosynthesis protein FliQ [Vibrio sinaloensis DSM
          21326]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++ A 
Sbjct: 8  ELFRDALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMMMEFFFNLIERLPQVL 88


>gi|227112530|ref|ZP_03826186.1| flagellar biosynthesis protein FliQ [Pectobacterium carotovorum
          subsp. brasiliensis PBR1692]
 gi|227328347|ref|ZP_03832371.1| flagellar biosynthesis protein FliQ [Pectobacterium carotovorum
          subsp. carotovorum WPP14]
 gi|462611|sp|P34201|FLIQ_PECCC RecName: Full=Flagellar biosynthetic protein FliQ; AltName:
          Full=Flagellar biosynthetic protein MopD
 gi|296056|emb|CAA51477.1| mopD [Pectobacterium carotovorum]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (83%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E+TL+F+PKI+ VF TL+I+ P++
Sbjct: 39 QAATQINEMTLSFIPKILTVFFTLVIAGPWM 69


>gi|326386957|ref|ZP_08208570.1| flagellar biosynthetic protein [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208566|gb|EGD59370.1| flagellar biosynthetic protein [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 90

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 48/83 (57%)

Query: 2  NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          + + +L +A   +W     + PVL +++ +G+++  +QA T + E TLTFVPK+    + 
Sbjct: 3  DTSSLLALADRMIWITALIATPVLLASLAVGLVVGVIQAATSVNEQTLTFVPKLAVTALV 62

Query: 62 LIISAPFIGGQISSFVTLVLSRI 84
          L++    + G +  F+  ++++I
Sbjct: 63 LVLLGGAMLGLVGDFLKDIMAQI 85


>gi|221635441|ref|YP_002523317.1| flagellar biosynthetic protein FliQ [Thermomicrobium roseum DSM
          5159]
 gi|221157420|gb|ACM06538.1| flagellar biosynthetic protein FliQ [Thermomicrobium roseum DSM
          5159]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 44/63 (69%)

Query: 16 TILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
          T L  SAP+L + + +G+L++ LQA+TQ+ E TL F+PKI+  F+ L+ +  ++G Q+++
Sbjct: 16 TTLLVSAPILLTILVVGLLVSVLQAVTQVNEQTLVFIPKIVITFLILLFAGSWMGRQLAT 75

Query: 76 FVT 78
            T
Sbjct: 76 LAT 78


>gi|299066523|emb|CBJ37713.1| Flagellar biosynthesis protein Q [Ralstonia solanacearum CMR15]
          Length = 58

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          +G  I+ LQ +TQ+QE +LTFVPK++   I+LI+  P++  +   F   + S I S
Sbjct: 1  MGFFISLLQVVTQVQENSLTFVPKLLTAVISLIVFGPWMLRKFVQFSVHLWSEIPS 56


>gi|239815244|ref|YP_002944154.1| export protein FliQ family 3 [Variovorax paradoxus S110]
 gi|239801821|gb|ACS18888.1| export protein FliQ family 3 [Variovorax paradoxus S110]
          Length = 60

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 38/58 (65%)

Query: 29 MFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          M +G+ ++ LQ +TQIQE++LTFVPK+      +I++ P++  +++ F   + S I S
Sbjct: 1  MLVGVAVSVLQVVTQIQEMSLTFVPKLFTAGAVMILAGPWMLRKLTQFTVQLWSGIPS 58


>gi|94314221|ref|YP_587430.1| flagellar biosynthesis protein FliQ [Cupriavidus metallidurans
          CH34]
 gi|93358073|gb|ABF12161.1| flagellar biosynthesis protein FliQ [Cupriavidus metallidurans
          CH34]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 3/51 (5%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          +  QA TQI E+TLTF+PK+IA+F T+++  P++   I++FV  +    QS
Sbjct: 36 SLFQAATQINEMTLTFIPKLIALFATMVLVGPWM---INTFVDYMRQVFQS 83


>gi|153951007|ref|YP_001398955.1| flagellar biosynthesis protein FliQ [Campylobacter jejuni subsp.
          doylei 269.97]
 gi|152938453|gb|ABS43194.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          doylei 269.97]
          Length = 89

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+  QA TQI E+TL+FVPKII V + LI   P++   +  F   +L++I +
Sbjct: 32 GLVISIFQATTQINEMTLSFVPKIILVVVILIFLMPWMTTTMMDFTENILNQIPT 86


>gi|261344131|ref|ZP_05971775.1| flagellar biosynthetic protein FliQ [Providencia rustigianii DSM
          4541]
 gi|282567723|gb|EFB73258.1| flagellar biosynthetic protein FliQ [Providencia rustigianii DSM
          4541]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 37/51 (72%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          +I+ LQA TQ+ E+TL+F+PKI++V  T+II+ P++   ++ ++  + S +
Sbjct: 34 IISLLQAATQVNEMTLSFIPKILSVISTIIIAGPWMLNLLTDYMRQLFSNL 84


>gi|285018169|ref|YP_003375880.1| flagellar biosynthetic protein fliq [Xanthomonas albilineans GPE
          PC73]
 gi|283473387|emb|CBA15892.1| probable flagellar biosynthetic protein fliq [Xanthomonas
          albilineans]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          R  + T+L  + P+L + + +G++I   QA TQ+ E T+ F+ K+IA+   L  +   + 
Sbjct: 11 RGGLVTVLWVAGPLLLAMLVVGVVIGVFQAATQLNEPTIAFIAKVIALTAMLFATGSMLL 70

Query: 71 GQISSFVTLVLSRI 84
            +  + TL+  RI
Sbjct: 71 AHLVEYTTLLFQRI 84


>gi|62185508|ref|YP_220293.1| putative type III export protein [Chlamydophila abortus S26/3]
 gi|329943277|ref|ZP_08292051.1| type III secretion , HrpO family protein [Chlamydophila psittaci
          Cal10]
 gi|332287855|ref|YP_004422756.1| secretion and cellular translocation protein S [Chlamydophila
          psittaci 6BC]
 gi|62148575|emb|CAH64347.1| putative type III export protein [Chlamydophila abortus S26/3]
 gi|313848427|emb|CBY17431.1| putative type III export protein [Chlamydophila psittaci RD1]
 gi|325507124|gb|ADZ18762.1| secretion and cellular translocation protein S [Chlamydophila
          psittaci 6BC]
 gi|328814824|gb|EGF84814.1| type III secretion , HrpO family protein [Chlamydophila psittaci
          Cal10]
 gi|328915117|gb|AEB55950.1| type III secretion system protein BsaX [Chlamydophila psittaci
          6BC]
          Length = 94

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          ++ + E +  ++  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL
Sbjct: 9  KSMLFEYSYQSLLLILIISAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTL 68

Query: 63 IISAPFIGGQISSFVTLVLSR 83
          +IS  ++   I  F + +   
Sbjct: 69 MISGGWLSNMIFRFASQIFQN 89


>gi|15618733|ref|NP_225019.1| Yop proteins translocation protein S [Chlamydophila pneumoniae
          CWL029]
 gi|15836357|ref|NP_300881.1| YopS translocation protein [Chlamydophila pneumoniae J138]
 gi|16752216|ref|NP_445584.1| type III secretion inner membrane protein SctS [Chlamydophila
          pneumoniae AR39]
 gi|33242184|ref|NP_877125.1| translocation protein S [Chlamydophila pneumoniae TW-183]
 gi|4377136|gb|AAD18961.1| Yop proteins translocation protein S [Chlamydophila pneumoniae
          CWL029]
 gi|6672010|dbj|BAA88642.1| YopS translocation protein [Chlamydophila pneumoniae]
 gi|8163544|gb|AAF73726.1| type III secretion inner membrane protein SctS [Chlamydophila
          pneumoniae AR39]
 gi|8979198|dbj|BAA99032.1| YopS translocation protein [Chlamydophila pneumoniae J138]
 gi|33236695|gb|AAP98782.1| translocation protein S [Chlamydophila pneumoniae TW-183]
 gi|269302614|gb|ACZ32714.1| putative Yop translocation protein S [Chlamydophila pneumoniae
          LPCoLN]
          Length = 95

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          ++ + E +  ++  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL
Sbjct: 10 KSVLFEYSYQSLLLILIVSAPPIILASIVGIMVAIFQAATQIQEQTFAFAVKLVVIFGTL 69

Query: 63 IISAPFIGGQISSF 76
          +IS  ++   I  F
Sbjct: 70 MISGGWLSNMILRF 83


>gi|212709501|ref|ZP_03317629.1| hypothetical protein PROVALCAL_00543 [Providencia alcalifaciens
          DSM 30120]
 gi|212687839|gb|EEB47367.1| hypothetical protein PROVALCAL_00543 [Providencia alcalifaciens
          DSM 30120]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 36/51 (70%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          +I+ LQA TQ+ E+TL+F+PKI++V   LII+ P++   ++ ++  + S +
Sbjct: 34 IISLLQAATQVNEMTLSFIPKILSVISVLIIAGPWMLNLLTDYIRTLFSNL 84


>gi|187919909|ref|YP_001888940.1| type III secretion protein, HrpO family [Burkholderia
          phytofirmans PsJN]
 gi|187718347|gb|ACD19570.1| type III secretion protein, HrpO family [Burkholderia
          phytofirmans PsJN]
          Length = 91

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P L  A  +G+++  LQ++TQIQ+  L +  KII V + +I++ P+   ++S F+   
Sbjct: 22 SLPALAVATAIGVVVGLLQSVTQIQDQALPYGAKIIGVGLVMIVAIPWGNSEVSRFLDHA 81

Query: 81 LSRI 84
           S I
Sbjct: 82 FSYI 85


>gi|332669210|ref|YP_004452218.1| flagellar biosynthetic protein FliQ [Cellulomonas fimi ATCC 484]
 gi|332338248|gb|AEE44831.1| flagellar biosynthetic protein FliQ [Cellulomonas fimi ATCC 484]
          Length = 90

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTF 51
          M+   VL++   A+      SAPVL +A+ +G +++ LQ++TQIQEVTL+F
Sbjct: 1  MDTTAVLDVGVDALILAAKLSAPVLVTALVVGFVVSLLQSVTQIQEVTLSF 51


>gi|225569961|ref|ZP_03778986.1| hypothetical protein CLOHYLEM_06056 [Clostridium hylemonae DSM
          15053]
 gi|225161431|gb|EEG74050.1| hypothetical protein CLOHYLEM_06056 [Clostridium hylemonae DSM
          15053]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 25/34 (73%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
            P+L  +M +GI+I+ LQA TQI E TLTFVPK
Sbjct: 21 GGPILLISMIVGIVISILQAATQIHEQTLTFVPK 54


>gi|260767695|ref|ZP_05876630.1| flagellar biosynthesis protein FliQ [Vibrio furnissii CIP 102972]
 gi|260617204|gb|EEX42388.1| flagellar biosynthesis protein FliQ [Vibrio furnissii CIP 102972]
 gi|315179473|gb|ADT86387.1| flagellar biosynthesis protein Q [Vibrio furnissii NCTC 11218]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++ A 
Sbjct: 8  EMFRDALWMVLIMVCAIIVPSLLIGLVVAVFQAATSINEQTLSFLPRLIVTLLALMLFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMMMEFFFAMIERLPQVL 88


>gi|84785896|gb|ABC62087.1| secretion and cellular translocation protein S [Chlamydophila
          psittaci]
          Length = 94

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          + E +  ++  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL+IS
Sbjct: 12 LFEYSYQSLLLILIISAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTLMIS 71

Query: 66 APFIGGQISSFVTLVLSR 83
            ++   I  F + +   
Sbjct: 72 GGWLSNMIFRFASQIFQN 89


>gi|187918148|ref|YP_001883711.1| flagellar biosynthetic protein FliQ [Borrelia hermsii DAH]
 gi|119860996|gb|AAX16791.1| flagellar biosynthetic protein FliQ [Borrelia hermsii DAH]
          Length = 87

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 57/86 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    ++ + R A+  I+  SAP+L  A+ +G+L++  QA+T IQ+ TL+F+PKII + +
Sbjct: 1  MTTGQIIYLIRIAVENIIILSAPMLIMALIVGLLVSIFQAVTSIQDQTLSFIPKIIIILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+I  P+I  ++  F  +V S+IQ+
Sbjct: 61 TLVIFGPWILKKLMQFAFIVFSQIQN 86


>gi|302392378|ref|YP_003828198.1| flagellar biosynthetic protein FliQ [Acetohalobium arabaticum DSM
          5501]
 gi|302204455|gb|ADL13133.1| flagellar biosynthetic protein FliQ [Acetohalobium arabaticum DSM
          5501]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 49/77 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  V+E+ R A+  ++  +AP+L   +  G+ I+ LQA TQIQE TL F+PKI+AV +
Sbjct: 1  MTEQLVIELGRRALLQVVMVTAPMLGLGLLAGLAISILQATTQIQEQTLVFIPKILAVIV 60

Query: 61 TLIISAPFIGGQISSFV 77
           +II  P++   +  FV
Sbjct: 61 AIIIFGPWMLNTLVDFV 77


>gi|237800000|ref|ZP_04588461.1| type III secretion protein HrcS [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331022855|gb|EGI02912.1| type III secretion protein HrcS [Pseudomonas syringae pv. oryzae
          str. 1_6]
          Length = 72

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL ++  +IG ++  F+ + 
Sbjct: 2  TAPPLGVAVLVGVITSLLQALMQIQDQTLPFGIKLAAVGLTLAMTGRWIGVELIQFINMA 61

Query: 81 LSRIQSS 87
             I  S
Sbjct: 62 FDLIARS 68


>gi|146282915|ref|YP_001173068.1| flagellar biosynthesis protein FliQ [Pseudomonas stutzeri A1501]
 gi|145571120|gb|ABP80226.1| flagellar biosynthetic protein FliQ [Pseudomonas stutzeri A1501]
 gi|327481255|gb|AEA84565.1| flagellar biosynthesis protein FliQ [Pseudomonas stutzeri DSM
          4166]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 42/69 (60%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          ++ R  +W        ++  ++ +G+++A  QA TQI E TL+F+P+++ + +TLI + P
Sbjct: 8  DLFREGLWMTAMIVGVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLLTLIWAGP 67

Query: 68 FIGGQISSF 76
          ++  ++  +
Sbjct: 68 WLVRELMEY 76


>gi|260776472|ref|ZP_05885367.1| flagellar biosynthesis protein FliQ [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260607695|gb|EEX33960.1| flagellar biosynthesis protein FliQ [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P+++   + L++ A 
Sbjct: 8  ELFRGALWMVLLMVCAIIIPSLLIGLIVAIFQAATSINEQTLSFLPRLVVTLLALMLFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  +   ++ R+   L
Sbjct: 68 WMTQMLMEYFFSIVERLPQVL 88


>gi|218778859|ref|YP_002430177.1| flagellar biosynthetic protein FliQ [Desulfatibacillum
          alkenivorans AK-01]
 gi|218760243|gb|ACL02709.1| Flagellar biosynthetic protein FliQ [Desulfatibacillum
          alkenivorans AK-01]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 38 LQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
           QA TQIQE+TLTFVPKI+ V +  I   P++  ++ +F  + +S+I +
Sbjct: 38 FQATTQIQEITLTFVPKIVVVLLGAIFFGPWMLEKLMAFTHMCISQIPN 86


>gi|220934505|ref|YP_002513404.1| flagellar biosynthetic protein FliQ [Thioalkalivibrio sp.
          HL-EbGR7]
 gi|219995815|gb|ACL72417.1| flagellar biosynthetic protein FliQ [Thioalkalivibrio sp.
          HL-EbGR7]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ + A+  I+  SAP+L +A+ +G+ I  +QA TQIQE+TL+F+PK++ +F 
Sbjct: 1  MTPETVVDLGQQALMVIVLLSAPMLLAALAIGLAIGMIQAATQIQEMTLSFIPKLLGMFA 60

Query: 61 TLIISAPFI 69
           L+I+  ++
Sbjct: 61 ALLITGHWM 69


>gi|124265769|ref|YP_001019773.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
 gi|124258544|gb|ABM93538.1| flagellar biosynthesis protein [Methylibium petroleiphilum PM1]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V    +  +  +L  SAP+L + + +G+LI+  QA TQI E TL+FVPK+IA   
Sbjct: 1  MDAQQVFTFGQQGLVLLLMVSAPMLLTILVVGLLISVFQAATQINESTLSFVPKLIAAVA 60

Query: 61 TLIISAPFI 69
           L I+ P++
Sbjct: 61 VLAIAGPWM 69


>gi|322432984|ref|YP_004210233.1| export protein FliQ family 3 [Acidobacterium sp. MP5ACTX9]
 gi|321165211|gb|ADW70915.1| export protein FliQ family 3 [Acidobacterium sp. MP5ACTX9]
          Length = 89

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R  +  ++  +AP+L  A+ + +++  +Q LT +Q+ TL+ VP+++A   
Sbjct: 1  MGADAVVAMGRMMLEEVIILTAPILLVAIAVSLVVNIIQVLTSLQDQTLSTVPRLLATGA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL I  P++   IS++  L+ S     L
Sbjct: 61 TLFILMPWMWRHISTYTLLLFSDFHKVL 88


>gi|311105949|ref|YP_003978802.1| flagellar biosynthetic protein FliQ [Achromobacter xylosoxidans
          A8]
 gi|310760638|gb|ADP16087.1| flagellar biosynthetic protein FliQ [Achromobacter xylosoxidans
          A8]
          Length = 89

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM  +L+ + P+L   + +G++I+  QA TQI E+TL+F+PK++A+  
Sbjct: 1  MTAETVMTMTYQAMKIVLAMAGPLLLVTLVVGLVISIFQAATQINEMTLSFIPKLLAMCG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++ G +  ++  ++ +I
Sbjct: 61 VLVLLGPWLIGVMVDYIRQLIGQI 84


>gi|206895800|ref|YP_002246701.1| flagellar biosynthetic protein FliQ [Coprothermobacter
          proteolyticus DSM 5265]
 gi|206738417|gb|ACI17495.1| flagellar biosynthetic protein FliQ [Coprothermobacter
          proteolyticus DSM 5265]
          Length = 87

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          R+++  IL    PVL  A+ LGI+I+ LQ LTQI + ++ FVPK    F+ +++   F G
Sbjct: 10 RSSVLQILIIVGPVLLVALVLGIIISILQVLTQIHDPSVAFVPK----FLVIMLLVLFFG 65

Query: 71 GQI 73
          G +
Sbjct: 66 GTV 68


>gi|225159017|ref|ZP_03725327.1| export protein FliQ family 3 [Opitutaceae bacterium TAV2]
 gi|224802396|gb|EEG20658.1| export protein FliQ family 3 [Opitutaceae bacterium TAV2]
          Length = 89

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G+L +  Q++T IQE TLTF PK++A+ +  I+ AP++   +S F  + ++R+ +
Sbjct: 32 GLLTSLAQSVTSIQEQTLTFAPKLVALGLLFILLAPWLLRTLSEFAAMCIARMAT 86


>gi|319795613|ref|YP_004157253.1| type III secretion protein, hrpo family [Variovorax paradoxus
          EPS]
 gi|315598076|gb|ADU39142.1| type III secretion protein, HrpO family [Variovorax paradoxus
          EPS]
          Length = 88

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 45/76 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   ++L+I R  +  +L  S PV+  A    +++A LQA+TQ+Q+  +    ++IAV +
Sbjct: 1  MTPQNILDITREGLLLVLWISLPVVAVATLTSLVVAVLQAVTQVQDQNIGQSIRMIAVMV 60

Query: 61 TLIISAPFIGGQISSF 76
           +I++A ++G  +  F
Sbjct: 61 AIIVTAGWLGRDMIRF 76


>gi|76574806|gb|ABA47280.1| HrcS [Pseudomonas cichorii]
 gi|182440972|dbj|BAG24097.1| HrcS [Pseudomonas cichorii]
 gi|284810344|gb|ADB95954.1| putative HrcS [Pseudomonas cichorii]
 gi|284810348|gb|ADB95957.1| putative HrcS [Pseudomonas cichorii]
 gi|284810352|gb|ADB95960.1| putative HrcS [Pseudomonas cichorii]
 gi|284810356|gb|ADB95963.1| putative HrcS [Pseudomonas cichorii]
 gi|284810360|gb|ADB95966.1| putative HrcS [Pseudomonas cichorii]
 gi|284810364|gb|ADB95969.1| putative HrcS [Pseudomonas cichorii]
 gi|284810368|gb|ADB95972.1| putative HrcS [Pseudomonas cichorii]
 gi|284810372|gb|ADB95975.1| putative HrcS [Pseudomonas cichorii]
 gi|284810376|gb|ADB95978.1| putative HrcS [Pseudomonas cichorii]
 gi|284810380|gb|ADB95981.1| putative HrcS [Pseudomonas cichorii]
 gi|284810384|gb|ADB95984.1| putative HrcS [Pseudomonas cichorii]
 gi|284810388|gb|ADB95987.1| putative HrcS [Pseudomonas cichorii]
 gi|284810392|gb|ADB95990.1| putative HrcS [Pseudomonas cichorii]
 gi|284810396|gb|ADB95993.1| putative HrcS [Pseudomonas cichorii]
 gi|284810400|gb|ADB95996.1| putative HrcS [Pseudomonas cichorii]
 gi|284810404|gb|ADB95999.1| putative HrcS [Pseudomonas cichorii]
 gi|284810408|gb|ADB96002.1| putative HrcS [Pseudomonas cichorii]
 gi|284810412|gb|ADB96005.1| putative HrcS [Pseudomonas cichorii]
 gi|284810416|gb|ADB96008.1| putative HrcS [Pseudomonas cichorii]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 42/66 (63%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + + AM  ++  SAP L  A+ +G++ + LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 2  ETLTLFKQAMLLVVVLSAPALIVAVIVGVITSLLQAVMQLQDQTLPFAIKLVAVGVALAL 61

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 62 TGRWIG 67


>gi|57238686|ref|YP_179817.1| flagellar biosynthesis protein FliQ [Campylobacter jejuni RM1221]
 gi|86149340|ref|ZP_01067571.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni CF93-6]
 gi|86152319|ref|ZP_01070530.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 260.94]
 gi|86152894|ref|ZP_01071099.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni HB93-13]
 gi|88596569|ref|ZP_01099806.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 84-25]
 gi|121612222|ref|YP_001001318.1| flagellar biosynthesis protein FliQ [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|148925811|ref|ZP_01809499.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni CG8486]
 gi|157415894|ref|YP_001483150.1| flagellar biosynthesis protein FliQ [Campylobacter jejuni subsp.
          jejuni 81116]
 gi|167006211|ref|ZP_02271969.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|205355693|ref|ZP_03222463.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni CG8421]
 gi|218563263|ref|YP_002345043.1| flagellar biosynthesis protein FliQ [Campylobacter jejuni subsp.
          jejuni NCTC 11168]
 gi|283957060|ref|ZP_06374532.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni 1336]
 gi|57167490|gb|AAW36269.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni RM1221]
 gi|62754294|gb|AAX99157.1| FliQ [Campylobacter jejuni subsp. jejuni 81-176]
 gi|85840122|gb|EAQ57380.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni CF93-6]
 gi|85840808|gb|EAQ58059.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 260.94]
 gi|85843779|gb|EAQ60989.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni HB93-13]
 gi|87249847|gb|EAQ72806.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|88191410|gb|EAQ95382.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 84-25]
 gi|112360970|emb|CAL35771.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni NCTC 11168]
 gi|145845821|gb|EDK22912.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni CG8486]
 gi|157386858|gb|ABV53173.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni 81116]
 gi|205346470|gb|EDZ33103.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni CG8421]
 gi|283791561|gb|EFC30358.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni 1336]
 gi|284926868|gb|ADC29220.1| flagellar biosynthetic protein [Campylobacter jejuni subsp.
          jejuni IA3902]
 gi|307748531|gb|ADN91801.1| Flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni M1]
 gi|315059125|gb|ADT73454.1| Flagellar biosynthesis protein fliQ [Campylobacter jejuni subsp.
          jejuni S3]
 gi|315927575|gb|EFV06906.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni DFVF1099]
 gi|315930885|gb|EFV09871.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 305]
 gi|315931361|gb|EFV10330.1| flagellar biosynthetic protein FliQ [Campylobacter jejuni subsp.
          jejuni 327]
          Length = 89

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+  QA TQI E+TL+FVPKII V + LI   P++   +  F   +L++I +
Sbjct: 32 GLVISIFQATTQINEMTLSFVPKIILVVVILIFLMPWMTTTMIDFTENILNQIPT 86


>gi|217422567|ref|ZP_03454070.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 576]
 gi|217394798|gb|EEC34817.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 576]
          Length = 87

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  MEIDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           + I+ P+   +I  F   ++S
Sbjct: 61 IVAIAGPWAAAEILHFAQQLMS 82


>gi|307725661|ref|YP_003908874.1| type III secretion protein, HrpO family [Burkholderia sp.
          CCGE1003]
 gi|323530326|ref|YP_004232478.1| type III secretion protein, HrpO family [Burkholderia sp.
          CCGE1001]
 gi|307586186|gb|ADN59583.1| type III secretion protein, HrpO family [Burkholderia sp.
          CCGE1003]
 gi|323387328|gb|ADX59418.1| type III secretion protein, HrpO family [Burkholderia sp.
          CCGE1001]
          Length = 87

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 35/48 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          S P++  A  +G+ ++FLQA+T +Q+ TL+   K+IAV I ++I+APF
Sbjct: 21 SLPIVIVAALVGLGVSFLQAITSMQDQTLSHGVKLIAVTIAIVIAAPF 68


>gi|120613020|ref|YP_972698.1| flagellar biosynthetic protein FliQ [Acidovorax citrulli AAC00-1]
 gi|120591484|gb|ABM34924.1| flagellar biosynthetic protein FliQ [Acidovorax citrulli AAC00-1]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 3/86 (3%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + R A+  +L  S PVL   M +G+L++  QA+TQI E TL FVPK+IA  +
Sbjct: 1  MTSQMVLTVGRDALTLLLMVSMPVLGVVMVVGLLVSIFQAVTQIHEATLAFVPKLIAAMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
             +  P++   I+S V  +   I+S
Sbjct: 61 VFAVVGPWM---ITSLVDYIRRTIES 83


>gi|312884900|ref|ZP_07744590.1| flagellar biosynthesis protein FliQ [Vibrio caribbenthicus ATCC
          BAA-2122]
 gi|309367377|gb|EFP94939.1| flagellar biosynthesis protein FliQ [Vibrio caribbenthicus ATCC
          BAA-2122]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++ A 
Sbjct: 8  ELFREALWVVLIMVCAIIIPSLLIGLIVAIFQAATSINEQTLSFLPRLIVTLLALMMFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQILMEFFFSMIERLPQVL 88


>gi|15835466|ref|NP_297225.1| type III secretion inner membrane protein SctS [Chlamydia
          muridarum Nigg]
 gi|270285646|ref|ZP_06195040.1| type III secretion inner membrane protein SctS [Chlamydia
          muridarum Nigg]
 gi|270289655|ref|ZP_06195957.1| type III secretion inner membrane protein SctS [Chlamydia
          muridarum Weiss]
 gi|301337042|ref|ZP_07225244.1| type III secretion inner membrane protein SctS [Chlamydia
          muridarum MopnTet14]
 gi|8163335|gb|AAF73611.1| type III secretion inner membrane protein SctS [Chlamydia
          muridarum Nigg]
          Length = 94

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          ++ + E +  A+  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL
Sbjct: 9  KSMLFEYSYEALLLILIISAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTL 68

Query: 63 IISAPFIGGQISSF 76
          +I+  ++   I  F
Sbjct: 69 MITGGWLCSMILRF 82


>gi|222823196|ref|YP_002574769.1| flagellar biosynthesis protein FliQ [Campylobacter lari RM2100]
 gi|222538417|gb|ACM63518.1| flagellar biosynthesis protein FliQ [Campylobacter lari RM2100]
          Length = 88

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+L + +  G++I+  QA+TQI E TL+FVPKI+ V + ++   P++   +  F T +
Sbjct: 20 SLPMLLAGLIAGLIISIFQAVTQINEATLSFVPKILLVVVVIVFLMPWMISSMIDFTTNI 79

Query: 81 LSRIQS 86
          L++I S
Sbjct: 80 LNQIPS 85


>gi|326794361|ref|YP_004312181.1| type III secretion protein, HrpO family [Marinomonas mediterranea
          MMB-1]
 gi|326545125|gb|ADZ90345.1| type III secretion protein, HrpO family [Marinomonas mediterranea
          MMB-1]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 47/74 (63%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D L + +  M  ++  SAP L  A+ +G++++ LQAL Q+Q+ TL F  K++AV +TL I
Sbjct: 2  DTLTLFKQGMVLVVMLSAPPLVVAVIVGVVVSLLQALLQVQDQTLPFTIKLVAVVVTLAI 61

Query: 65 SAPFIGGQISSFVT 78
          +  ++G +I  F T
Sbjct: 62 TGRWLGVEIIQFTT 75


>gi|167567943|ref|ZP_02360859.1| type III secretion-associated protein [Burkholderia oklahomensis
          EO147]
 gi|167573183|ref|ZP_02366057.1| type III secretion-associated protein [Burkholderia oklahomensis
          C6786]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++  +   M   L+ S P +  A  +G+ ++F+QA+T +Q+ TL  V K+IAV I
Sbjct: 1  MDIDSLIRFSTQGMLLCLTVSLPPVIVAALVGLGVSFVQAITSLQDQTLPQVAKLIAVTI 60

Query: 61 TLIISAP 67
          T+I++AP
Sbjct: 61 TIIVAAP 67


>gi|257095349|ref|YP_003168990.1| flagellar biosynthetic protein FliQ [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
 gi|257047873|gb|ACV37061.1| flagellar biosynthetic protein FliQ [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 47/69 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+   L  SAP+L +A+ +G++++  QA TQI E TL FVPK++ +F+
Sbjct: 1  MTPELVMDIGRQAVEMTLLLSAPLLLAALVIGLIVSVFQAATQINEQTLAFVPKLVGMFL 60

Query: 61 TLIISAPFI 69
           L+++ P++
Sbjct: 61 ILLLAGPWM 69


>gi|302185357|ref|ZP_07262030.1| HrpO family type III secretion protein [Pseudomonas syringae pv.
          syringae 642]
 gi|256259403|gb|ACU65040.1| HrcS [Pseudomonas syringae pv. syringae]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (57%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M  ++  +AP L  A+ +G+L + +QAL Q+Q+ TL F  K++AV +TL +
Sbjct: 2  EALNLFKQGMILVVLLTAPPLIVAVAVGVLTSLVQALMQVQDQTLPFGLKLLAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++     L  + I  S
Sbjct: 62 TGRWIGVELIQLTNLAFNMIAQS 84


>gi|116694513|ref|YP_728724.1| flagellar biosynthesis protein FliQ [Ralstonia eutropha H16]
 gi|113529012|emb|CAJ95359.1| flagellar biosynthesis protein [Ralstonia eutropha H16]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 3/51 (5%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          +  QA TQI E+TL+F+PK+IA+F T++++ P++   I+S V  +    QS
Sbjct: 36 SLFQAATQINEMTLSFIPKLIALFATMVLAGPWM---INSMVDYMREVFQS 83


>gi|83720940|ref|YP_440591.1| flagellar biosynthesis protein FliQ [Burkholderia thailandensis
          E264]
 gi|167579278|ref|ZP_02372152.1| flagellar biosynthesis protein FliQ [Burkholderia thailandensis
          TXDOH]
 gi|167617384|ref|ZP_02386015.1| flagellar biosynthesis protein FliQ [Burkholderia thailandensis
          Bt4]
 gi|83654765|gb|ABC38828.1| flagellar biosynthetic protein FliQ [Burkholderia thailandensis
          E264]
          Length = 90

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++AV  
Sbjct: 1  MTPENVMTLAHQAMYIGLLLAAPLLLVALAVGLVVSLFQAATQINEATLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T++I+ P++   +  ++  +L R+ +
Sbjct: 61 TMVIAGPWMLSTMLDYLREILLRVAT 86


>gi|90021816|ref|YP_527643.1| flagellar hook-associated protein [Saccharophagus degradans 2-40]
 gi|89951416|gb|ABD81431.1| flagellar biosynthetic protein FliQ [Saccharophagus degradans
          2-40]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 39/57 (68%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          ++ +G++++  QA TQI E TL+F+P+++    T++++ P++ G IS   T ++ RI
Sbjct: 28 SLLVGLVVSTFQAATQINEQTLSFLPRLMMTIATIMVTGPWLLGSISDLFTSLVMRI 84


>gi|76818013|ref|YP_335590.1| type III secretion inner membrane protein SctS [Burkholderia
          pseudomallei 1710b]
 gi|126443963|ref|YP_001062996.1| HrpO family type III secretion protein [Burkholderia pseudomallei
          668]
 gi|126455867|ref|YP_001075943.1| HrpO family type III secretion protein [Burkholderia pseudomallei
          1106a]
 gi|134282456|ref|ZP_01769160.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 305]
 gi|167742992|ref|ZP_02415766.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 14]
 gi|167828538|ref|ZP_02460009.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 9]
 gi|167849996|ref|ZP_02475504.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei B7210]
 gi|167898605|ref|ZP_02486006.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 7894]
 gi|167906947|ref|ZP_02494152.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei NCTC 13177]
 gi|167915306|ref|ZP_02502397.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 112]
 gi|167923139|ref|ZP_02510230.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei BCC215]
 gi|217425305|ref|ZP_03456799.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 576]
 gi|226199049|ref|ZP_03794611.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pakistan 9]
 gi|237507517|ref|ZP_04520232.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei MSHR346]
 gi|242311426|ref|ZP_04810443.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106b]
 gi|254183806|ref|ZP_04890398.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1655]
 gi|254186720|ref|ZP_04893236.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pasteur 52237]
 gi|254193606|ref|ZP_04900038.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei S13]
 gi|254263098|ref|ZP_04953963.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1710a]
 gi|254301599|ref|ZP_04969043.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 406e]
 gi|4206079|gb|AAD11412.1| SctS [Burkholderia pseudomallei]
 gi|48479066|gb|AAT44856.1| putative type III secretory pathway and flagellar biosynthesis
          protein [Burkholderia pseudomallei]
 gi|76582486|gb|ABA51960.1| type III secretion inner membrane protein SctS [Burkholderia
          pseudomallei 1710b]
 gi|126223454|gb|ABN86959.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 668]
 gi|126229635|gb|ABN93048.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106a]
 gi|134246013|gb|EBA46103.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 305]
 gi|157811488|gb|EDO88658.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 406e]
 gi|157934404|gb|EDO90074.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pasteur 52237]
 gi|169650357|gb|EDS83050.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei S13]
 gi|184214339|gb|EDU11382.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1655]
 gi|217391556|gb|EEC31584.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 576]
 gi|225928824|gb|EEH24849.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pakistan 9]
 gi|234999722|gb|EEP49146.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei MSHR346]
 gi|242134665|gb|EES21068.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106b]
 gi|254214100|gb|EET03485.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1710a]
          Length = 87

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 38/55 (69%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          AM   LS S P +  A  +G+ ++F+QA+T +Q+ TL  V K+IAV IT++++AP
Sbjct: 13 AMLLCLSVSLPPVIVAALVGLGVSFVQAITSLQDQTLPQVLKLIAVTITIMVAAP 67


>gi|283836564|ref|ZP_06356305.1| surface presentation of antigens protein SpaQ [Citrobacter
          youngae ATCC 29220]
 gi|291067493|gb|EFE05602.1| surface presentation of antigens protein SpaQ [Citrobacter
          youngae ATCC 29220]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+++ +       +W ++  S P + +A  +G+LI+ +QA+TQIQ+ T+ F+ K++ V +
Sbjct: 1  MSDSVIAHFGEELLWIVVMLSLPTVVAASVVGVLISLIQAVTQIQDQTVQFLIKLVVVSV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+++  ++G  + S+  L+  +I
Sbjct: 61 VLVMTYNWMGNVLLSYTHLIFQQI 84


>gi|52842015|ref|YP_095814.1| flagellar biosynthetic protein FliQ [Legionella pneumophila
          subsp. pneumophila str. Philadelphia 1]
 gi|148359332|ref|YP_001250539.1| flagellar biosynthetic protein FliQ [Legionella pneumophila str.
          Corby]
 gi|296107379|ref|YP_003619079.1| flagellar biosynthetic protein FliQ [Legionella pneumophila
          2300/99 Alcoy]
 gi|52629126|gb|AAU27867.1| flagellar biosynthetic protein FliQ [Legionella pneumophila
          subsp. pneumophila str. Philadelphia 1]
 gi|148281105|gb|ABQ55193.1| flagellar biosynthetic protein FliQ [Legionella pneumophila str.
          Corby]
 gi|295649280|gb|ADG25127.1| flagellar biosynthetic protein FliQ [Legionella pneumophila
          2300/99 Alcoy]
 gi|307610488|emb|CBX00060.1| flagellar biosynthetic protein FliQ [Legionella pneumophila 130b]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 37/57 (64%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
           + +G++I+  QA TQI E +L+F+PK+   F+ LI++ P++   + ++   ++S I
Sbjct: 28 GLIVGLIISMFQAATQINETSLSFIPKLFVTFLVLILAGPWLLKTLINYTDTLISNI 84


>gi|54294675|ref|YP_127090.1| flagellar biosynthetic protein FliQ [Legionella pneumophila str.
          Lens]
 gi|54297701|ref|YP_124070.1| flagellar biosynthetic protein FliQ [Legionella pneumophila str.
          Paris]
 gi|53751486|emb|CAH12904.1| Flagellar biosynthetic protein FliQ [Legionella pneumophila str.
          Paris]
 gi|53754507|emb|CAH15991.1| Flagellar biosynthetic protein FliQ [Legionella pneumophila str.
          Lens]
          Length = 89

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 37/57 (64%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
           + +G++I+  QA TQI E +L+F+PK+   F+ LI++ P++   + ++   ++S I
Sbjct: 28 GLIVGLIISMFQAATQINETSLSFIPKLFVTFLVLILAGPWLLKTLINYTDTLISNI 84


>gi|206603141|gb|EDZ39621.1| flagellar biosynthesis protein FliQ [Leptospirillum sp. Group II
          '5-way CG']
          Length = 112

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN    +++   A+   L  + PVL  ++ +G+L++  QA+TQI E TL+F+PK+  V  
Sbjct: 24 MNVQTAIDLTHNALVMALILTLPVLVVSLVIGVLVSLFQAVTQINETTLSFLPKVAGVVG 83

Query: 61 TLIISAPFIGGQISSF 76
           L++  P++  Q+  +
Sbjct: 84 VLLVLMPWMVRQLIDY 99


>gi|300906600|ref|ZP_07124291.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 84-1]
 gi|71388158|gb|AAZ31292.1| EpaQ [Escherichia coli]
 gi|300401639|gb|EFJ85177.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 84-1]
 gi|315256733|gb|EFU36701.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 85-1]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I   +
Sbjct: 3  DIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSICFFL 62

Query: 65 SAPFIGGQISSF 76
           + + G ++ SF
Sbjct: 63 MSGWYGEKLYSF 74


>gi|255348944|ref|ZP_05380951.1| type III secretion system, membrane protein [Chlamydia
          trachomatis 70]
 gi|255503483|ref|ZP_05381873.1| type III secretion system, membrane protein [Chlamydia
          trachomatis 70s]
          Length = 94

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          + E +  A+  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL+I+
Sbjct: 12 LFEYSYEALLLILIISAPPIILASVVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTLMIT 71

Query: 66 APFIGGQISSF 76
            ++   I  F
Sbjct: 72 GGWLCSMILRF 82


>gi|15803388|ref|NP_289421.1| type III secretion apparatus protein [Escherichia coli O157:H7
          EDL933]
 gi|15832978|ref|NP_311751.1| EpaQ [Escherichia coli O157:H7 str. Sakai]
 gi|157158179|ref|YP_001464196.1| type III secretion apparatus protein EpaQ [Escherichia coli
          E24377A]
 gi|157162319|ref|YP_001459637.1| type III secretion apparatus protein EpaQ [Escherichia coli HS]
 gi|168747670|ref|ZP_02772692.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4113]
 gi|168753790|ref|ZP_02778797.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4401]
 gi|168759980|ref|ZP_02784987.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4501]
 gi|168766845|ref|ZP_02791852.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4486]
 gi|168775729|ref|ZP_02800736.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4196]
 gi|168778866|ref|ZP_02803873.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4076]
 gi|168785698|ref|ZP_02810705.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC869]
 gi|168799985|ref|ZP_02824992.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC508]
 gi|170018892|ref|YP_001723846.1| HrpO family type III secretion protein [Escherichia coli ATCC
          8739]
 gi|191166013|ref|ZP_03027849.1| type III secretion apparatus protein EpaQ [Escherichia coli B7A]
 gi|193071823|ref|ZP_03052712.1| type III secretion apparatus protein EpaQ [Escherichia coli
          E110019]
 gi|195936470|ref|ZP_03081852.1| HrpO family type III secretion protein [Escherichia coli O157:H7
          str. EC4024]
 gi|208808401|ref|ZP_03250738.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4206]
 gi|208814108|ref|ZP_03255437.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4045]
 gi|208820917|ref|ZP_03261237.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4042]
 gi|209399840|ref|YP_002272330.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4115]
 gi|217326771|ref|ZP_03442854.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. TW14588]
 gi|254794805|ref|YP_003079642.1| type III secretion apparatus protein [Escherichia coli O157:H7
          str. TW14359]
 gi|256019340|ref|ZP_05433205.1| type III secretion apparatus protein [Shigella sp. D9]
 gi|260856976|ref|YP_003230867.1| type III secretion protein EpaQ [Escherichia coli O26:H11 str.
          11368]
 gi|260869539|ref|YP_003235941.1| type III secretion protein EpaQ [Escherichia coli O111:H- str.
          11128]
 gi|261226165|ref|ZP_05940446.1| type III secretion apparatus protein [Escherichia coli O157:H7
          str. FRIK2000]
 gi|261256581|ref|ZP_05949114.1| type III secretion protein EpaQ [Escherichia coli O157:H7 str.
          FRIK966]
 gi|293406353|ref|ZP_06650279.1| antigen surface presentation protein SpaQ [Escherichia coli
          FVEC1412]
 gi|293412211|ref|ZP_06654934.1| hypothetical protein ECEG_02216 [Escherichia coli B354]
 gi|293416107|ref|ZP_06658747.1| type III secretion protein SctS [Escherichia coli B185]
 gi|293449184|ref|ZP_06663605.1| type III secretion protein SctS [Escherichia coli B088]
 gi|298382088|ref|ZP_06991685.1| type III secretion protein SctS [Escherichia coli FVEC1302]
 gi|300820660|ref|ZP_07100811.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 119-7]
 gi|300898068|ref|ZP_07116436.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 198-1]
 gi|300936203|ref|ZP_07151139.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 21-1]
 gi|300950613|ref|ZP_07164515.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 116-1]
 gi|300958194|ref|ZP_07170348.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 175-1]
 gi|301026124|ref|ZP_07189598.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 196-1]
 gi|301027457|ref|ZP_07190794.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 69-1]
 gi|301643800|ref|ZP_07243837.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 146-1]
 gi|307139549|ref|ZP_07498905.1| type III secretion protein, HrpO family [Escherichia coli H736]
 gi|309793921|ref|ZP_07688346.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 145-7]
 gi|331643549|ref|ZP_08344680.1| surface presentation of antigens protein SpaQ [Escherichia coli
          H736]
 gi|331664425|ref|ZP_08365331.1| surface presentation of antigens protein SpaQ [Escherichia coli
          TA143]
 gi|331669596|ref|ZP_08370442.1| surface presentation of antigens protein SpaQ [Escherichia coli
          TA271]
 gi|331674341|ref|ZP_08375101.1| surface presentation of antigens protein SpaQ [Escherichia coli
          TA280]
 gi|331678846|ref|ZP_08379520.1| surface presentation of antigens protein SpaQ [Escherichia coli
          H591]
 gi|332280454|ref|ZP_08392867.1| type III secretion apparatus protein EpaQ [Shigella sp. D9]
 gi|12517366|gb|AAG57980.1|AE005515_2 type III secretion apparatus protein [Escherichia coli O157:H7
          str. EDL933]
 gi|13363196|dbj|BAB37147.1| type III secretion protein EpaQ [Escherichia coli O157:H7 str.
          Sakai]
 gi|62085062|gb|AAX62927.1| type III secretion apparatus protein [Escherichia coli]
 gi|62085078|gb|AAX62942.1| type III secretion apparatus protein [Escherichia coli]
 gi|62085086|gb|AAX62949.1| type III secretion apparatus protein [Escherichia coli]
 gi|157067999|gb|ABV07254.1| type III secretion apparatus protein EpaQ [Escherichia coli HS]
 gi|157080209|gb|ABV19917.1| type III secretion apparatus protein EpaQ [Escherichia coli
          E24377A]
 gi|169753820|gb|ACA76519.1| type III secretion protein, HrpO family [Escherichia coli ATCC
          8739]
 gi|186976182|gb|ACD01064.1| EpaQ [Escherichia coli O157:H7 str. EC10]
 gi|187768730|gb|EDU32574.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4196]
 gi|188017805|gb|EDU55927.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4113]
 gi|189003282|gb|EDU72268.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4076]
 gi|189358380|gb|EDU76799.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4401]
 gi|189363741|gb|EDU82160.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4486]
 gi|189369218|gb|EDU87634.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4501]
 gi|189373883|gb|EDU92299.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC869]
 gi|189377618|gb|EDU96034.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC508]
 gi|190903961|gb|EDV63674.1| type III secretion apparatus protein EpaQ [Escherichia coli B7A]
 gi|192954863|gb|EDV85377.1| type III secretion apparatus protein EpaQ [Escherichia coli
          E110019]
 gi|208728202|gb|EDZ77803.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4206]
 gi|208735385|gb|EDZ84072.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4045]
 gi|208741040|gb|EDZ88722.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4042]
 gi|209161240|gb|ACI38673.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. EC4115]
 gi|217319138|gb|EEC27563.1| type III secretion apparatus protein EpaQ [Escherichia coli
          O157:H7 str. TW14588]
 gi|254594205|gb|ACT73566.1| type III secretion apparatus protein [Escherichia coli O157:H7
          str. TW14359]
 gi|257755625|dbj|BAI27127.1| type III secretion protein EpaQ [Escherichia coli O26:H11 str.
          11368]
 gi|257765895|dbj|BAI37390.1| type III secretion protein EpaQ [Escherichia coli O111:H- str.
          11128]
 gi|284922802|emb|CBG35890.1| type III secretion system protein [Escherichia coli 042]
 gi|291322274|gb|EFE61703.1| type III secretion protein SctS [Escherichia coli B088]
 gi|291426359|gb|EFE99391.1| antigen surface presentation protein SpaQ [Escherichia coli
          FVEC1412]
 gi|291432296|gb|EFF05278.1| type III secretion protein SctS [Escherichia coli B185]
 gi|291468982|gb|EFF11473.1| hypothetical protein ECEG_02216 [Escherichia coli B354]
 gi|298277228|gb|EFI18744.1| type III secretion protein SctS [Escherichia coli FVEC1302]
 gi|299879819|gb|EFI88030.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 196-1]
 gi|300315146|gb|EFJ64930.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 175-1]
 gi|300358206|gb|EFJ74076.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 198-1]
 gi|300394965|gb|EFJ78503.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 69-1]
 gi|300450093|gb|EFK13713.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 116-1]
 gi|300458660|gb|EFK22153.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 21-1]
 gi|300526924|gb|EFK47993.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 119-7]
 gi|301077833|gb|EFK92639.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 146-1]
 gi|308122328|gb|EFO59590.1| surface presentation of antigens protein SpaQ [Escherichia coli
          MS 145-7]
 gi|309703221|emb|CBJ02556.1| type III secretion system protein [Escherichia coli ETEC H10407]
 gi|320189198|gb|EFW63857.1| Surface presentation of antigens protein SpaQ [Escherichia coli
          O157:H7 str. EC1212]
 gi|323180304|gb|EFZ65856.1| epaQ [Escherichia coli 1180]
 gi|323183414|gb|EFZ68811.1| epaQ [Escherichia coli 1357]
 gi|323941618|gb|EGB37798.1| export protein 3 [Escherichia coli E482]
 gi|323966654|gb|EGB62086.1| export protein 3 [Escherichia coli M863]
 gi|323978519|gb|EGB73601.1| export protein 3 [Escherichia coli TW10509]
 gi|326339061|gb|EGD62876.1| Surface presentation of antigens protein SpaQ [Escherichia coli
          O157:H7 str. 1044]
 gi|326343058|gb|EGD66826.1| Surface presentation of antigens protein SpaQ [Escherichia coli
          O157:H7 str. 1125]
 gi|327251615|gb|EGE63301.1| epaQ [Escherichia coli STEC_7v]
 gi|331037020|gb|EGI09244.1| surface presentation of antigens protein SpaQ [Escherichia coli
          H736]
 gi|331058356|gb|EGI30337.1| surface presentation of antigens protein SpaQ [Escherichia coli
          TA143]
 gi|331063264|gb|EGI35177.1| surface presentation of antigens protein SpaQ [Escherichia coli
          TA271]
 gi|331068435|gb|EGI39830.1| surface presentation of antigens protein SpaQ [Escherichia coli
          TA280]
 gi|331073676|gb|EGI44997.1| surface presentation of antigens protein SpaQ [Escherichia coli
          H591]
 gi|332102806|gb|EGJ06152.1| type III secretion apparatus protein EpaQ [Shigella sp. D9]
 gi|332344756|gb|AEE58090.1| Type III secretion apparatus protein EpaQ [Escherichia coli
          UMNK88]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I   +
Sbjct: 3  DIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSICFFL 62

Query: 65 SAPFIGGQISSF 76
           + + G ++ SF
Sbjct: 63 MSGWYGEKLYSF 74


>gi|297617155|ref|YP_003702314.1| flagellar biosynthetic protein FliQ [Syntrophothermus lipocalidus
          DSM 12680]
 gi|297144992|gb|ADI01749.1| flagellar biosynthetic protein FliQ [Syntrophothermus lipocalidus
          DSM 12680]
          Length = 91

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 55/84 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  VL +A+ A++  L  +AP+L  ++ +G++I+ LQA TQIQE TLTFVPKII V +
Sbjct: 1  MYQDVVLGLAKEAVYATLLVAAPILLGSLLIGLVISILQATTQIQEQTLTFVPKIIVVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           +I+  P++   + +F   +L  I
Sbjct: 61 VIIVFGPWMLNTMVAFANNLLVNI 84


>gi|317121830|ref|YP_004101833.1| flagellar biosynthetic protein FliQ [Thermaerobacter marianensis
          DSM 12885]
 gi|315591810|gb|ADU51106.1| flagellar biosynthetic protein FliQ [Thermaerobacter marianensis
          DSM 12885]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +A VL + R A+WT L  +APVL   + +G++++ LQA TQ+ E TL FVPKI+A   
Sbjct: 1  MTDAMVLTVGREALWTGLLVAAPVLVLTVLVGVVVSVLQAATQVTEQTLVFVPKILAAAA 60

Query: 61 TLIISAPFI 69
           L++  P++
Sbjct: 61 ALLLFGPWM 69


>gi|242309972|ref|ZP_04809127.1| flagellar biosynthesis protein FliQ [Helicobacter pullorum MIT
          98-5489]
 gi|239523269|gb|EEQ63135.1| flagellar biosynthesis protein FliQ [Helicobacter pullorum MIT
          98-5489]
          Length = 88

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++ +A       L  S P+L   + +G+LI+  QA TQI E+TLTFVPKI+AV + +
Sbjct: 2  EAQLMNLAIETYKITLVLSLPMLLVGLVIGLLISIFQATTQINEMTLTFVPKILAVIVVI 61

Query: 63 IISAPFIGGQISSF 76
          I + P++   +  F
Sbjct: 62 IFTMPWMLNMLIDF 75


>gi|15605292|ref|NP_220078.1| Yop proteins translocation protein S [Chlamydia trachomatis
          D/UW-3/CX]
 gi|76789300|ref|YP_328386.1| SctS [Chlamydia trachomatis A/HAR-13]
 gi|166154778|ref|YP_001654896.1| type III secretion system, membrane protein [Chlamydia
          trachomatis 434/Bu]
 gi|166155653|ref|YP_001653908.1| type III secretion system, membrane protein [Chlamydia
          trachomatis L2b/UCH-1/proctitis]
 gi|237802992|ref|YP_002888186.1| type III secretion system, membrane protein [Chlamydia
          trachomatis B/Jali20/OT]
 gi|237804914|ref|YP_002889068.1| type III secretion system, membrane protein [Chlamydia
          trachomatis B/TZ1A828/OT]
 gi|255311382|ref|ZP_05353952.1| type III secretion system, membrane protein [Chlamydia
          trachomatis 6276]
 gi|255317683|ref|ZP_05358929.1| type III secretion system, membrane protein [Chlamydia
          trachomatis 6276s]
 gi|255507161|ref|ZP_05382800.1| type III secretion system, membrane protein [Chlamydia
          trachomatis D(s)2923]
 gi|301336053|ref|ZP_07224297.1| type III secretion system, membrane protein [Chlamydia
          trachomatis L2tet1]
 gi|3329004|gb|AAC68165.1| Yop proteins translocation protein S [Chlamydia trachomatis
          D/UW-3/CX]
 gi|76167830|gb|AAX50838.1| SctS [Chlamydia trachomatis A/HAR-13]
 gi|165930766|emb|CAP04263.1| type III secretion system, membrane protein [Chlamydia
          trachomatis 434/Bu]
 gi|165931641|emb|CAP07217.1| type III secretion system, membrane protein [Chlamydia
          trachomatis L2b/UCH-1/proctitis]
 gi|231273214|emb|CAX10127.1| type III secretion system, membrane protein [Chlamydia
          trachomatis B/TZ1A828/OT]
 gi|231274226|emb|CAX11020.1| type III secretion system, membrane protein [Chlamydia
          trachomatis B/Jali20/OT]
 gi|289525608|emb|CBJ15086.1| type III secretion system, membrane protein [Chlamydia
          trachomatis Sweden2]
 gi|296435169|gb|ADH17347.1| type III secretion system, membrane protein [Chlamydia
          trachomatis E/150]
 gi|296436097|gb|ADH18271.1| type III secretion system, membrane protein [Chlamydia
          trachomatis G/9768]
 gi|296437025|gb|ADH19195.1| type III secretion system, membrane protein [Chlamydia
          trachomatis G/11222]
 gi|296437957|gb|ADH20118.1| type III secretion system, membrane protein [Chlamydia
          trachomatis G/11074]
 gi|296438889|gb|ADH21042.1| type III secretion system, membrane protein [Chlamydia
          trachomatis E/11023]
 gi|297140458|gb|ADH97216.1| type III secretion system, membrane protein [Chlamydia
          trachomatis G/9301]
 gi|297748693|gb|ADI51239.1| type III secretion innner membrane protein SctS [Chlamydia
          trachomatis D-EC]
 gi|297749573|gb|ADI52251.1| type III secretion inner membrane protein SctS [Chlamydia
          trachomatis D-LC]
          Length = 94

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          + E +  A+  IL  SAP +  A  +GI++A  QA TQIQE T  F  K++ +F TL+I+
Sbjct: 12 LFEYSYEALLLILIISAPPIILASVVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTLMIT 71

Query: 66 APFIGGQISSF 76
            ++   I  F
Sbjct: 72 GGWLCSMILRF 82


>gi|262393599|ref|YP_003285453.1| flagellar biosynthesis protein FliQ [Vibrio sp. Ex25]
 gi|262337193|gb|ACY50988.1| flagellar biosynthesis protein FliQ [Vibrio sp. Ex25]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 45/81 (55%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++   
Sbjct: 8  ELFREALWMVLIMVCAIIIPSLLIGLIVAIFQAATSINEQTLSFLPRLIVTLLALMLFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  +   ++ R+   L
Sbjct: 68 WMTQMLMEYFYGLIERLPQVL 88


>gi|289624374|ref|ZP_06457328.1| type III secretion component, putative [Pseudomonas syringae pv.
          aesculi str. NCPPB3681]
 gi|289646627|ref|ZP_06477970.1| type III secretion component, putative [Pseudomonas syringae pv.
          aesculi str. 2250]
 gi|298487105|ref|ZP_07005155.1| type III secretion system integral membrane protein [Pseudomonas
          savastanoi pv. savastanoi NCPPB 3335]
 gi|298158348|gb|EFH99418.1| type III secretion system integral membrane protein [Pseudomonas
          savastanoi pv. savastanoi NCPPB 3335]
 gi|330868642|gb|EGH03351.1| type III secretion component [Pseudomonas syringae pv. aesculi
          str. 0893_23]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQALTQIQ+ TL  V K++AV +
Sbjct: 1  MGQDVFLSLMNKALMTVLLLSAPALIVAIVVGLSVGLLQALTQIQDQTLPQVVKLVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           ++   P + GQ++     VL  
Sbjct: 61 VIVFVGPLLAGQVAELGNQVLDN 83


>gi|256024632|ref|ZP_05438497.1| type III secretion apparatus protein [Escherichia sp. 4_1_40B]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I   +
Sbjct: 3  DIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSICFFL 62

Query: 65 SAPFIGGQISSF 76
           + + G ++ SF
Sbjct: 63 MSGWYGERLYSF 74


>gi|193063539|ref|ZP_03044628.1| type III secretion apparatus protein EpaQ [Escherichia coli E22]
 gi|194426266|ref|ZP_03058821.1| type III secretion apparatus protein EpaQ [Escherichia coli B171]
 gi|260845524|ref|YP_003223302.1| type III secretion protein EpaQ [Escherichia coli O103:H2 str.
          12009]
 gi|14422434|dbj|BAB60841.1| epaQ [Escherichia coli]
 gi|192930816|gb|EDV83421.1| type III secretion apparatus protein EpaQ [Escherichia coli E22]
 gi|194415574|gb|EDX31841.1| type III secretion apparatus protein EpaQ [Escherichia coli B171]
 gi|257760671|dbj|BAI32168.1| type III secretion protein EpaQ [Escherichia coli O103:H2 str.
          12009]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I   +
Sbjct: 3  DIVFAGNRALYLILVMSAGPIEVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSICFFL 62

Query: 65 SAPFIGGQISSF 76
           + + G ++ SF
Sbjct: 63 MSGWYGEKLYSF 74


>gi|323491456|ref|ZP_08096640.1| flagellar biosynthesis protein FliQ [Vibrio brasiliensis LMG
          20546]
 gi|323314325|gb|EGA67405.1| flagellar biosynthesis protein FliQ [Vibrio brasiliensis LMG
          20546]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R ++W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++ A 
Sbjct: 8  ELFRESLWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMLMEFFFSMIERMPQVL 88


>gi|261252333|ref|ZP_05944906.1| flagellar biosynthesis protein FliQ [Vibrio orientalis CIP
          102891]
 gi|260935724|gb|EEX91713.1| flagellar biosynthesis protein FliQ [Vibrio orientalis CIP
          102891]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 46/81 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++ A 
Sbjct: 8  ELFRDALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQILMEFFFSMIERLPQVL 88


>gi|188592195|ref|YP_001796793.1| flagellar biosynthesis protein fliq [Cupriavidus taiwanensis LMG
          19424]
 gi|170938569|emb|CAP63556.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Cupriavidus taiwanensis LMG 19424]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 33/49 (67%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          +  QA TQI E+TL+F+PK+IA+F T++++ P++   +  ++  V   I
Sbjct: 36 SLFQAATQINEMTLSFIPKLIALFATMVLAGPWMINAMVDYMREVFQSI 84


>gi|170690581|ref|ZP_02881748.1| type III secretion protein, HrpO family [Burkholderia graminis
          C4D1M]
 gi|170145016|gb|EDT13177.1| type III secretion protein, HrpO family [Burkholderia graminis
          C4D1M]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 35/48 (72%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          S P++  A  +G+ ++FLQA+T +Q+ TL+   K+IAV + ++I+APF
Sbjct: 21 SLPIVIVAALVGLGVSFLQAITSMQDQTLSHGVKLIAVTVAIVIAAPF 68


>gi|86146125|ref|ZP_01064451.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218708834|ref|YP_002416455.1| flagellar biosynthesis protein FliQ [Vibrio splendidus LGP32]
 gi|85836072|gb|EAQ54204.1| flagellar biosynthesis protein [Vibrio sp. MED222]
 gi|218321853|emb|CAV17830.1| Flagellar biosynthetic protein fliQ [Vibrio splendidus LGP32]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN    +++ + A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MNPEIFVDLFQDALWMVLIMVCAIIIPSLLIGLVVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++ A ++   +  F   ++ R+   L
Sbjct: 61 ALMMFAHWMTQMMMEFFFELIERLPQVL 88


>gi|330819398|ref|YP_004348260.1| Type III secretion inner membrane protein SctS [Burkholderia
          gladioli BSR3]
 gi|327371393|gb|AEA62748.1| Type III secretion inner membrane protein SctS [Burkholderia
          gladioli BSR3]
          Length = 87

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++      M   L+ S P +  A  +G+ ++F+QA+T +Q+ TL  V K+IAV I
Sbjct: 1  MDVDSLIRFTTQGMLLCLTVSLPPVIVAAVVGLGVSFVQAITSLQDQTLPQVIKLIAVTI 60

Query: 61 TLIISAPFIGGQISSF 76
          T+I++AP     +  F
Sbjct: 61 TIIVAAPVCCAAVLHF 76


>gi|313905145|ref|ZP_07838514.1| export protein FliQ family 3 [Eubacterium cellulosolvens 6]
 gi|313470048|gb|EFR65381.1| export protein FliQ family 3 [Eubacterium cellulosolvens 6]
          Length = 88

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          M  + V++I R      L  + P L  +M +GI++A  QA TQI E TL FV K++++
Sbjct: 1  MTNSQVIDIVRQTFMMALRIALPFLLVSMLVGIILAIFQAATQINEQTLMFVLKLLSI 58


>gi|330953283|gb|EGH53543.1| type III secretion component [Pseudomonas syringae Cit 7]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQALTQIQ+ TL  V K++ V +
Sbjct: 1  MGQDVFLSLMNQALMTVLLLSAPALIVAIVVGLGVGLLQALTQIQDQTLPQVVKLVGVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           ++   P + GQ++     VL  
Sbjct: 61 VIVFVGPLLAGQVAELGNQVLDN 83


>gi|237800780|ref|ZP_04589241.1| type III secretion component [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331023638|gb|EGI03695.1| type III secretion component [Pseudomonas syringae pv. oryzae
          str. 1_6]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQALTQIQ+ TL  V K++ V +
Sbjct: 1  MGQDVFLSLMNQALMTVLLLSAPALIVAIVVGLSVGLLQALTQIQDQTLPQVVKLVGVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           ++   P + GQ++     VL  
Sbjct: 61 VIVFVGPLLAGQVAELGNQVLDN 83


>gi|91223556|ref|ZP_01258821.1| flagellar biosynthesis protein Q [Vibrio alginolyticus 12G01]
 gi|269965692|ref|ZP_06179805.1| flagellar biosynthesis protein [Vibrio alginolyticus 40B]
 gi|91191642|gb|EAS77906.1| flagellar biosynthesis protein Q [Vibrio alginolyticus 12G01]
 gi|269829760|gb|EEZ83996.1| flagellar biosynthesis protein [Vibrio alginolyticus 40B]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 45/81 (55%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++   
Sbjct: 8  ELFREALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  +   ++ R+   L
Sbjct: 68 WMTQMLMEYFYGLIERLPQVL 88


>gi|226944501|ref|YP_002799574.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
 gi|226719428|gb|ACO78599.1| flagellar biosynthetic protein [Azotobacter vinelandii DJ]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 27/35 (77%)

Query: 35 IAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          ++  QA TQI E+TL+F+PKI+AVF  L+++ P +
Sbjct: 35 VSLFQAATQINEMTLSFIPKILAVFAVLVLAGPLM 69


>gi|261885291|ref|ZP_06009330.1| flagellar biosynthesis protein FliQ [Campylobacter fetus subsp.
          venerealis str. Azul-94]
          Length = 72

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+L + +  G++I+  QA TQI E+TL+FVPKII V + +I   P++  Q+  F   +
Sbjct: 4  SLPMLLAGLIAGLIISIFQATTQINEMTLSFVPKIILVVVIIIFLMPWMMNQMIEFTARI 63

Query: 81 LSRIQS 86
          L+ I +
Sbjct: 64 LNMIPT 69


>gi|257487955|ref|ZP_05641996.1| type III secretion component, putative [Pseudomonas syringae pv.
          tabaci ATCC 11528]
 gi|320324518|gb|EFW80595.1| type III secretion component, putative [Pseudomonas syringae pv.
          glycinea str. B076]
 gi|320328891|gb|EFW84890.1| type III secretion component, putative [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330985217|gb|EGH83320.1| type III secretion component [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331008644|gb|EGH88700.1| type III secretion component [Pseudomonas syringae pv. tabaci
          ATCC 11528]
          Length = 89

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQALTQIQ+ TL  V K++AV +
Sbjct: 1  MGQDVFLSLMNKALMTVLLLSAPALVVAIVVGLSVGLLQALTQIQDQTLPQVVKLVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           ++   P + GQ++     VL  
Sbjct: 61 VIVFVGPLLAGQVAELGNQVLDN 83


>gi|149191146|ref|ZP_01869404.1| flagellar biosynthetic protein [Vibrio shilonii AK1]
 gi|148834984|gb|EDL51963.1| flagellar biosynthetic protein [Vibrio shilonii AK1]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 48/76 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  + + +   A+W I+   + ++  ++ +G+++A  QA+TQ+ E TL+F+P+++   +
Sbjct: 1  MSPEEAVTLVSQAIWVIILMVSVLIVPSLIVGLVVAIFQAVTQVNEQTLSFLPRLLVTLL 60

Query: 61 TLIISAPFIGGQISSF 76
          ++I++  ++  +IS  
Sbjct: 61 SIILAGHWLLQEISDL 76


>gi|284041538|ref|YP_003391878.1| flagellar biosynthetic protein FliQ [Conexibacter woesei DSM
          14684]
 gi|283945759|gb|ADB48503.1| flagellar biosynthetic protein FliQ [Conexibacter woesei DSM
          14684]
          Length = 91

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 30/38 (78%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          QA+TQIQE +L+F+PKIIA  + L+++ P++  Q+ ++
Sbjct: 39 QAITQIQEQSLSFIPKIIATAVVLVVAGPWMLNQLIAY 76


>gi|260768790|ref|ZP_05877724.1| flagellar biosynthesis protein FliQ [Vibrio furnissii CIP 102972]
 gi|260616820|gb|EEX42005.1| flagellar biosynthesis protein FliQ [Vibrio furnissii CIP 102972]
 gi|315180493|gb|ADT87407.1| flagellar biosynthetic protein [Vibrio furnissii NCTC 11218]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E  V  +A A +W I++  + ++  ++ +G+++A  QA+TQI E TL+F+P+++   +++
Sbjct: 4  EMSVTLVAHA-LWVIIAMVSVLIVPSLLVGLIVAVFQAVTQINEQTLSFLPRLLVTMVSI 62

Query: 63 IISAPFIGGQISSF 76
          I++  ++  ++++ 
Sbjct: 63 IVTGHWLLMKLTTL 76


>gi|74317629|ref|YP_315369.1| flagellar biosynthesis protein FliQ [Thiobacillus denitrificans
          ATCC 25259]
 gi|74057124|gb|AAZ97564.1| flagellar biosynthesis protein FliQ [Thiobacillus denitrificans
          ATCC 25259]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ I R A+   +  SAPVL   + +G++++  QA TQI + +L+F+PK++AV  
Sbjct: 1  MTPESVMTIGRTALEMTILVSAPVLLVTLVVGLVVSVFQAATQINDASLSFIPKVLAVLA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T  ++ P++   ++ ++  VL+ +
Sbjct: 61 TFALAGPWMLTVMTDYMRRVLTEL 84


>gi|326796454|ref|YP_004314274.1| flagellar biosynthetic protein FliQ [Marinomonas mediterranea
          MMB-1]
 gi|326547218|gb|ADZ92438.1| flagellar biosynthetic protein FliQ [Marinomonas mediterranea
          MMB-1]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 46/76 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL++     + I+   A V+  ++ +G++++  QA TQI E TL+F+P++I   +
Sbjct: 1  MDPQVVLDLYGQGFYLIVLLVAAVMVPSLAVGLMVSIFQAATQINEQTLSFLPRLIVTIL 60

Query: 61 TLIISAPFIGGQISSF 76
          T++   P++  +++ F
Sbjct: 61 TIMYLGPWLLTKLTDF 76


>gi|189426338|ref|YP_001953515.1| flagellar biosynthetic protein FliQ [Geobacter lovleyi SZ]
 gi|189422597|gb|ACD96995.1| flagellar biosynthetic protein FliQ [Geobacter lovleyi SZ]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%)

Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          +G+ I+  QA+T I E TL F PKI+AV + +II  P++   +S F
Sbjct: 31 VGLAISVFQAVTSINEATLAFAPKIVAVMVAVIIFFPWMMSYMSDF 76


>gi|118474914|ref|YP_891408.1| flagellar biosynthesis protein FliQ [Campylobacter fetus subsp.
          fetus 82-40]
 gi|118414140|gb|ABK82560.1| flagellar biosynthetic protein FliQ [Campylobacter fetus subsp.
          fetus 82-40]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+L + +  G++I+  QA TQI E+TL+FVPKII V + +I   P++  Q+  F   +
Sbjct: 20 SLPMLLAGLIAGLIISIFQATTQINEMTLSFVPKIILVVVIIIFLMPWMMNQMIEFTARI 79

Query: 81 LSRIQS 86
          L+ I +
Sbjct: 80 LNMIPT 85


>gi|34498459|ref|NP_902674.1| flagellar biosynthetic protein FliQ [Chromobacterium violaceum
          ATCC 12472]
 gi|34104314|gb|AAQ60673.1| flagellar biosynthetic protein FliQ [Chromobacterium violaceum
          ATCC 12472]
          Length = 90

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL 88
          G++++ +QA TQI E TL+F+P+++ V +T+ ++  +I G +  F   +  R  S +
Sbjct: 33 GVVVSLIQAATQINEQTLSFLPRLLIVLLTIALAGHWITGYLMDFCVAMFQRAASQV 89


>gi|238023705|ref|YP_002907937.1| type III secretion-associated protein [Burkholderia glumae BGR1]
 gi|237878370|gb|ACR30702.1| Type III secretion-associated protein [Burkholderia glumae BGR1]
          Length = 87

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++      M   L+ S P +  A  +G+ ++F+QA+T +Q+ TL  V K++AV I
Sbjct: 1  MDVDSLIRFTTEGMLLCLTVSLPPVIVAAVVGLGVSFVQAITSLQDQTLPQVIKLVAVTI 60

Query: 61 TLIISAPFIGGQISSF 76
          T++I+AP     +  F
Sbjct: 61 TIVIAAPVCCAAVLHF 76


>gi|53717670|ref|YP_106656.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          K96243]
 gi|53724242|ref|YP_104209.1| flagellar biosynthesis protein FliQ [Burkholderia mallei ATCC
          23344]
 gi|67641567|ref|ZP_00440343.1| flagellar biosynthetic protein FliQ [Burkholderia mallei GB8
          horse 4]
 gi|76809084|ref|YP_331660.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          1710b]
 gi|121600763|ref|YP_994547.1| flagellar biosynthesis protein FliQ [Burkholderia mallei SAVP1]
 gi|124384525|ref|YP_001027837.1| flagellar biosynthesis protein FliQ [Burkholderia mallei NCTC
          10229]
 gi|126440833|ref|YP_001057088.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          668]
 gi|126449410|ref|YP_001082215.1| flagellar biosynthesis protein FliQ [Burkholderia mallei NCTC
          10247]
 gi|126454577|ref|YP_001064318.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          1106a]
 gi|134281561|ref|ZP_01768269.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          305]
 gi|167001620|ref|ZP_02267414.1| flagellar biosynthetic protein FliQ [Burkholderia mallei PRL-20]
 gi|167717398|ref|ZP_02400634.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          DM98]
 gi|167736440|ref|ZP_02409214.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          14]
 gi|167813516|ref|ZP_02445196.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          91]
 gi|167822058|ref|ZP_02453529.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei 9]
 gi|167843671|ref|ZP_02469179.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          B7210]
 gi|167892142|ref|ZP_02479544.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          7894]
 gi|167900654|ref|ZP_02487859.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          NCTC 13177]
 gi|167908874|ref|ZP_02495965.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          112]
 gi|167916913|ref|ZP_02504004.1| flagellar biosynthesis protein FliQ [Burkholderia pseudomallei
          BCC215]
 gi|217424032|ref|ZP_03455532.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          576]
 gi|226193193|ref|ZP_03788803.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          Pakistan 9]
 gi|237814426|ref|YP_002898877.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          MSHR346]
 gi|242317919|ref|ZP_04816935.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1106b]
 gi|254175228|ref|ZP_04881889.1| flagellar biosynthetic protein FliQ [Burkholderia mallei ATCC
          10399]
 gi|254184096|ref|ZP_04890687.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1655]
 gi|254186562|ref|ZP_04893079.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          Pasteur 52237]
 gi|254194698|ref|ZP_04901129.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          S13]
 gi|254201282|ref|ZP_04907646.1| flagellar biosynthetic protein FliQ [Burkholderia mallei FMH]
 gi|254206624|ref|ZP_04912975.1| flagellar biosynthetic protein FliQ [Burkholderia mallei JHU]
 gi|254259098|ref|ZP_04950152.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1710a]
 gi|254298636|ref|ZP_04966087.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          406e]
 gi|254357357|ref|ZP_04973631.1| flagellar biosynthetic protein FliQ [Burkholderia mallei
          2002721280]
 gi|52208084|emb|CAH34014.1| flagellar biosynthetic protein [Burkholderia pseudomallei K96243]
 gi|52427665|gb|AAU48258.1| flagellar biosynthetic protein FliQ [Burkholderia mallei ATCC
          23344]
 gi|76578537|gb|ABA48012.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1710b]
 gi|121229573|gb|ABM52091.1| flagellar biosynthetic protein FliQ [Burkholderia mallei SAVP1]
 gi|124292545|gb|ABN01814.1| flagellar biosynthetic protein FliQ [Burkholderia mallei NCTC
          10229]
 gi|126220326|gb|ABN83832.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          668]
 gi|126228219|gb|ABN91759.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1106a]
 gi|126242280|gb|ABO05373.1| flagellar biosynthetic protein FliQ [Burkholderia mallei NCTC
          10247]
 gi|134247228|gb|EBA47314.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          305]
 gi|147747176|gb|EDK54252.1| flagellar biosynthetic protein FliQ [Burkholderia mallei FMH]
 gi|147752166|gb|EDK59232.1| flagellar biosynthetic protein FliQ [Burkholderia mallei JHU]
 gi|148026421|gb|EDK84506.1| flagellar biosynthetic protein FliQ [Burkholderia mallei
          2002721280]
 gi|157808619|gb|EDO85789.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          406e]
 gi|157934247|gb|EDO89917.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          Pasteur 52237]
 gi|160696273|gb|EDP86243.1| flagellar biosynthetic protein FliQ [Burkholderia mallei ATCC
          10399]
 gi|169651448|gb|EDS84141.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          S13]
 gi|184214628|gb|EDU11671.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1655]
 gi|217393095|gb|EEC33117.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          576]
 gi|225934793|gb|EEH30770.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          Pakistan 9]
 gi|237505331|gb|ACQ97649.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          MSHR346]
 gi|238522520|gb|EEP85964.1| flagellar biosynthetic protein FliQ [Burkholderia mallei GB8
          horse 4]
 gi|242141158|gb|EES27560.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1106b]
 gi|243062630|gb|EES44816.1| flagellar biosynthetic protein FliQ [Burkholderia mallei PRL-20]
 gi|254217787|gb|EET07171.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1710a]
          Length = 90

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   +V+ +A  AM+  L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++AV  
Sbjct: 1  MTPENVMTLAHQAMYIGLLLAAPLLLVALAVGLVVSLFQAATQINEATLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          T++I+ P++   +  ++   L R+ +
Sbjct: 61 TMVIAGPWMLSTMIDYLRETLLRVAT 86


>gi|21672368|ref|NP_660435.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25008466|sp|Q8KA36|FLIQ_BUCAP RecName: Full=Flagellar biosynthetic protein FliQ
 gi|21622973|gb|AAM67646.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 90

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 36/55 (65%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+ LQA TQ+ E TL+F+PKII++ + + +  P++ G +  ++  +   I S
Sbjct: 32 GLIISILQAATQVNEQTLSFIPKIISILVVITLLGPWMLGVMLDYMHNLFYNIPS 86


>gi|292489151|ref|YP_003532038.1| flagellar biosynthetic protein FliQ [Erwinia amylovora CFBP1430]
 gi|292900269|ref|YP_003539638.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291200117|emb|CBJ47243.1| flagellar biosynthetic protein [Erwinia amylovora ATCC 49946]
 gi|291554585|emb|CBA22217.1| Flagellar biosynthetic protein FliQ [Erwinia amylovora CFBP1430]
 gi|312173309|emb|CBX81564.1| Flagellar biosynthetic protein FliQ [Erwinia amylovora ATCC
          BAA-2158]
          Length = 89

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   A+   L  + P+L +A+  G++I+ LQA TQI E+T+TF+PKI+ +  
Sbjct: 1  MTPESVMSLGIQAIKLGLMVAGPLLLAALATGLIISILQAATQINEMTMTFIPKILVIIG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            ++  P++      +  L L+ I
Sbjct: 61 VAVVLGPWMMRNFIEYTRLTLTNI 84


>gi|51103120|gb|AAT96263.1| HrcS [Pseudomonas viridiflava]
 gi|51103162|gb|AAT96304.1| HrcS [Pseudomonas viridiflava]
 gi|51103203|gb|AAT96344.1| HrcS [Pseudomonas viridiflava]
          Length = 86

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (57%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + + AM  ++  SAP L  A+ +G++ + LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 2  ETLTLFKQAMMLVVVLSAPPLIVAVVVGVITSLLQAVMQLQDQTLPFAIKLVAVGLALAL 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++     L  S I  +
Sbjct: 62 TGRWIGIELMQLAYLSFSMISQT 84


>gi|148976242|ref|ZP_01812966.1| flagellar biosynthetic protein [Vibrionales bacterium SWAT-3]
 gi|145964336|gb|EDK29591.1| flagellar biosynthetic protein [Vibrionales bacterium SWAT-3]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 51/87 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  + + +   A+W I+   + ++  ++ +G+++A  QA+TQ+ E TL+F+P+++   +
Sbjct: 1  MSPEEAVTLVSQAIWLIILMVSVLIVPSLVVGLVVAIFQAVTQVNEQTLSFLPRLLVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           +I++  ++  +I+     + + I S 
Sbjct: 61 CIILAGHWLLQEINDLFLFIFNTIPSK 87


>gi|291286236|ref|YP_003503052.1| flagellar biosynthetic protein FliQ [Denitrovibrio acetiphilus
          DSM 12809]
 gi|290883396|gb|ADD67096.1| flagellar biosynthetic protein FliQ [Denitrovibrio acetiphilus
          DSM 12809]
          Length = 90

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 39/49 (79%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          +AP+L   + +G+LI+  Q++TQIQE+TLTF+PKII V + +++ AP++
Sbjct: 21 AAPMLGIGLIIGLLISIFQSVTQIQEMTLTFIPKIIGVVVAVMVFAPWM 69


>gi|149189859|ref|ZP_01868139.1| flagellar biosynthetic protein [Vibrio shilonii AK1]
 gi|148836345|gb|EDL53302.1| flagellar biosynthetic protein [Vibrio shilonii AK1]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQ 72
          A+W I+S    ++   + +G++IA  QA TQIQE TL+F+PK++A  + +I +  ++  +
Sbjct: 13 AVWLIISIVMVLVVPGLLVGLVIAVFQAATQIQEQTLSFLPKLLATLLMVIFAGHWMLRK 72

Query: 73 ISSFVTLVLSRI 84
          I      +   I
Sbjct: 73 IMELFDFLFHNI 84


>gi|78064697|ref|YP_367466.1| flagellar biosynthesis protein FliQ [Burkholderia sp. 383]
 gi|77965442|gb|ABB06822.1| Flagellar biosynthesis protein FliQ [Burkholderia sp. 383]
          Length = 90

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 26/31 (83%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++AV +TL+I+ P++
Sbjct: 39 QAATQINESTLSFIPKLLAVAVTLVIAGPWM 69


>gi|53722432|ref|YP_111417.1| type III secretion-associated protein [Burkholderia pseudomallei
          K96243]
 gi|167724023|ref|ZP_02407259.1| type III secretion-associated protein [Burkholderia pseudomallei
          DM98]
 gi|167820163|ref|ZP_02451843.1| type III secretion-associated protein [Burkholderia pseudomallei
          91]
 gi|52212846|emb|CAH38880.1| putative type III secretion-associated protein [Burkholderia
          pseudomallei K96243]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 38/55 (69%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          AM   L+ S P +  A  +G+ ++F+QA+T +Q+ TL  V K+IAV IT++++AP
Sbjct: 13 AMLLCLTVSLPPVIVAALVGLGVSFVQAITSLQDQTLPQVLKLIAVTITIMVAAP 67


>gi|28899012|ref|NP_798617.1| flagellar biosynthesis protein FliQ [Vibrio parahaemolyticus RIMD
          2210633]
 gi|153837022|ref|ZP_01989689.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AQ3810]
 gi|260365242|ref|ZP_05777799.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          K5030]
 gi|260878792|ref|ZP_05891147.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AN-5034]
 gi|260897387|ref|ZP_05905883.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          Peru-466]
 gi|4322008|gb|AAD15911.1| polar flagellar assembly protein FliQ [Vibrio parahaemolyticus]
 gi|28807231|dbj|BAC60501.1| polar flagellar assembly protein FliQ [Vibrio parahaemolyticus
          RIMD 2210633]
 gi|149749795|gb|EDM60540.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AQ3810]
 gi|308088234|gb|EFO37929.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          Peru-466]
 gi|308094198|gb|EFO43893.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AN-5034]
 gi|308115483|gb|EFO53023.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          K5030]
 gi|328474451|gb|EGF45256.1| flagellar biosynthesis protein FliQ [Vibrio parahaemolyticus
          10329]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 45/81 (55%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++   
Sbjct: 8  ELFREALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  +   ++ R+   L
Sbjct: 68 WMTQMLMEYFFGLIERLPQVL 88


>gi|259907617|ref|YP_002647973.1| Flagellar biosynthetic protein FliQ [Erwinia pyrifoliae Ep1/96]
 gi|224963239|emb|CAX54723.1| Flagellar biosynthetic protein FliQ [Erwinia pyrifoliae Ep1/96]
 gi|283477459|emb|CAY73375.1| Flagellar biosynthetic protein FliQ [Erwinia pyrifoliae DSM
          12163]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   A+   L  + P+L +A+  G++I+ LQA TQI E+T+TF+PKI+ +  
Sbjct: 1  MTPESVMALGIQAIKLGLMVAGPLLLAALATGLIISILQAATQINEMTMTFIPKILVIIG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
            ++  P++      +  L L+ I
Sbjct: 61 VAVVLGPWMMRNFIEYTRLTLTNI 84


>gi|51587259|emb|CAE53649.1| putative HrcS [Pseudomonas gingeri]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTL 79
          +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL  +  +IG ++  F+ L
Sbjct: 8  TAPPLGVAVLVGVITSLLQALMQIQDQTLPFGIKLAAVGLTLAATGRWIGVELIQFINL 66


>gi|123443726|ref|YP_001007697.1| type III secretion apparatus protein [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|15088599|gb|AAK84110.1|AF369954_8 YsaS [Yersinia enterocolitica]
 gi|122090687|emb|CAL13563.1| type III secretion apparatus protein [Yersinia enterocolitica
          subsp. enterocolitica 8081]
          Length = 89

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 1/72 (1%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +A +  +L S+ PV+  A  +G+LI  +Q +TQ+QE TL F  K++AVF +L + + ++ 
Sbjct: 10 KAMLLIVLLSAIPVMV-ATVVGLLIGLIQTVTQLQEQTLPFGIKLLAVFGSLFMISGWLS 68

Query: 71 GQISSFVTLVLS 82
           ++ ++ T VL+
Sbjct: 69 DKVMNYATEVLA 80


>gi|322379080|ref|ZP_08053483.1| flagellar biosynthesis protein FliQ [Helicobacter suis HS1]
 gi|322379944|ref|ZP_08054221.1| flagellar biosynthesis protein FliQ [Helicobacter suis HS5]
 gi|321147642|gb|EFX42265.1| flagellar biosynthesis protein FliQ [Helicobacter suis HS5]
 gi|321148572|gb|EFX43069.1| flagellar biosynthesis protein FliQ [Helicobacter suis HS1]
          Length = 97

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (63%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++++A       L +S PVL   + +G+L++  QA TQI E+TL+FVPKI+AV   +
Sbjct: 11 EAQLMKLAIETYKITLMTSLPVLLVGLVVGLLVSIFQATTQINEMTLSFVPKILAVIAVI 70

Query: 63 IISAPFIGGQISSF 76
          I++ P++   +  +
Sbjct: 71 ILTMPWMLNMLLDY 84


>gi|153834121|ref|ZP_01986788.1| flagellar biosynthetic protein FliQ [Vibrio harveyi HY01]
 gi|156975419|ref|YP_001446326.1| flagellar biosynthesis protein FliQ [Vibrio harveyi ATCC
          BAA-1116]
 gi|269961631|ref|ZP_06175993.1| flagellar biosynthesis protein [Vibrio harveyi 1DA3]
 gi|148869491|gb|EDL68489.1| flagellar biosynthetic protein FliQ [Vibrio harveyi HY01]
 gi|156527013|gb|ABU72099.1| hypothetical protein VIBHAR_03150 [Vibrio harveyi ATCC BAA-1116]
 gi|269833672|gb|EEZ87769.1| flagellar biosynthesis protein [Vibrio harveyi 1DA3]
          Length = 89

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 45/81 (55%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++   
Sbjct: 8  ELFRDALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIVTLLALMLFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  +   ++ R+   L
Sbjct: 68 WMTQMLMEYFFGLIERLPQVL 88


>gi|209522297|ref|ZP_03270924.1| flagellar biosynthetic protein FliQ [Burkholderia sp. H160]
 gi|209497273|gb|EDZ97501.1| flagellar biosynthetic protein FliQ [Burkholderia sp. H160]
          Length = 89

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 26/31 (83%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++A+ +TL+I+ P++
Sbjct: 39 QAATQINETTLSFIPKLLAIAVTLVIAGPWM 69


>gi|254200991|ref|ZP_04907356.1| type III secretion system protein BsaX [Burkholderia mallei FMH]
 gi|254204955|ref|ZP_04911308.1| type III secretion system protein BsaX [Burkholderia mallei JHU]
 gi|147748603|gb|EDK55678.1| type III secretion system protein BsaX [Burkholderia mallei FMH]
 gi|147754541|gb|EDK61605.1| type III secretion system protein BsaX [Burkholderia mallei JHU]
          Length = 97

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          G+ I   Q +TQ+QE TL F  K++AVF  L++ + + GG++ +F T +LS
Sbjct: 43 GLAIGLFQTVTQLQEQTLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLS 93


>gi|254251035|ref|ZP_04944353.1| Flagellar biosynthesis pathway component FliQ [Burkholderia
          dolosa AUO158]
 gi|124893644|gb|EAY67524.1| Flagellar biosynthesis pathway component FliQ [Burkholderia
          dolosa AUO158]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++AV  TL+I+ P++
Sbjct: 39 QAATQINEATLSFIPKLLAVAATLVIAGPWM 69


>gi|167566197|ref|ZP_02359113.1| type III secretion protein, HrpO family [Burkholderia
          oklahomensis EO147]
 gi|167573307|ref|ZP_02366181.1| type III secretion protein, HrpO family [Burkholderia
          oklahomensis C6786]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          G+ I   Q +TQ+QE TL F  K++AVF  L++ + + GG++ +F T +LS
Sbjct: 30 GLAIGLFQTVTQLQEQTLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLS 80


>gi|310764877|gb|ADP09827.1| flagellar biosynthetic protein [Erwinia sp. Ejp617]
          Length = 83

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 41/67 (61%)

Query: 18 LSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFV 77
          L  + P+L +A+  G++I+ LQA TQI E+T+TF+PKI+ +    ++  P++      + 
Sbjct: 12 LMVAGPLLLAALATGLIISILQAATQINEMTMTFIPKILVIIGVAVVLGPWMMRNFIEYT 71

Query: 78 TLVLSRI 84
           L L+ I
Sbjct: 72 RLTLTNI 78


>gi|53716463|ref|YP_106125.1| type III secretion system protein BsaX [Burkholderia mallei ATCC
          23344]
 gi|53722557|ref|YP_111542.1| surface presentation of antigens protein [Burkholderia
          pseudomallei K96243]
 gi|67641436|ref|ZP_00440215.1| EpaQ [Burkholderia mallei GB8 horse 4]
 gi|76817353|ref|YP_335735.1| type III secretion system protein BsaX [Burkholderia pseudomallei
          1710b]
 gi|83716660|ref|YP_439034.1| type III secretion system protein BsaX [Burkholderia
          thailandensis E264]
 gi|124382058|ref|YP_001025865.1| type III secretion system protein BsaX [Burkholderia mallei NCTC
          10229]
 gi|126445290|ref|YP_001063160.1| HrpO family type III secretion protein [Burkholderia pseudomallei
          668]
 gi|126446907|ref|YP_001077950.1| type III secretion system protein BsaX [Burkholderia mallei NCTC
          10247]
 gi|126457838|ref|YP_001076111.1| HrpO family type III secretion protein [Burkholderia pseudomallei
          1106a]
 gi|134282032|ref|ZP_01768738.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 305]
 gi|167004215|ref|ZP_02269982.1| type III secretion system protein BsaX [Burkholderia mallei
          PRL-20]
 gi|167577440|ref|ZP_02370314.1| type III secretion protein, HrpO family [Burkholderia
          thailandensis TXDOH]
 gi|167615591|ref|ZP_02384226.1| type III secretion protein, HrpO family [Burkholderia
          thailandensis Bt4]
 gi|167724225|ref|ZP_02407461.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei DM98]
 gi|167743200|ref|ZP_02415974.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 14]
 gi|167820374|ref|ZP_02452054.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 91]
 gi|167828746|ref|ZP_02460217.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 9]
 gi|167840167|ref|ZP_02466851.1| type III secretion protein, HrpO family [Burkholderia
          thailandensis MSMB43]
 gi|167850201|ref|ZP_02475709.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei B7210]
 gi|167898808|ref|ZP_02486209.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 7894]
 gi|167907136|ref|ZP_02494341.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei NCTC 13177]
 gi|167915490|ref|ZP_02502581.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 112]
 gi|167923335|ref|ZP_02510426.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei BCC215]
 gi|217425115|ref|ZP_03456610.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 576]
 gi|226196058|ref|ZP_03791644.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pakistan 9]
 gi|237507342|ref|ZP_04520057.1| EpaQ [Burkholderia pseudomallei MSHR346]
 gi|242313286|ref|ZP_04812303.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106b]
 gi|254175967|ref|ZP_04882625.1| type III secretion system protein BsaX [Burkholderia mallei ATCC
          10399]
 gi|254185168|ref|ZP_04891757.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1655]
 gi|254186855|ref|ZP_04893371.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pasteur 52237]
 gi|254193621|ref|ZP_04900053.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei S13]
 gi|254262650|ref|ZP_04953515.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1710a]
 gi|254301457|ref|ZP_04968901.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 406e]
 gi|254359074|ref|ZP_04975346.1| type III secretion system protein BsaX [Burkholderia mallei
          2002721280]
 gi|257142142|ref|ZP_05590404.1| HrpO family type III secretion protein [Burkholderia
          thailandensis E264]
 gi|52212971|emb|CAH39009.1| surface presentation of antigens protein [Burkholderia
          pseudomallei K96243]
 gi|52422433|gb|AAU46003.1| type III secretion system protein BsaX [Burkholderia mallei ATCC
          23344]
 gi|76581826|gb|ABA51300.1| type III secretion system protein BsaX [Burkholderia pseudomallei
          1710b]
 gi|83650485|gb|ABC34549.1| type III secretion system protein BsaX [Burkholderia
          thailandensis E264]
 gi|126224781|gb|ABN88286.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 668]
 gi|126231606|gb|ABN95019.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106a]
 gi|126239761|gb|ABO02873.1| type III secretion system protein BsaX [Burkholderia mallei NCTC
          10247]
 gi|134246561|gb|EBA46649.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 305]
 gi|148028261|gb|EDK86221.1| type III secretion system protein BsaX [Burkholderia mallei
          2002721280]
 gi|157811254|gb|EDO88424.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 406e]
 gi|157934539|gb|EDO90209.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pasteur 52237]
 gi|160697009|gb|EDP86979.1| type III secretion system protein BsaX [Burkholderia mallei ATCC
          10399]
 gi|169650372|gb|EDS83065.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei S13]
 gi|184215760|gb|EDU12741.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1655]
 gi|217391720|gb|EEC31747.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 576]
 gi|225931951|gb|EEH27952.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei Pakistan 9]
 gi|234999547|gb|EEP48971.1| EpaQ [Burkholderia pseudomallei MSHR346]
 gi|238522376|gb|EEP85821.1| EpaQ [Burkholderia mallei GB8 horse 4]
 gi|242136525|gb|EES22928.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1106b]
 gi|243060410|gb|EES42596.1| type III secretion system protein BsaX [Burkholderia mallei
          PRL-20]
 gi|254213652|gb|EET03037.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 1710a]
 gi|261826624|gb|ABM99203.2| type III secretion system protein BsaX [Burkholderia mallei NCTC
          10229]
          Length = 84

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          G+ I   Q +TQ+QE TL F  K++AVF  L++ + + GG++ +F T +LS
Sbjct: 30 GLAIGLFQTVTQLQEQTLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLS 80


>gi|296282255|ref|ZP_06860253.1| hypothetical protein CbatJ_01475 [Citromicrobium bathyomarinum
          JL354]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 1  MNEADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M+E  VL  +A   +WT    +AP+L +A+ LG++I  +QA T + E TLTFVPK+ AV 
Sbjct: 1  MDEMSVLLSLADRMLWTTALVAAPILLAALGLGLVIGLIQAATSVNEQTLTFVPKLAAVA 60

Query: 60 ITLIISAPFIGGQISSFVT 78
            L++    +G  + + VT
Sbjct: 61 FVLVV----LGASMMALVT 75


>gi|107021596|ref|YP_619923.1| flagellar biosynthesis protein FliQ [Burkholderia cenocepacia AU
          1054]
 gi|116688060|ref|YP_833683.1| flagellar biosynthesis protein FliQ [Burkholderia cenocepacia
          HI2424]
 gi|161523219|ref|YP_001578231.1| flagellar biosynthesis protein FliQ [Burkholderia multivorans
          ATCC 17616]
 gi|170731410|ref|YP_001763357.1| flagellar biosynthesis protein FliQ [Burkholderia cenocepacia
          MC0-3]
 gi|189348924|ref|YP_001944552.1| flagellar biosynthesis protein FliQ [Burkholderia multivorans
          ATCC 17616]
 gi|221201780|ref|ZP_03574817.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          CGD2M]
 gi|221207715|ref|ZP_03580723.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          CGD2]
 gi|221214541|ref|ZP_03587511.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          CGD1]
 gi|254246637|ref|ZP_04939958.1| Flagellar biosynthesis protein FliQ [Burkholderia cenocepacia
          PC184]
 gi|105891785|gb|ABF74950.1| flagellar biosynthetic protein FliQ [Burkholderia cenocepacia AU
          1054]
 gi|116646149|gb|ABK06790.1| flagellar biosynthetic protein FliQ [Burkholderia cenocepacia
          HI2424]
 gi|124871413|gb|EAY63129.1| Flagellar biosynthesis protein FliQ [Burkholderia cenocepacia
          PC184]
 gi|160340648|gb|ABX13734.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          ATCC 17616]
 gi|169814652|gb|ACA89235.1| flagellar biosynthetic protein FliQ [Burkholderia cenocepacia
          MC0-3]
 gi|189332946|dbj|BAG42016.1| flagellar biosynthetic protein [Burkholderia multivorans ATCC
          17616]
 gi|221165431|gb|EED97907.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          CGD1]
 gi|221172561|gb|EEE05000.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          CGD2]
 gi|221178200|gb|EEE10610.1| flagellar biosynthetic protein FliQ [Burkholderia multivorans
          CGD2M]
 gi|325525521|gb|EGD03320.1| flagellar biosynthesis protein FliQ [Burkholderia sp. TJI49]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++AV  TL+I+ P++
Sbjct: 39 QAATQINEATLSFIPKLLAVAATLVIAGPWM 69


>gi|330814979|ref|YP_004358684.1| Flagellar biosynthesis protein FliQ [Burkholderia gladioli BSR3]
 gi|327367372|gb|AEA58728.1| Flagellar biosynthesis protein FliQ [Burkholderia gladioli BSR3]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 26/31 (83%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++A+ +T++I+ P++
Sbjct: 39 QAATQINESTLSFIPKLLAIVVTMVIAGPWM 69


>gi|27365291|ref|NP_760819.1| flagellar biosynthesis protein FliQ [Vibrio vulnificus CMCP6]
 gi|37680654|ref|NP_935263.1| flagellar biosynthesis protein FliQ [Vibrio vulnificus YJ016]
 gi|320155675|ref|YP_004188054.1| flagellar biosynthesis protein FliQ [Vibrio vulnificus MO6-24/O]
 gi|27361438|gb|AAO10346.1| flagellar biosynthetic protein FliQ [Vibrio vulnificus CMCP6]
 gi|37199403|dbj|BAC95234.1| flagellar biosynthesis pathway, component FliQ [Vibrio vulnificus
          YJ016]
 gi|319930987|gb|ADV85851.1| flagellar biosynthesis protein FliQ [Vibrio vulnificus MO6-24/O]
          Length = 89

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 43/76 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L++   
Sbjct: 8  ELFREALWMVLIMVCAIIIPSLLVGLIVAIFQAATSINEQTLSFLPRLIVTLLALMLFGH 67

Query: 68 FIGGQISSFVTLVLSR 83
          ++   +  +   ++ R
Sbjct: 68 WMTQMLMEYFFALVER 83


>gi|238025696|ref|YP_002909927.1| flagellar biosynthesis protein FliQ [Burkholderia glumae BGR1]
 gi|237874890|gb|ACR27223.1| Flagellar biosynthesis protein [Burkholderia glumae BGR1]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 26/31 (83%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++A+ +T++I+ P++
Sbjct: 39 QAATQINESTLSFIPKLLAIVVTMVIAGPWM 69


>gi|315453523|ref|YP_004073793.1| flagellar biosynthetic protein [Helicobacter felis ATCC 49179]
 gi|315132575|emb|CBY83203.1| flagellar biosynthetic protein [Helicobacter felis ATCC 49179]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (60%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          EA ++++A       L  S PVL   + +G+L++  QA TQI E+TL+FVPKI+AV   +
Sbjct: 2  EAQLMKLAIETYKITLMISLPVLLVGLVVGLLVSIFQATTQINEMTLSFVPKILAVIAVI 61

Query: 63 IISAPFIGGQISSFVTLVLSRI 84
          +I+ P++   +  + +++   I
Sbjct: 62 VITMPWMLNMLLDYTSMLFKLI 83


>gi|206561839|ref|YP_002232604.1| flagellar biosynthesis protein FliQ [Burkholderia cenocepacia
          J2315]
 gi|198037881|emb|CAR53825.1| flagellar biosynthetic protein FliQ [Burkholderia cenocepacia
          J2315]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQI E TL+F+PK++AV  TL+I+ P++
Sbjct: 39 QAATQINEATLSFIPKLLAVAATLVIAGPWM 69


>gi|167834871|ref|ZP_02461754.1| flagellar biosynthesis protein FliQ [Burkholderia thailandensis
          MSMB43]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          +  QA TQI E TL+F+PK++AV  T++I+ P++   +  ++   L R+
Sbjct: 36 SLFQAATQINEATLSFIPKLLAVAATMVIAGPWMLSTMIDYLRETLLRV 84


>gi|117619170|ref|YP_855915.1| flagellar biosynthetic protein FliQ [Aeromonas hydrophila subsp.
          hydrophila ATCC 7966]
 gi|74055045|gb|AAZ95850.1| FliQ [Aeromonas hydrophila]
 gi|117560577|gb|ABK37525.1| flagellar biosynthetic protein FliQ [Aeromonas hydrophila subsp.
          hydrophila ATCC 7966]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +++ R A+W +      V+  ++ +G+L+A  QA T I E TL+F+P++I    
Sbjct: 1  MSPETFIDVFREALWLVTIMVCAVILPSLCVGLLVAIFQAATSINEQTLSFLPRLIVTLF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L   A +    +  F  L++S+I
Sbjct: 61 ALGAGAHWGLQSLMDFFLLMVSQI 84


>gi|90406808|ref|ZP_01215000.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
 gi|90312045|gb|EAS40138.1| flagellar biosynthesis protein [Psychromonas sp. CNPT3]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          + I R A+WT+L   +  +  ++ +G+++A  QA T I E TL+F+P+++     L   A
Sbjct: 7  VNIFRQALWTVLLLVSAAIIPSLLVGLVVAVFQAATSINEQTLSFLPRLMMTLTALAFGA 66

Query: 67 PFIGGQISSFVTLVLSRI 84
           +  G++  F   ++ +I
Sbjct: 67 HWGFGKLMEFFISMIDQI 84


>gi|327394276|dbj|BAK11698.1| flagellar biosynthetic protein FliQ [Pantoea ananatis AJ13355]
          Length = 108

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 30/46 (65%)

Query: 39  QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
           QA TQI E TL+F+PKIIAV  T II+ P++   +  ++  V S +
Sbjct: 58  QAATQINEQTLSFIPKIIAVATTGIIAGPWMLNVLLDYIRTVFSNL 103


>gi|330828810|ref|YP_004391762.1| flagellar biosynthetic protein FliQ [Aeromonas veronii B565]
 gi|328803946|gb|AEB49145.1| Flagellar biosynthetic protein FliQ [Aeromonas veronii B565]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 48/84 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +++ R A+W +    + V+  ++ +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MSPETFVDVFREALWLVNIMVSAVILPSLAIGLVVAIFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L I A +    +  F  L++++I
Sbjct: 61 ALGIGAHWGMQSLMDFFILMVNQI 84


>gi|291617859|ref|YP_003520601.1| FliQ [Pantoea ananatis LMG 20103]
 gi|291152889|gb|ADD77473.1| FliQ [Pantoea ananatis LMG 20103]
          Length = 108

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 30/46 (65%)

Query: 39  QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
           QA TQI E TL+F+PKIIAV  T II+ P++   +  ++  V S +
Sbjct: 58  QAATQINEQTLSFIPKIIAVATTGIIAGPWMLNVLLDYIRTVFSNL 103


>gi|88800468|ref|ZP_01116032.1| flagellar biosynthesis protein [Reinekea sp. MED297]
 gi|88776798|gb|EAR08009.1| flagellar biosynthesis protein [Reinekea sp. MED297]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/84 (20%), Positives = 49/84 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  ++ ++   A++ ++   + ++  ++ +G++++  QA TQI E TL+F+P+++   +
Sbjct: 1  MDAMNIADLFSEALYIVVIIVSIIIVPSLIVGLIVSTFQAATQINEQTLSFLPRLLVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           +I + P++  ++  F   +   I
Sbjct: 61 MMIFAGPYLVNKVVEFANTIYMNI 84


>gi|183598643|ref|ZP_02960136.1| hypothetical protein PROSTU_02047 [Providencia stuartii ATCC
          25827]
 gi|188020826|gb|EDU58866.1| hypothetical protein PROSTU_02047 [Providencia stuartii ATCC
          25827]
          Length = 89

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 35 IAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          I+ LQA TQ+ E+TL+F+PKI++V   +II+ P++
Sbjct: 35 ISLLQAATQVNEMTLSFIPKILSVIAVIIIAGPWM 69


>gi|45440281|ref|NP_991820.1| putative type III secretion apparatus protein [Yersinia pestis
          biovar Microtus str. 91001]
 gi|51594683|ref|YP_068874.1| type III secretion apparatus protein EscS/SsaS/YscS [Yersinia
          pseudotuberculosis IP 32953]
 gi|108810001|ref|YP_653917.1| putative type III secretion apparatus protein [Yersinia pestis
          Antiqua]
 gi|108813556|ref|YP_649323.1| type III secretion apparatus protein [Yersinia pestis Nepal516]
 gi|145600946|ref|YP_001165022.1| type III secretion apparatus protein [Yersinia pestis Pestoides
          F]
 gi|150260680|ref|ZP_01917408.1| putative type III secretion apparatus protein [Yersinia pestis
          CA88-4125]
 gi|165926783|ref|ZP_02222615.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165936431|ref|ZP_02224999.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166010452|ref|ZP_02231350.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166213899|ref|ZP_02239934.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167418745|ref|ZP_02310498.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167426120|ref|ZP_02317873.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|170026114|ref|YP_001722619.1| HrpO family type III secretion protein [Yersinia
          pseudotuberculosis YPIII]
 gi|186893686|ref|YP_001870798.1| HrpO family type III secretion protein [Yersinia
          pseudotuberculosis PB1/+]
 gi|218927478|ref|YP_002345353.1| putative type III secretion apparatus protein [Yersinia pestis
          CO92]
 gi|229836526|ref|ZP_04456692.1| putative type III secretion apparatus protein [Yersinia pestis
          Pestoides A]
 gi|229840134|ref|ZP_04460293.1| putative type III secretion apparatus protein [Yersinia pestis
          biovar Orientalis str. PEXU2]
 gi|229842215|ref|ZP_04462370.1| putative type III secretion apparatus protein [Yersinia pestis
          biovar Orientalis str. India 195]
 gi|229904046|ref|ZP_04519159.1| putative type III secretion apparatus protein [Yersinia pestis
          Nepal516]
 gi|270488969|ref|ZP_06206043.1| type III secretion protein, HrpO family [Yersinia pestis KIM D27]
 gi|45435137|gb|AAS60697.1| putative type III secretion apparatus protein [Yersinia pestis
          biovar Microtus str. 91001]
 gi|51587965|emb|CAH19568.1| putative type III secretion apparatus protein EscS/SsaS/YscS
          [Yersinia pseudotuberculosis IP 32953]
 gi|108777204|gb|ABG19723.1| type III secretion apparatus protein [Yersinia pestis Nepal516]
 gi|108781914|gb|ABG15972.1| putative type III secretion apparatus protein [Yersinia pestis
          Antiqua]
 gi|115346089|emb|CAL18957.1| putative type III secretion apparatus protein [Yersinia pestis
          CO92]
 gi|145212642|gb|ABP42049.1| type III secretion apparatus protein [Yersinia pestis Pestoides
          F]
 gi|149290088|gb|EDM40165.1| putative type III secretion apparatus protein [Yersinia pestis
          CA88-4125]
 gi|165915547|gb|EDR34156.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165921406|gb|EDR38630.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165990542|gb|EDR42843.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166204874|gb|EDR49354.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166962739|gb|EDR58760.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167054831|gb|EDR64633.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169752648|gb|ACA70166.1| type III secretion protein, HrpO family [Yersinia
          pseudotuberculosis YPIII]
 gi|186696712|gb|ACC87341.1| type III secretion protein, HrpO family [Yersinia
          pseudotuberculosis PB1/+]
 gi|229679816|gb|EEO75919.1| putative type III secretion apparatus protein [Yersinia pestis
          Nepal516]
 gi|229690525|gb|EEO82579.1| putative type III secretion apparatus protein [Yersinia pestis
          biovar Orientalis str. India 195]
 gi|229696500|gb|EEO86547.1| putative type III secretion apparatus protein [Yersinia pestis
          biovar Orientalis str. PEXU2]
 gi|229706210|gb|EEO92218.1| putative type III secretion apparatus protein [Yersinia pestis
          Pestoides A]
 gi|270337473|gb|EFA48250.1| type III secretion protein, HrpO family [Yersinia pestis KIM D27]
          Length = 97

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 34/45 (75%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          G++I+ +QALTQIQ+ TL F+ K++AV  TL+++  ++G  + ++
Sbjct: 40 GLVISLVQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNY 84


>gi|115350084|ref|YP_771923.1| flagellar biosynthesis protein FliQ [Burkholderia ambifaria AMMD]
 gi|170698076|ref|ZP_02889157.1| flagellar biosynthetic protein FliQ [Burkholderia ambifaria
          IOP40-10]
 gi|171316886|ref|ZP_02906095.1| flagellar biosynthetic protein FliQ [Burkholderia ambifaria
          MEX-5]
 gi|172059103|ref|YP_001806755.1| flagellar biosynthesis protein FliQ [Burkholderia ambifaria
          MC40-6]
 gi|115280072|gb|ABI85589.1| flagellar biosynthetic protein FliQ [Burkholderia ambifaria AMMD]
 gi|170137037|gb|EDT05284.1| flagellar biosynthetic protein FliQ [Burkholderia ambifaria
          IOP40-10]
 gi|171097967|gb|EDT42785.1| flagellar biosynthetic protein FliQ [Burkholderia ambifaria
          MEX-5]
 gi|171991620|gb|ACB62539.1| flagellar biosynthetic protein FliQ [Burkholderia ambifaria
          MC40-6]
          Length = 90

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 26/34 (76%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          +  QA TQI E TL+F+PK++AV  TL+I+ P++
Sbjct: 36 SLFQAATQINESTLSFIPKLLAVAATLVIAGPWM 69


>gi|134294169|ref|YP_001117904.1| flagellar biosynthesis protein FliQ [Burkholderia vietnamiensis
          G4]
 gi|134137326|gb|ABO53069.1| flagellar biosynthetic protein FliQ [Burkholderia vietnamiensis
          G4]
          Length = 90

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 26/34 (76%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          +  QA TQI E TL+F+PK++AV  TL+I+ P++
Sbjct: 36 SLFQAATQINESTLSFIPKLLAVAATLVIAGPWM 69


>gi|149188096|ref|ZP_01866391.1| flagellar biosynthesis protein Q [Vibrio shilonii AK1]
 gi|148838084|gb|EDL55026.1| flagellar biosynthesis protein Q [Vibrio shilonii AK1]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + LI  A 
Sbjct: 8  ELFRDALWMVLILVCAIVVPSLLVGLVVAIFQAATSINEQTLSFLPRLIVTILALIGFAH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          +    +  F   ++ R+   L
Sbjct: 68 WGTQMMMEFFYEIIERLPQVL 88


>gi|258514016|ref|YP_003190238.1| flagellar biosynthetic protein FliQ [Desulfotomaculum acetoxidans
          DSM 771]
 gi|257777721|gb|ACV61615.1| flagellar biosynthetic protein FliQ [Desulfotomaculum acetoxidans
          DSM 771]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          M +   + +AR A   +L  + P + + + +G++++  QA+TQIQE TL+FVPK
Sbjct: 1  MTQTFAIHMAREAFIMMLILALPPIGAGLLVGLVVSVFQAVTQIQEQTLSFVPK 54


>gi|146305088|ref|YP_001185553.1| HrpO family type III secretion protein [Pseudomonas mendocina
          ymp]
 gi|145573289|gb|ABP82821.1| type III secretion protein, HrpO family [Pseudomonas mendocina
          ymp]
          Length = 87

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 47/83 (56%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G+  + +QAL Q+Q+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLAVAVLVGVTTSLVQALMQMQDQTLPFGLKLAAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F  +    I  S
Sbjct: 62 TGRWIGLELIQFTNMAFDLIARS 84


>gi|170694403|ref|ZP_02885557.1| flagellar biosynthetic protein FliQ [Burkholderia graminis C4D1M]
 gi|170140826|gb|EDT09000.1| flagellar biosynthetic protein FliQ [Burkholderia graminis C4D1M]
          Length = 83

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 32/46 (69%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          QA TQI E TL+F+PK++A+ +T++I+ P++   +  ++   L+ I
Sbjct: 33 QAATQINESTLSFIPKLLAIAVTMVIAGPWMLTTMLDYLRQTLTNI 78


>gi|209695729|ref|YP_002263659.1| flagellar biosynthesis protein FliQ [Aliivibrio salmonicida
          LFI1238]
 gi|208009682|emb|CAQ79981.1| polar flagellar assembly protein FliR [Aliivibrio salmonicida
          LFI1238]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 50/88 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +E+ R A++ +L     ++  ++ +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MTPEMAIELFRGALYMVLIMVCAIIIPSLLIGLVVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L++   ++   +  +   +++R+ + L
Sbjct: 61 SLMLFGHWMTRMLMEYFYELIARMPTIL 88


>gi|91200237|emb|CAJ73281.1| similar to flagellar biosynthetic protein FliQ [Candidatus
          Kuenenia stuttgartiensis]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 22 APVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVL 81
          AP+L  AM +G+ I   QA++ I E TLTF+PK+ AV    +   P++   ++S+   +L
Sbjct: 22 APLLGVAMIVGLAIGIFQAVSSIHEQTLTFLPKVFAVLGMFLFCLPWMLRIMTSYTVNLL 81

Query: 82 SRI 84
            +
Sbjct: 82 GEL 84


>gi|332531134|ref|ZP_08407048.1| flagellar biosynthetic protein FliQ [Hylemonella gracilis ATCC
          19624]
 gi|332039419|gb|EGI75831.1| flagellar biosynthetic protein FliQ [Hylemonella gracilis ATCC
          19624]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VL I + A++ +L  SAP+L + + +G+L++  QA+TQI E TL FVPK++    
Sbjct: 1  MNAEMVLTIGQEALFILLMVSAPLLGAVLLVGLLVSLFQAITQIHEATLAFVPKLVVALA 60

Query: 61 TLIISAPFI 69
              + P++
Sbjct: 61 VFAWAGPWM 69


>gi|152997436|ref|YP_001342271.1| flagellar biosynthetic protein FliQ [Marinomonas sp. MWYL1]
 gi|150838360|gb|ABR72336.1| flagellar biosynthetic protein FliQ [Marinomonas sp. MWYL1]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VL++     + I+     V+  ++ +G++++  QA TQI E TL+F+P++I   +
Sbjct: 1  MNPQVVLDLYGQGFYLIVLIVGVVMVPSLIVGLIVSVFQAATQINEQTLSFLPRLIVTIL 60

Query: 61 TLIISAPFIGGQISSFVT 78
           ++   P+I  ++  F T
Sbjct: 61 VIMQLGPWILMKLMDFTT 78


>gi|254442080|ref|ZP_05055556.1| Bacterial export protein, family 3 [Verrucomicrobiae bacterium
          DG1235]
 gi|198256388|gb|EDY80696.1| Bacterial export protein, family 3 [Verrucomicrobiae bacterium
          DG1235]
          Length = 71

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 22 APVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVL 81
          +P+L + + +G++I+ +Q++T IQE TL+F PK+ AV   LI+ + ++   +  F   V 
Sbjct: 4  SPILITTIVVGLVISLIQSVTSIQEQTLSFAPKLFAVGGVLIVGSSWLLKTLMGFTIEVY 63

Query: 82 SRI 84
           +I
Sbjct: 64 QKI 66


>gi|154173912|ref|YP_001409021.1| flagellar biosynthesis protein FliQ [Campylobacter curvus 525.92]
 gi|112804012|gb|EAU01356.1| flagellar biosynthetic protein FliQ [Campylobacter curvus 525.92]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+L S +  G++I+  QA TQI E TL+FVPKII V + +I   P++   +  F T +
Sbjct: 20 SLPMLLSGLIAGLIISIFQATTQINETTLSFVPKIILVVVVIIFLMPWMVSMMVEFTTRM 79

Query: 81 LSRI 84
          +  I
Sbjct: 80 IDYI 83


>gi|171057714|ref|YP_001790063.1| flagellar biosynthetic protein FliQ [Leptothrix cholodnii SP-6]
 gi|170775159|gb|ACB33298.1| flagellar biosynthetic protein FliQ [Leptothrix cholodnii SP-6]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 48/84 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL   +  +  +L  +AP+L + + +G+ ++  QA TQ+ E TL+FVPK++A   
Sbjct: 1  MDATQVLTHGQEGLGILLMVAAPMLLTVLLVGLTVSIFQAATQLHESTLSFVPKMVAAVT 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           + I+ P++   +  ++  VL  I
Sbjct: 61 VMAIAGPWMLSTLVEYLQRVLQSI 84


>gi|311992341|gb|ADQ26744.1| flagellar export component [Aeromonas hydrophila]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +++ R A+W +      V+  ++ +G+L+A  QA T I E TL+F+P++I     L   A
Sbjct: 6  IDVFREALWLVTIMVCAVILPSLCVGLLVAIFQAATSINEQTLSFLPRLIVTLFALGAGA 65

Query: 67 PFIGGQISSFVTLVLSRI 84
           +    +  F  L++S+I
Sbjct: 66 HWGLQSLMDFFLLMVSQI 83


>gi|22124445|ref|NP_667868.1| type III secretion system component [Yersinia pestis KIM 10]
 gi|153949767|ref|YP_001402767.1| HrpO family type III secretion protein [Yersinia
          pseudotuberculosis IP 31758]
 gi|162419851|ref|YP_001608227.1| HrpO family type III secretion protein [Yersinia pestis Angola]
 gi|167402190|ref|ZP_02307663.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|21957232|gb|AAM84119.1|AE013654_8 putative type III secretion system component [Yersinia pestis KIM
          10]
 gi|152961262|gb|ABS48723.1| type III secretion protein, HrpO family [Yersinia
          pseudotuberculosis IP 31758]
 gi|162352666|gb|ABX86614.1| type III secretion protein, HrpO family [Yersinia pestis Angola]
 gi|167048371|gb|EDR59779.1| type III secretion protein, HrpO family [Yersinia pestis biovar
          Antiqua str. UG05-0454]
          Length = 93

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 34/45 (75%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          G++I+ +QALTQIQ+ TL F+ K++AV  TL+++  ++G  + ++
Sbjct: 36 GLVISLVQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNY 80


>gi|71737453|ref|YP_274732.1| type III secretion component [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|71558006|gb|AAZ37217.1| type III secretion component, putative [Pseudomonas syringae pv.
          phaseolicola 1448A]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQAL QIQ+ TL  V K++AV +
Sbjct: 1  MGQDVFLSLMNKALMTVLLLSAPALVVAIVVGLSVGLLQALPQIQDQTLPQVVKLVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSR 83
           ++   P + GQ++     VL  
Sbjct: 61 VIVFVGPLLAGQVAELGNQVLDN 83


>gi|296135632|ref|YP_003642874.1| flagellar biosynthetic protein FliQ [Thiomonas intermedia K12]
 gi|295795754|gb|ADG30544.1| flagellar biosynthetic protein FliQ [Thiomonas intermedia K12]
          Length = 91

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +  IA+ A+W     + P+L  A+ +G++++ +QA TQ+ E+TL+FVPK++A+ +
Sbjct: 1  MTPETITTIAQQALWVTFLVALPLLGVALVVGLVVSLIQAATQLNEMTLSFVPKVLAMGL 60

Query: 61 TLIISAPFI 69
            +I+ P++
Sbjct: 61 AGVIAGPWM 69


>gi|86157130|ref|YP_463915.1| type III secretion protein HrpO [Anaeromyxobacter dehalogenans
          2CP-C]
 gi|85773641|gb|ABC80478.1| type III secretion protein HrpO [Anaeromyxobacter dehalogenans
          2CP-C]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A +L + R A+  +L  SAP L +A+ +G++   LQA TQ+QE TL  VP+++AV +
Sbjct: 1  MDPA-LLHLGREALLLVLVLSAPPLGAALLVGLVTGVLQAATQVQEQTLAVVPRLVAVVV 59

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           L I+AP+IG +   F    L+
Sbjct: 60 ALAIAAPWIGARAVRFAADCLA 81


>gi|82702485|ref|YP_412051.1| flagellar biosynthesis protein FliQ [Nitrosospira multiformis
          ATCC 25196]
 gi|82410550|gb|ABB74659.1| flagellar biosynthetic protein FliQ [Nitrosospira multiformis
          ATCC 25196]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + + AM   L  SAP+L +A+  G+L++  QA TQI E+TL+F+PK++ +F 
Sbjct: 1  MTPESVMTLGQKAMEVTLMVSAPLLLAALATGLLVSIFQAATQINEMTLSFIPKLVVLFA 60

Query: 61 TLIISAPFI 69
           L+++ P++
Sbjct: 61 MLVLAGPWM 69


>gi|90411034|ref|ZP_01219048.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
 gi|90328247|gb|EAS44558.1| flagellar biosynthesis protein [Photobacterium profundum 3TCK]
          Length = 89

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +EI + A++ +L     ++   + +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MTPEAFVEIFQEALFMVLIMVCAIVVPGLLIGLVVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+     + G +  +   ++ RI
Sbjct: 61 ALMFFGHMMTGMLMDYFFRIIDRI 84


>gi|294339801|emb|CAZ88164.1| Flagellar biosynthetic protein FliQ [Thiomonas sp. 3As]
          Length = 91

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 46/69 (66%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +  IA+ A+W     + P+L  A+ +G++++ +QA TQ+ E+TL+FVPK++A+ +
Sbjct: 1  MTPEAITTIAQQALWVTFLVALPLLGVALVVGLVVSLIQAATQLNEMTLSFVPKVLAMGL 60

Query: 61 TLIISAPFI 69
            +I+ P++
Sbjct: 61 AGVIAGPWM 69


>gi|87119472|ref|ZP_01075369.1| flagellar biosynthetic protein FliQ [Marinomonas sp. MED121]
 gi|86164948|gb|EAQ66216.1| flagellar biosynthetic protein FliQ [Marinomonas sp. MED121]
          Length = 97

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL++   A   I+     V+  ++ +G++++  QA TQI E TLTF+P++I   + +I  
Sbjct: 14 VLDLFGQAFLLIVIMVGAVMVPSLIVGLIVSVFQAATQINEQTLTFLPRLIVTILVIIYL 73

Query: 66 APFIGGQISSFVTLVLSRI 84
           P++  ++  F T +L  I
Sbjct: 74 GPWLLQKLVDFTTQLLIDI 92


>gi|269836608|ref|YP_003318836.1| flagellar biosynthetic protein FliQ [Sphaerobacter thermophilus
          DSM 20745]
 gi|269785871|gb|ACZ38014.1| flagellar biosynthetic protein FliQ [Sphaerobacter thermophilus
          DSM 20745]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 58/82 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  VLE+ R ++ T+L   AP+L +A+ +G++++  QA+TQ+ E TLTFVPK++ +F+
Sbjct: 1  MSEMLVLELTRDSIATLLLVLAPLLLAALVVGLVVSIFQAVTQVNEATLTFVPKMVVMFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           L+++ P++  Q+  F   +L+
Sbjct: 61 VLLVAGPWMADQLVRFTVRLLT 82


>gi|192359213|ref|YP_001982205.1| flagellar biosynthetic protein FliQ [Cellvibrio japonicus
          Ueda107]
 gi|190685378|gb|ACE83056.1| flagellar biosynthetic protein FliQ [Cellvibrio japonicus
          Ueda107]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 50/87 (57%), Gaps = 4/87 (4%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I   A W  +     ++   + +G++++  QA TQI E TL+F+P+++    
Sbjct: 1  MTPEVVMDIFADAFWLTILMLTVIVGPGLIVGLVVSMFQAATQINEQTLSFLPRLLVTIA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          TL+++ P++   ++ F+ L  +R+ S+
Sbjct: 61 TLMVAGPWL---LTRFMDL-FNRLYSA 83


>gi|145298357|ref|YP_001141198.1| flagellar biosynthetic protein FliQ [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|142851129|gb|ABO89450.1| flagellar biosynthetic protein FliQ [Aeromonas salmonicida subsp.
          salmonicida A449]
          Length = 89

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +++ R A+W +      V+  ++ +G+++A  QA T I E TL+F+P++I    
Sbjct: 1  MSPETFVDVFREALWLVTIMVCAVILPSLMIGLVVAIFQAATSINEQTLSFLPRLIVTLF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L   A +    +  F  L++S+I
Sbjct: 61 ALGAGAHWGLQSLMDFFLLMVSQI 84


>gi|157042764|ref|YP_001449235.1| Spa9 [Shigella dysenteriae Sd197]
 gi|187734394|ref|YP_001883217.1| Spa9 [Shigella boydii CDC 3083-94]
 gi|304905|gb|AAA72012.1| InvX [Escherichia coli HB101]
 gi|32307047|gb|AAP79017.1| Spa9 [Shigella flexneri]
 gi|154152387|gb|ABS59871.1| Spa9 [Shigella dysenteriae Sd197]
 gi|187426890|gb|ACD06165.1| Spa9 [Shigella boydii CDC 3083-94]
          Length = 86

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 48/84 (57%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          +D++ +   A++ IL  S   +  A  +G+ I  LQ +TQ+QE TL F  K+I V I+L+
Sbjct: 2  SDIVYMGNKALYLILIFSLWPVGIATVIGLTIGLLQTVTQLQEQTLPFGIKLIGVSISLL 61

Query: 64 ISAPFIGGQISSFVTLVLSRIQSS 87
          + + + G  + SF   ++  I+S 
Sbjct: 62 LLSGWYGEVLLSFCHEIMFLIKSG 85


>gi|51587251|emb|CAE53643.1| putative HrcS [Pseudomonas syringae pv. phaseolicola]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +A  L  A+ +G+L + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTASPLGVAVLVGVLTSLLQALMQIQDQTLPFGIKLGAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++   + +    I  S
Sbjct: 62 TGRWIGVELIQLINMAFDLIARS 84


>gi|207110683|ref|ZP_03244845.1| flagellar biosynthesis protein FliQ [Helicobacter pylori
          HPKX_438_CA4C1]
          Length = 74

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          QA TQI E+TL+FVPKI+AV   LI++ P++   +  +
Sbjct: 33 QATTQINEMTLSFVPKILAVIGVLILTMPWMTNMLLDY 70


>gi|317011552|gb|ADU85299.1| flagellar biosynthesis protein FliQ [Helicobacter pylori
          SouthAfrica7]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E+ ++++A       L  S PVL   + +G+L++  QA TQI E+TL+FVPKI+AV   L
Sbjct: 2  ESQLMKLAIETYKITLMISLPVLLVGLVVGLLVSIFQATTQINEMTLSFVPKILAVIGVL 61

Query: 63 IISAPFIGGQISSF 76
          I++ P++   +  +
Sbjct: 62 ILTMPWMTNMLLDY 75


>gi|119953073|ref|YP_945282.1| flagellar biosynthetic protein FliQ [Borrelia turicatae 91E135]
 gi|119861844|gb|AAX17612.1| flagellar biosynthetic protein FliQ [Borrelia turicatae 91E135]
          Length = 87

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 49/66 (74%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          SAP+L +A+ +G+LI+  QA+T IQ+ TL+F+PKII + +TL+I  P+I  ++  F  +V
Sbjct: 21 SAPMLITALIVGLLISIFQAVTSIQDQTLSFIPKIIIILLTLVIFGPWILKKLMLFAFMV 80

Query: 81 LSRIQS 86
           S+IQ+
Sbjct: 81 FSQIQN 86


>gi|15612379|ref|NP_224032.1| flagellar biosynthesis protein FliQ [Helicobacter pylori J99]
 gi|15646028|ref|NP_208210.1| flagellar biosynthesis protein FliQ [Helicobacter pylori 26695]
 gi|208435289|ref|YP_002266955.1| flagellar biosynthetic protein [Helicobacter pylori G27]
 gi|210135581|ref|YP_002302020.1| flagellar biosynthesis protein FliQ [Helicobacter pylori P12]
 gi|217032109|ref|ZP_03437609.1| hypothetical protein HPB128_16g69 [Helicobacter pylori B128]
 gi|217034566|ref|ZP_03439975.1| hypothetical protein HP9810_874g23 [Helicobacter pylori 98-10]
 gi|254779932|ref|YP_003058039.1| flagellar biosynthesis protein FliQ [Helicobacter pylori B38]
 gi|298735621|ref|YP_003728146.1| flagellar biosynthetic protein FliQ [Helicobacter pylori B8]
 gi|308183512|ref|YP_003927639.1| flagellar biosynthesis protein FliQ [Helicobacter pylori PeCan4]
 gi|60392295|sp|P0A0S3|FLIQ_HELPY RecName: Full=Flagellar biosynthetic protein FliQ
 gi|60392296|sp|P0A0S4|FLIQ_HELPJ RecName: Full=Flagellar biosynthetic protein FliQ
 gi|2314593|gb|AAD08461.1| flagellar biosynthetic protein (fliQ) [Helicobacter pylori 26695]
 gi|2731647|gb|AAB93499.1| membrane protein [Helicobacter pylori]
 gi|4155919|gb|AAD06887.1| FLAGELLAR BIOSYNTHESIS PROTEIN [Helicobacter pylori J99]
 gi|208433218|gb|ACI28089.1| flagellar biosynthetic protein [Helicobacter pylori G27]
 gi|210133549|gb|ACJ08540.1| flagellar biosynthetic protein [Helicobacter pylori P12]
 gi|216942986|gb|EEC22469.1| hypothetical protein HP9810_874g23 [Helicobacter pylori 98-10]
 gi|216946257|gb|EEC24865.1| hypothetical protein HPB128_16g69 [Helicobacter pylori B128]
 gi|254001845|emb|CAX30093.1| Flagellar biosynthesis protein FliQ [Helicobacter pylori B38]
 gi|261838694|gb|ACX98460.1| flagellar biosynthetic protein [Helicobacter pylori 51]
 gi|261840094|gb|ACX99859.1| flagellar biosynthetic protein [Helicobacter pylori 52]
 gi|297380579|gb|ADI35466.1| flagellar biosynthetic protein FliQ [Helicobacter pylori v225d]
 gi|298354810|emb|CBI65682.1| flagellar biosynthetic protein FliQ [Helicobacter pylori B8]
 gi|307638074|gb|ADN80524.1| Flagellar biosynthesis protein [Helicobacter pylori 908]
 gi|308062681|gb|ADO04569.1| flagellar biosynthesis protein FliQ [Helicobacter pylori Cuz20]
 gi|308064173|gb|ADO06060.1| flagellar biosynthesis protein FliQ [Helicobacter pylori Sat464]
 gi|308065697|gb|ADO07589.1| flagellar biosynthesis protein FliQ [Helicobacter pylori PeCan4]
 gi|315585805|gb|ADU40186.1| flagellar biosynthetic protein FliQ [Helicobacter pylori 35A]
 gi|317010212|gb|ADU80792.1| flagellar biosynthesis protein FliQ [Helicobacter pylori India7]
 gi|317013185|gb|ADU83793.1| flagellar biosynthesis protein FliQ [Helicobacter pylori
          Lithuania75]
 gi|317014790|gb|ADU82226.1| flagellar biosynthesis protein FliQ [Helicobacter pylori
          Gambia94/24]
 gi|317178125|dbj|BAJ55914.1| flagellar biosynthesis protein FliQ [Helicobacter pylori F16]
 gi|317179597|dbj|BAJ57385.1| flagellar biosynthesis protein FliQ [Helicobacter pylori F30]
 gi|317181102|dbj|BAJ58888.1| flagellar biosynthesis protein FliQ [Helicobacter pylori F32]
 gi|317182624|dbj|BAJ60408.1| flagellar biosynthesis protein FliQ [Helicobacter pylori F57]
 gi|325996677|gb|ADZ52082.1| Flagellar biosynthesis protein [Helicobacter pylori 2018]
 gi|325998268|gb|ADZ50476.1| Flagellar biosynthesis protein [Helicobacter pylori 2017]
 gi|332674185|gb|AEE71002.1| flagellar biosynthetic protein FliQ [Helicobacter pylori 83]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (63%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E+ ++++A       L  S PVL + + +G+L++  QA TQI E+TL+FVPKI+AV   L
Sbjct: 2  ESQLMKLAIETYKITLMISLPVLLAGLVVGLLVSIFQATTQINEMTLSFVPKILAVIGVL 61

Query: 63 IISAPFIGGQISSF 76
          I++ P++   +  +
Sbjct: 62 ILTMPWMTNMLLDY 75


>gi|108563770|ref|YP_628086.1| flagellar biosynthesis protein FliQ [Helicobacter pylori HPAG1]
 gi|107837543|gb|ABF85412.1| flagellar biosynthetic protein [Helicobacter pylori HPAG1]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (63%)

Query: 3  EADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITL 62
          E+ ++++A       L  S PVL + + +G+L++  QA TQI E+TL+FVPKI+AV   L
Sbjct: 2  ESQLMKLAIETYKITLMISLPVLLAGLVVGLLVSIFQATTQINEMTLSFVPKILAVIGVL 61

Query: 63 IISAPFIGGQISSF 76
          I++ P++   +  +
Sbjct: 62 ILTMPWMTNMLLDY 75


>gi|78485086|ref|YP_391011.1| flagellar biosynthetic protein FliQ [Thiomicrospira crunogena
          XCL-2]
 gi|78363372|gb|ABB41337.1| flagellar biosynthetic protein FliQ [Thiomicrospira crunogena
          XCL-2]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 31/46 (67%)

Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          +G+L+   QA TQI E+TL+F+PK+  V   L+++ P++   + SF
Sbjct: 31 VGLLVGMFQAATQINEMTLSFIPKVAIVGFVLVLAGPWMLTTLVSF 76


>gi|238752884|ref|ZP_04614349.1| Lateral flagellar export/assembly protein (FliQ-like) [Yersinia
          rohdei ATCC 43380]
 gi|238708923|gb|EEQ01176.1| Lateral flagellar export/assembly protein (FliQ-like) [Yersinia
          rohdei ATCC 43380]
          Length = 90

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 1  MNEADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          M  AD+  +I  A +  +L  S   +  ++  G+L++  QA TQI E TL+F+P+++   
Sbjct: 1  MMTADIAGDIIAAGLHLVLIISVVAIIPSLLTGLLVSIFQATTQINEQTLSFLPRLVMTM 60

Query: 60 ITLIISAPFIGGQISSF 76
          + LI +  ++  ++S F
Sbjct: 61 LVLIFAGKWMLTKLSDF 77


>gi|94500291|ref|ZP_01306824.1| flagellar biosynthesis protein [Oceanobacter sp. RED65]
 gi|94427590|gb|EAT12567.1| flagellar biosynthesis protein [Oceanobacter sp. RED65]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 38/62 (61%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +  R A++ ++   + +L   + +G+++A  QA TQI E TL+F+P+++   + ++   P
Sbjct: 8  DFLREALFVVILIVSAILVPGLLVGLIVATFQAATQINEQTLSFLPRLVVTLLCVLFFGP 67

Query: 68 FI 69
          +I
Sbjct: 68 WI 69


>gi|15606961|ref|NP_214343.1| flagellar biosynthesis protein FliQ [Aquifex aeolicus VF5]
 gi|6225368|sp|O67774|FLIQ_AQUAE RecName: Full=Flagellar biosynthetic protein FliQ
 gi|2984201|gb|AAC07731.1| flagellar biosynthesis protein FliQ [Aquifex aeolicus VF5]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 36/58 (62%)

Query: 27 SAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          S   +G++++  QA TQIQE+TL+++PK+I  F+ + +   ++  ++  F   + + I
Sbjct: 27 STFVVGLVVSIFQAATQIQEMTLSYIPKVITAFLVIFLLGGWMMRKLVDFAVEIFANI 84


>gi|167467561|ref|ZP_02332265.1| type III secretion system protein [Yersinia pestis FV-1]
          Length = 333

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 34/45 (75%)

Query: 32  GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
           G++I+ +QALTQIQ+ TL F+ K++AV  TL+++  ++G  + ++
Sbjct: 276 GLVISLVQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNY 320


>gi|188528184|ref|YP_001910871.1| flagellar biosynthesis protein FliQ [Helicobacter pylori Shi470]
 gi|308185179|ref|YP_003929312.1| flagellar biosynthesis protein FliQ [Helicobacter pylori SJM180]
 gi|188144424|gb|ACD48841.1| flagellar biosynthesis protein FliQ [Helicobacter pylori Shi470]
 gi|308061099|gb|ADO02995.1| flagellar biosynthesis protein FliQ [Helicobacter pylori SJM180]
          Length = 83

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          QA TQI E+TL+FVPKI+AV   LI++ P++   +  +
Sbjct: 33 QATTQINEMTLSFVPKILAVIGVLILTMPWMTNMLLDY 70


>gi|285018284|ref|YP_003375995.1| xanthomonas secretion apparatus protein [Xanthomonas albilineans
          GPE PC73]
 gi|283473502|emb|CBA16005.1| probable xanthomonas secretion apparatus protein [Xanthomonas
          albilineans]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          SAP + +A  +GI +   Q +TQ+QE TL F  K+IAV   L++  P++
Sbjct: 19 SAPAIITATIVGIAMGLFQTVTQLQEQTLPFGVKLIAVLACLLLLEPWM 67


>gi|109946731|ref|YP_663959.1| flagellar biosynthesis protein FliQ [Helicobacter acinonychis
          str. Sheeba]
 gi|109713952|emb|CAJ98960.1| flagellar biosynthetic protein [Helicobacter acinonychis str.
          Sheeba]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          QA TQI E+TL+FVPKI+AV   LI++ P++   +  +
Sbjct: 38 QATTQINEMTLSFVPKILAVIGVLILTMPWMTNMLLDY 75


>gi|262276384|ref|ZP_06054193.1| flagellar biosynthesis protein FliQ [Grimontia hollisae CIP
          101886]
 gi|262220192|gb|EEY71508.1| flagellar biosynthesis protein FliQ [Grimontia hollisae CIP
          101886]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          E+ + A++ IL     ++   + +G+L+A  QA T I E TL+F+P++IA  + L++
Sbjct: 8  ELFQDALYLILIMVCAIIIPGLIVGLLVAIFQAATSINEQTLSFLPRLIATLVALMV 64


>gi|13449101|ref|NP_085317.1| Type III secretion protein [Shigella flexneri 5a]
 gi|31983792|ref|NP_858287.1| Spa9, component of the Mxi-Spa secretion machinery [Shigella
          flexneri 2a str. 301]
 gi|157042766|ref|YP_001449233.1| Spa9 [Shigella sonnei Ss046]
 gi|60415915|sp|P0A1M4|SPAQ_SHIFL RecName: Full=Surface presentation of antigens protein SpaQ;
          AltName: Full=Protein spa9
 gi|60415916|sp|P0A1M5|SPAQ_SHISO RecName: Full=Surface presentation of antigens protein SpaQ;
          AltName: Full=Protein spa9
 gi|13310649|gb|AAK18473.1|AF348706_162 Type III secretion protein [Shigella flexneri 5a]
 gi|303894|dbj|BAA02830.1| spa9 [Shigella flexneri]
 gi|12329098|emb|CAC05829.1| Spa9, component of the Mxi-Spa secretion machinery [Shigella
          flexneri]
 gi|18462784|gb|AAL72556.1| Spa9, component of the Mxi-Spa secretion machinery [Shigella
          flexneri 2a str. 301]
 gi|154152389|gb|ABS59873.1| Spa9, component of the Mxi-Spa secretion machinery [Shigella
          sonnei Ss046]
 gi|281603909|gb|ADA76892.1| Spa9, component of the Mxi-Spa secretion machinery [Shigella
          flexneri 2002017]
          Length = 86

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 48/84 (57%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          +D++ +   A++ IL  S   +  A  +G+ I  LQ +TQ+QE TL F  K+I V I+L+
Sbjct: 2  SDIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLQTVTQLQEQTLPFGIKLIGVSISLL 61

Query: 64 ISAPFIGGQISSFVTLVLSRIQSS 87
          + + + G  + SF   ++  I+S 
Sbjct: 62 LLSGWYGEVLLSFCHEIMFLIKSG 85


>gi|23099027|ref|NP_692493.1| flagellar biosynthesis protein FliQ [Oceanobacillus iheyensis
          HTE831]
 gi|22777255|dbj|BAC13528.1| flagellar protein required for flagellar formation
          [Oceanobacillus iheyensis HTE831]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          QA TQIQE TL F+PKIIAV + L+   P++
Sbjct: 39 QATTQIQEQTLAFIPKIIAVLVGLVFFGPWM 69


>gi|258621115|ref|ZP_05716149.1| flagellar biosynthesis protein [Vibrio mimicus VM573]
 gi|258626188|ref|ZP_05721036.1| flagellar biosynthesis protein [Vibrio mimicus VM603]
 gi|261209858|ref|ZP_05924159.1| flagellar biosynthesis protein FliQ [Vibrio sp. RC341]
 gi|262170891|ref|ZP_06038569.1| flagellar biosynthesis protein FliQ [Vibrio mimicus MB-451]
 gi|258581543|gb|EEW06444.1| flagellar biosynthesis protein [Vibrio mimicus VM603]
 gi|258586503|gb|EEW11218.1| flagellar biosynthesis protein [Vibrio mimicus VM573]
 gi|260841044|gb|EEX67569.1| flagellar biosynthesis protein FliQ [Vibrio sp. RC341]
 gi|261891967|gb|EEY37953.1| flagellar biosynthesis protein FliQ [Vibrio mimicus MB-451]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 44/81 (54%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ + ++W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L+    
Sbjct: 8  ELFKESLWLVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIITLLALMFFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMLMDFFYSMIERLPQVL 88


>gi|207091751|ref|ZP_03239538.1| flagellar biosynthesis protein FliQ [Helicobacter pylori
          HPKX_438_AG0C1]
          Length = 83

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          QA TQI E+TL+FVPKI+AV   LI++ P++   +  +
Sbjct: 33 QATTQINEMTLSFVPKILAVIGVLILTMPWMTNMLLDY 70


>gi|163800127|ref|ZP_02194028.1| isopentenyl pyrophosphate isomerase [Vibrio sp. AND4]
 gi|159175570|gb|EDP60364.1| isopentenyl pyrophosphate isomerase [Vibrio sp. AND4]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQ 72
          A+W I+S  A ++   + +G+ IA  QA TQI E TL+F+P+++   + +I +  ++  +
Sbjct: 13 AVWLIISMVAVLVVPGLIVGLCIAVFQAATQINEQTLSFLPRLLVTLLMVIFAGHWMLRK 72

Query: 73 ISSFVTLVLSRI 84
          I      +   I
Sbjct: 73 IMELFDFLFHNI 84


>gi|170738278|ref|YP_001779538.1| HrpO family type III secretion protein [Burkholderia cenocepacia
          MC0-3]
 gi|169820466|gb|ACA95048.1| type III secretion protein, HrpO family [Burkholderia cenocepacia
          MC0-3]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   ++ +    +   L  S P +  +   G+++AFLQA+T +Q+ T++   K+ AV  
Sbjct: 1  MNTDTLIGLTSQGLLLCLYISLPAIIVSALSGLIVAFLQAITSLQDQTISHSVKLFAVIG 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
          TL+++A + G  I  F   +LS
Sbjct: 61 TLLLTAGWGGTTILRFALRLLS 82


>gi|262404468|ref|ZP_06081023.1| flagellar biosynthesis protein FliQ [Vibrio sp. RC586]
 gi|262349500|gb|EEY98638.1| flagellar biosynthesis protein FliQ [Vibrio sp. RC586]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 44/81 (54%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ + ++W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L+    
Sbjct: 8  ELFKDSLWLVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPRLIITLLALMFFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMLMDFFYSMIERLPQVL 88


>gi|332162919|ref|YP_004299496.1| Lateral flagellar export/assembly protein [Yersinia
          enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667149|gb|ADZ43793.1| Lateral flagellar export/assembly protein [Yersinia
          enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862336|emb|CBX72496.1| flagellar biosynthetic protein fliQ [Yersinia enterocolitica
          W22703]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 40/69 (57%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I  A +  +L  S   +  ++  G+L++  QA TQI E TL+F+P+++   + LI +  
Sbjct: 9  DIIAAGLHLVLIISVVAIIPSLLTGLLVSIFQATTQINEQTLSFLPRLVMTMLVLIFAGK 68

Query: 68 FIGGQISSF 76
          ++  ++S F
Sbjct: 69 WMMTKLSDF 77


>gi|254456846|ref|ZP_05070274.1| flagellar biosynthetic protein FliQ [Campylobacterales bacterium
          GD 1]
 gi|207085638|gb|EDZ62922.1| flagellar biosynthetic protein FliQ [Campylobacterales bacterium
          GD 1]
          Length = 88

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 38/56 (67%)

Query: 27 SAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLS 82
          + M +G+ ++  QA TQI E+TL+F+PKII V I +I++ P++   ++ F T + +
Sbjct: 26 TGMLVGLAVSIFQATTQINEMTLSFIPKIIGVVIVIILTMPWMLNSMTDFATNIFN 81


>gi|152985438|ref|YP_001349234.1| flagellar biosynthesis protein FliQ [Pseudomonas aeruginosa PA7]
 gi|150960596|gb|ABR82621.1| flagellar biosynthetic protein FliQ [Pseudomonas aeruginosa PA7]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 48/78 (61%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L++ R A+W      A ++  ++ +G+++A  QA TQI E TL+F+P+++ + +TLI+  
Sbjct: 7  LDLFREALWLTAMIVAVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVILLTLIVLG 66

Query: 67 PFIGGQISSFVTLVLSRI 84
          P++  Q+  +   ++  I
Sbjct: 67 PWLLRQLMEYTQALIGNI 84


>gi|59712448|ref|YP_205224.1| flagellar biosynthesis protein FliQ [Vibrio fischeri ES114]
 gi|197336221|ref|YP_002156667.1| flagellar biosynthetic protein FliQ [Vibrio fischeri MJ11]
 gi|59480549|gb|AAW86336.1| flagellar biosynthesis protein FliQ [Vibrio fischeri ES114]
 gi|197317711|gb|ACH67158.1| flagellar biosynthetic protein FliQ [Vibrio fischeri MJ11]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A++ +L     ++  ++ +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MTPEMAIDLFRGALYMVLIMVCAIIIPSLLIGLVVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++   ++   +  +   +++R+ + L
Sbjct: 61 ALMLFGHWMTRMLMEYFYELIARMPTVL 88


>gi|332284031|ref|YP_004415942.1| flagellar biosynthetic protein FliQ [Pusillimonas sp. T7-7]
 gi|330427984|gb|AEC19318.1| flagellar biosynthetic protein FliQ [Pusillimonas sp. T7-7]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P+L   + +G++I+  QA TQI E+TL+F+PK++AV  
Sbjct: 1  MTSETVMSMTYLAMKVALIMAGPLLLVTLVVGLVISIFQAATQINEMTLSFIPKLLAVGA 60

Query: 61 TLIISAPFI 69
           L++  P++
Sbjct: 61 ALVLLGPWL 69


>gi|325981180|ref|YP_004293582.1| flagellar biosynthetic protein FliQ [Nitrosomonas sp. AL212]
 gi|325530699|gb|ADZ25420.1| flagellar biosynthetic protein FliQ [Nitrosomonas sp. AL212]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 28/35 (80%)

Query: 35 IAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          ++  QA TQI E+TL+F+PK++ +F+ ++++ P++
Sbjct: 35 VSIFQAATQINEMTLSFIPKLLVMFLVMVLAGPWM 69


>gi|171316781|ref|ZP_02905992.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MEX-5]
 gi|171098039|gb|EDT42855.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MEX-5]
          Length = 87

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          S P++  A  +G+  +FLQA+T IQ+ TL+   K+IA  + ++I+AP
Sbjct: 21 SLPIVAVAALVGLATSFLQAVTSIQDQTLSHAVKLIAATVAVMITAP 67


>gi|54308126|ref|YP_129146.1| flagellar biosynthesis protein FliQ [Photobacterium profundum
          SS9]
 gi|46912552|emb|CAG19344.1| Putative polar flagellar assembly protein, FliQ [Photobacterium
          profundum SS9]
          Length = 89

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          EI + A+  +L     ++   + +G+++A  QA T I E TL+F+P++I   + L+    
Sbjct: 8  EIFQEALLMVLIMVCAIVVPGLLIGLVVAVFQAATSINEQTLSFLPRLIVTLLALMFFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
           + G +  +   ++ RI   L
Sbjct: 68 MMTGMLMDYFFRIIDRIPQLL 88


>gi|153949888|ref|YP_001399617.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          IP 31758]
 gi|152961383|gb|ABS48844.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          IP 31758]
          Length = 90

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 33/49 (67%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          ++ +G+L++  QA TQI E TL+F+P+++   + LI +  ++  ++S F
Sbjct: 29 SLLIGLLVSIFQATTQINEQTLSFLPRLVMTMLVLIFAGKWMMTKLSDF 77


>gi|187478199|ref|YP_786223.1| flagellar biosynthetic protein FliQ [Bordetella avium 197N]
 gi|115422785|emb|CAJ49313.1| flagellar biosynthetic protein FliQ [Bordetella avium 197N]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 50/84 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  AM   L  + P+L   + +G++I+  QA TQI E+TL+F+PK++A+  
Sbjct: 1  MTAEAVMTMAYQAMKIALVLAGPLLLVTLVVGLVISVFQAATQINEMTLSFIPKLLAMCG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++   +  ++  ++S I
Sbjct: 61 VLVLLGPWLIELLVDYIRQLISNI 84


>gi|254491665|ref|ZP_05104844.1| Bacterial export protein, family 3 [Methylophaga thiooxidans
          DMS010]
 gi|224463143|gb|EEF79413.1| Bacterial export protein, family 3 [Methylophaga thiooxydans
          DMS010]
          Length = 80

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 34/55 (61%)

Query: 22 APVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          A +L  A+ +G++++  QA T I E TLTF+PK+    + LI + P++   + SF
Sbjct: 13 AMILLPALGIGLIVSMFQAATSINEQTLTFIPKLFITILVLIFAGPWMLSMLLSF 67


>gi|217077268|ref|YP_002334986.1| flagellar biosynthetic protein FliQ [Thermosipho africanus
          TCF52B]
 gi|217037123|gb|ACJ75645.1| flagellar biosynthetic protein FliQ [Thermosipho africanus
          TCF52B]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKII 56
          L++    + T+L+   P L  ++ +G+LI+  QA TQI E TLTF P+II
Sbjct: 7  LDVFGLGIKTLLTVILPPLLISLIVGLLISIFQAATQINEQTLTFAPRII 56


>gi|220903657|ref|YP_002478969.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          subsp. desulfuricans str. ATCC 27774]
 gi|219867956|gb|ACL48291.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          subsp. desulfuricans str. ATCC 27774]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 37/54 (68%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVF 59
          V+   R A+   L  + P+L   + +G++++ +QA TQIQE+TLTF+PKI+ +F
Sbjct: 6  VIGFGRQAIELCLMMALPMLGVGLGVGVIVSVIQAATQIQEMTLTFIPKIVCMF 59


>gi|89899372|ref|YP_521843.1| flagellar biosynthetic protein FliQ [Rhodoferax ferrireducens
          T118]
 gi|89344109|gb|ABD68312.1| flagellar biosynthetic protein FliQ [Rhodoferax ferrireducens
          T118]
          Length = 85

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%)

Query: 6  VLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIIS 65
          VL + + A+  +L  SAPVL   + +G+L++  QA+TQI E TL FVPK++A      ++
Sbjct: 2  VLTMGQEALIMLLMVSAPVLGVVLVVGLLVSLFQAVTQINEATLAFVPKLVAAMAVFALA 61

Query: 66 APFI 69
           P++
Sbjct: 62 GPWM 65


>gi|229524124|ref|ZP_04413529.1| flagellar biosynthesis protein FliQ [Vibrio cholerae bv. albensis
          VL426]
 gi|229337705|gb|EEO02722.1| flagellar biosynthesis protein FliQ [Vibrio cholerae bv. albensis
          VL426]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 44/81 (54%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ + ++W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L+    
Sbjct: 8  ELFKESLWLVLIMVCAIIIPSLLVGLVVAIFQAATSINEQTLSFLPRLIITLLALMFFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQMLMDFFYSMVERLPQVL 88


>gi|116514992|ref|YP_802621.1| hypothetical protein BCc_049 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
 gi|116256846|gb|ABJ90528.1| type III protein export, membrane component [Buchnera aphidicola
          str. Cc (Cinara cedri)]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 48/69 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  ++ + + ++  +   S P L   + +GILI+FLQ++TQI E TL+F+PKI+++F+
Sbjct: 1  MNQEFLITLFQDSIKFVFLISVPCLIPILLIGILISFLQSITQIHEQTLSFIPKILSIFL 60

Query: 61 TLIISAPFI 69
          +LI   P++
Sbjct: 61 SLIFFGPWM 69


>gi|74101641|gb|AAZ99731.1| FliQL [Aeromonas hydrophila]
          Length = 93

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 34/48 (70%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
          ++ +G++++  QA TQIQE TL+F+P+ +   +TLI +  ++  QI++
Sbjct: 32 SLIVGLVVSVFQAATQIQEQTLSFLPRFLVTLMTLIFTGNWLLSQITT 79


>gi|89072285|ref|ZP_01158864.1| flagellar biosynthetic protein [Photobacterium sp. SKA34]
 gi|330447936|ref|ZP_08311584.1| flagellar biosynthetic protein FliQ [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
 gi|89051817|gb|EAR57269.1| flagellar biosynthetic protein [Photobacterium sp. SKA34]
 gi|328492127|dbj|GAA06081.1| flagellar biosynthetic protein FliQ [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A+W I++    ++   + +G++IA  QA TQI E TL+F+P++I   + +I +  ++
Sbjct: 13 AVWIIINMVMVLVIPGLLVGLVIAVFQAATQINEQTLSFLPRLIMTLLMVIFAGHWM 69


>gi|238755992|ref|ZP_04617317.1| Surface presentation of antigens protein spaQ [Yersinia ruckeri
          ATCC 29473]
 gi|238705781|gb|EEP98173.1| Surface presentation of antigens protein spaQ [Yersinia ruckeri
          ATCC 29473]
          Length = 87

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +A +  ++ S+ PVL  A  +G+ +  +Q +TQ+QE TL F  K++AVF +L + + ++ 
Sbjct: 10 KAMLLIVVLSAIPVLV-ATVVGLFVGLIQTVTQLQEQTLPFGLKLLAVFGSLFMISGWLS 68

Query: 71 GQISSFVTLVLS 82
           ++ S+   VLS
Sbjct: 69 DKVMSYAMEVLS 80


>gi|167915627|ref|ZP_02502718.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 112]
          Length = 87

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  MEIDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 T 61
          T
Sbjct: 61 T 61


>gi|145297438|ref|YP_001140279.1| lateral flagellar biosynthetic protein, LfiQ [Aeromonas
          salmonicida subsp. salmonicida A449]
 gi|142850210|gb|ABO88531.1| lateral flagellar biosynthetic protein, LfiQ [Aeromonas
          salmonicida subsp. salmonicida A449]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 34/48 (70%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
          ++ +G++++  QA TQIQE TL+F+P+ +   +TLI +  ++  QI++
Sbjct: 28 SLIVGLVVSVFQAATQIQEQTLSFLPRFLVTLMTLIFTGNWLLSQITT 75


>gi|90577374|ref|ZP_01233185.1| flagellar biosynthetic protein [Vibrio angustum S14]
 gi|90440460|gb|EAS65640.1| flagellar biosynthetic protein [Vibrio angustum S14]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A+W I++    ++   + +G++IA  QA TQI E TL+F+P++I   + +I +  ++
Sbjct: 13 AVWLIINMVMVLVIPGLLVGLVIAVFQAATQINEQTLSFLPRLIMTLLMVIFAGHWM 69


>gi|115360605|ref|YP_777742.1| HrpO family type III secretion protein [Burkholderia ambifaria
          AMMD]
 gi|115285933|gb|ABI91408.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          AMMD]
          Length = 87

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 3  EADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          E D L  I    +   LS S PV+  A   G+ I+F+QA+T +Q+ ++++  K++AV  T
Sbjct: 2  ETDTLVRITSQGLLLCLSVSMPVVAVAALSGLAISFVQAITSMQDQSISYAVKLVAVVAT 61

Query: 62 LIISAPFIGGQISSFVTLVLS 82
          ++I+  +    I  F   +++
Sbjct: 62 VLITGAWGAAAILRFANQIIT 82


>gi|307131231|ref|YP_003883247.1| type III secretion inner membrane protein [Dickeya dadantii 3937]
 gi|306528760|gb|ADM98690.1| type III secretion inner membrane protein [Dickeya dadantii 3937]
          Length = 86

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 50/83 (60%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 2  ETLNLFRQAMVLVVMLSAPPLLVAVVVGVLISLLQAVMQLQDQTLPFAVKLVAVGLVLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++     L  + I+ +
Sbjct: 62 TGRWIGVELIQLAMLAFNMIEQT 84


>gi|163801856|ref|ZP_02195753.1| flagellar biosynthesis protein Q [Vibrio sp. AND4]
 gi|159174364|gb|EDP59168.1| flagellar biosynthesis protein Q [Vibrio sp. AND4]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 30/47 (63%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          E+ R A+W +L     ++  ++ +G+++A  QA T I E TL+F+P+
Sbjct: 8  ELFRDALWMVLIMVCAIIIPSLLIGLVVAIFQAATSINEQTLSFLPR 54


>gi|284007674|emb|CBA73395.1| type III secretion sytem SpaQ [Arsenophonus nasoniae]
          Length = 61

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%)

Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          +G++I  LQ +TQIQE TL F  K++AVFI L++
Sbjct: 28 IGLIIGLLQTVTQIQEQTLPFGLKLVAVFICLLM 61


>gi|103488402|ref|YP_617963.1| flagellar biosynthetic protein FliQ [Sphingopyxis alaskensis
          RB2256]
 gi|98978479|gb|ABF54630.1| flagellar biosynthetic protein FliQ [Sphingopyxis alaskensis
          RB2256]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          +A+ ++W +  +SAP+L   + +G+L+  +QA T I E TLTFVPK+I   I L I    
Sbjct: 9  MAQQSLWILALASAPLLLPVLIVGVLLGMVQAATSINEQTLTFVPKLIVAAICLAI---- 64

Query: 69 IGGQI 73
           GG I
Sbjct: 65 FGGSI 69


>gi|88858097|ref|ZP_01132739.1| flagellar biosynthesis [Pseudoalteromonas tunicata D2]
 gi|88819714|gb|EAR29527.1| flagellar biosynthesis [Pseudoalteromonas tunicata D2]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          I   A++ ++   A ++  ++ +G++++  QA T I E TL+F+P++I     LII A +
Sbjct: 9  ILSNALFLVIKLVAAIIVPSLIVGLIVSVFQAATSINEQTLSFLPRLIVTLFALIIGAHW 68

Query: 69 IGGQISSFVT-LVLS 82
          +  ++  F T LV+S
Sbjct: 69 LTQELMDFFTGLVMS 83


>gi|330879021|gb|EGH13170.1| type III secretion component [Pseudomonas syringae pv. glycinea
          str. race 4]
          Length = 67

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTL 49
          M +   L +   A+ T+L  SAP L  A+ +G+ +  LQALTQIQ+ TL
Sbjct: 1  MGQDVFLSLMNKALMTVLLLSAPALVVAIVVGLSVGLLQALTQIQDQTL 49


>gi|113969636|ref|YP_733429.1| flagellar biosynthetic protein FliQ [Shewanella sp. MR-4]
 gi|114046866|ref|YP_737416.1| flagellar biosynthetic protein FliQ [Shewanella sp. MR-7]
 gi|117919801|ref|YP_868993.1| flagellar biosynthetic protein FliQ [Shewanella sp. ANA-3]
 gi|113884320|gb|ABI38372.1| flagellar biosynthetic protein FliQ [Shewanella sp. MR-4]
 gi|113888308|gb|ABI42359.1| flagellar biosynthetic protein FliQ [Shewanella sp. MR-7]
 gi|117612133|gb|ABK47587.1| flagellar biosynthetic protein FliQ [Shewanella sp. ANA-3]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 47/84 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +++I R A+  I+   + ++   + +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MTPEALIDIFREALAVIVMMVSAIVLPGLGIGLIVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++   ++   +  F   +++RI
Sbjct: 61 ALMVMGHWLVQTLMDFFIEMVNRI 84


>gi|188534809|ref|YP_001908606.1| Type III secretion apparatus [Erwinia tasmaniensis Et1/99]
 gi|188029851|emb|CAO97732.1| Type III secretion apparatus [Erwinia tasmaniensis Et1/99]
          Length = 84

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 44/77 (57%)

Query: 4  ADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          +++L I  +A+  +L  +A  +  A  +GI++   Q + QIQE TL F  K++AVF ++ 
Sbjct: 2  SNILFIGNSALILVLKLTAVPIACATIVGIIVGLFQTVMQIQEQTLPFGLKMLAVFASIF 61

Query: 64 ISAPFIGGQISSFVTLV 80
          I   +   ++ +F T V
Sbjct: 62 ILIEWFSAEMMNFATHV 78


>gi|91795012|ref|YP_564663.1| export protein FliQ [Shewanella denitrificans OS217]
 gi|91717014|gb|ABE56940.1| export protein FliQ, family 3 [Shewanella denitrificans OS217]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 43/75 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  ++  I   AM+ ++     ++   + LG++IA  QA TQ+ E TL+F+PK+I   +
Sbjct: 1  MDTNELTVIFADAMYLVIIMVGVLITPGLILGVVIAVFQAATQVNEQTLSFLPKLILTLL 60

Query: 61 TLIISAPFIGGQISS 75
           ++ S  ++  ++S 
Sbjct: 61 MVLFSGSWLIQKLSD 75


>gi|168704085|ref|ZP_02736362.1| hypothetical protein GobsU_31414 [Gemmata obscuriglobus UQM 2246]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 39/68 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + +      L  + P L  ++ +G+L++  Q +T IQ+ TL++VP+II V +
Sbjct: 1  MTAEHVIRMTQELFLVALVVALPALVISLAVGLLVSIFQTVTSIQDQTLSYVPRIILVGL 60

Query: 61 TLIISAPF 68
           L+++  F
Sbjct: 61 ALVVTLGF 68


>gi|212711700|ref|ZP_03319828.1| hypothetical protein PROVALCAL_02775 [Providencia alcalifaciens
          DSM 30120]
 gi|212685802|gb|EEB45330.1| hypothetical protein PROVALCAL_02775 [Providencia alcalifaciens
          DSM 30120]
          Length = 90

 Score = 37.0 bits (84), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +A +  ++ S+ PV+  A  +G+L+  LQ +TQ+QE TL F  K++AVF +L + + ++ 
Sbjct: 10 KAMLLIVILSAIPVIV-ATVVGVLVGLLQTVTQLQEQTLPFGIKLLAVFGSLFMISGWLA 68

Query: 71 GQISSF 76
           ++ ++
Sbjct: 69 DKVMNY 74


>gi|218927895|ref|YP_002345770.1| putative flagellar assembly protein [Yersinia pestis CO92]
 gi|115346506|emb|CAL19382.1| putative flagellar assembly protein [Yersinia pestis CO92]
          Length = 89

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 33/49 (67%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          ++ +G+L++  QA TQI E TL+F+P+++   + LI +  ++  ++S F
Sbjct: 28 SLLIGLLVSIFQATTQINEQTLSFLPRLVMTMLVLIFAGKWMMIKLSDF 76


>gi|22127345|ref|NP_670768.1| hypothetical protein y3470 [Yersinia pestis KIM 10]
 gi|45442779|ref|NP_994318.1| flagellar biosynthesis/type III secretory pathway protein
          [Yersinia pestis biovar Microtus str. 91001]
 gi|51597654|ref|YP_071845.1| flagellar assembly/export protein, fliQ [Yersinia
          pseudotuberculosis IP 32953]
 gi|108809076|ref|YP_652992.1| putative flagellar assembly protein [Yersinia pestis Antiqua]
 gi|108810731|ref|YP_646498.1| flagellar assembly protein [Yersinia pestis Nepal516]
 gi|145597800|ref|YP_001161876.1| flagellar assembly protein [Yersinia pestis Pestoides F]
 gi|150260266|ref|ZP_01916994.1| lateral flagellar export and assembly protein [Yersinia pestis
          CA88-4125]
 gi|162419711|ref|YP_001604862.1| flagellar biosynthetic protein FliQ [Yersinia pestis Angola]
 gi|165924852|ref|ZP_02220684.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165939032|ref|ZP_02227584.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166008751|ref|ZP_02229649.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166211991|ref|ZP_02238026.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167399325|ref|ZP_02304849.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167419024|ref|ZP_02310777.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167425099|ref|ZP_02316852.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167466358|ref|ZP_02331062.1| putative flagellar assembly protein [Yersinia pestis FV-1]
 gi|170022954|ref|YP_001719459.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          YPIII]
 gi|186896788|ref|YP_001873900.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          PB1/+]
 gi|229837391|ref|ZP_04457554.1| Flagellar biosynthesis protein fliQ [Yersinia pestis Pestoides A]
 gi|229840604|ref|ZP_04460763.1| Flagellar biosynthesis protein fliQ [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229842845|ref|ZP_04462997.1| Flagellar biosynthesis protein fliQ [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229900928|ref|ZP_04516052.1| Flagellar biosynthesis protein fliQ [Yersinia pestis Nepal516]
 gi|270487691|ref|ZP_06204765.1| flagellar biosynthetic protein FliQ [Yersinia pestis KIM D27]
 gi|21960428|gb|AAM87019.1|AE013950_4 hypothetical [Yersinia pestis KIM 10]
 gi|45437645|gb|AAS63195.1| Flagellar biosynthesis/type III secretory pathway protein
          [Yersinia pestis biovar Microtus str. 91001]
 gi|51590936|emb|CAH22592.1| Putative flagellar assembly/export protein, fliQ [Yersinia
          pseudotuberculosis IP 32953]
 gi|108774379|gb|ABG16898.1| flagellar assembly protein [Yersinia pestis Nepal516]
 gi|108780989|gb|ABG15047.1| putative flagellar assembly protein [Yersinia pestis Antiqua]
 gi|145209496|gb|ABP38903.1| flagellar assembly protein [Yersinia pestis Pestoides F]
 gi|149289674|gb|EDM39751.1| lateral flagellar export and assembly protein [Yersinia pestis
          CA88-4125]
 gi|162352526|gb|ABX86474.1| flagellar biosynthetic protein FliQ [Yersinia pestis Angola]
 gi|165912988|gb|EDR31613.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165923052|gb|EDR40203.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165992090|gb|EDR44391.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166206737|gb|EDR51217.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166963018|gb|EDR59039.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167051829|gb|EDR63237.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167055862|gb|EDR65643.1| flagellar biosynthetic protein FliQ [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169749488|gb|ACA67006.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          YPIII]
 gi|186699814|gb|ACC90443.1| flagellar biosynthetic protein FliQ [Yersinia pseudotuberculosis
          PB1/+]
 gi|229682267|gb|EEO78359.1| Flagellar biosynthesis protein fliQ [Yersinia pestis Nepal516]
 gi|229690112|gb|EEO82169.1| Flagellar biosynthesis protein fliQ [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229696970|gb|EEO87017.1| Flagellar biosynthesis protein fliQ [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229705514|gb|EEO91524.1| Flagellar biosynthesis protein fliQ [Yersinia pestis Pestoides A]
 gi|270336195|gb|EFA46972.1| flagellar biosynthetic protein FliQ [Yersinia pestis KIM D27]
 gi|320016728|gb|ADW00300.1| Flagellar biosynthesis protein fliQ [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 90

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 33/49 (67%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          ++ +G+L++  QA TQI E TL+F+P+++   + LI +  ++  ++S F
Sbjct: 29 SLLIGLLVSIFQATTQINEQTLSFLPRLVMTMLVLIFAGKWMMIKLSDF 77


>gi|149908779|ref|ZP_01897439.1| flagellar biosynthetic protein [Moritella sp. PE36]
 gi|149808053|gb|EDM67994.1| flagellar biosynthetic protein [Moritella sp. PE36]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 44/76 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   A+ TI++  + ++   + +G++++  QA TQIQE TL+F+PK+I   +
Sbjct: 1  MTPEQVVSLMGLAVNTIIAMVSVLVIPGLVVGLIVSVFQAATQIQEQTLSFLPKLIVTLL 60

Query: 61 TLIISAPFIGGQISSF 76
           +  +  ++  Q+ + 
Sbjct: 61 MVTFAGHWLLAQVKAL 76


>gi|238762377|ref|ZP_04623348.1| Lateral flagellar export/assembly protein (FliQ-like) [Yersinia
          kristensenii ATCC 33638]
 gi|238699362|gb|EEP92108.1| Lateral flagellar export/assembly protein (FliQ-like) [Yersinia
          kristensenii ATCC 33638]
          Length = 90

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          G+L++  QA TQI E TL+F+P+++   + LI +  ++  ++S F
Sbjct: 33 GLLVSIFQATTQINEQTLSFLPRLVMTMLVLIFAGKWMMTKLSDF 77


>gi|157376187|ref|YP_001474787.1| flagellar biosynthetic protein FliQ [Shewanella sediminis
          HAW-EB3]
 gi|157318561|gb|ABV37659.1| flagellar biosynthetic protein FliQ [Shewanella sediminis
          HAW-EB3]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 38/63 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   +++I R A+  I++  + ++   + +G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MNPESLVDIFREALTVIVTIVSLIIVPGLIIGLVVAVFQAATSINEQTLSFLPRLLTTLF 60

Query: 61 TLI 63
           L+
Sbjct: 61 ALM 63


>gi|222833216|gb|EEE71693.1| predicted protein [Populus trichocarpa]
          Length = 314

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 23 PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQIS 74
          PVL   + +G+ ++  QA+TQ+ E TL FVPK+I+  +   I+    GG +S
Sbjct: 2  PVLGVVLAVGLAVSVFQAVTQVHEATLAFVPKLISAVLVFAIA----GGGLS 49


>gi|194292011|ref|YP_002007918.1| scts: non flagellar t3S system conserved transmembrane protein.
          belongs to the fliq/mopd/spaq family. [Cupriavidus
          taiwanensis LMG 19424]
 gi|193225915|emb|CAQ71862.1| SctS: non flagellar T3S system conserved transmembrane protein.
          Belongs to the fliQ/mopD/spaQ family [Cupriavidus
          taiwanensis LMG 19424]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 37/61 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +L+I R A+  +L  + PV+     + +++A LQA+TQIQ+ ++    ++IAV +
Sbjct: 1  MGADTILDITRQALLVVLWVTLPVVLIGTLVALVVAVLQAVTQIQDQSIGTSARLIAVLV 60

Query: 61 T 61
          +
Sbjct: 61 S 61


>gi|56460297|ref|YP_155578.1| flagellar biosynthesis protein FliQ [Idiomarina loihiensis L2TR]
 gi|56179307|gb|AAV82029.1| Flagellar biosynthesis protein FliQ [Idiomarina loihiensis L2TR]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          L+I + A+ TI+   A ++   + +G+++A  QA T I E TL+F+P+++     + +  
Sbjct: 7  LDIFQEALKTIVIMVAFIIIPGLLVGLVVAVFQAATSINEQTLSFLPRLLVTLAVIGLGG 66

Query: 67 PFIGGQISSFVTLVLSRI 84
           F+   +  F   + +RI
Sbjct: 67 HFLTETVMDFTIEMFNRI 84


>gi|24374729|ref|NP_718772.1| flagellar biosynthetic protein FliQ [Shewanella oneidensis MR-1]
 gi|24349389|gb|AAN56216.1|AE015759_8 flagellar biosynthetic protein FliQ [Shewanella oneidensis MR-1]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 47/84 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +++I R A+  I+   + ++   + +G+++A  QA T I E TL+F+P++I   +
Sbjct: 1  MTPEALIDIFREALAVIVMMVSAIVLPGLGIGLIVAVFQAATSINEQTLSFLPRLIVTLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++   ++   +  F   +++RI
Sbjct: 61 ALMLMGHWLVQTLMDFFIEMVNRI 84


>gi|183600581|ref|ZP_02962074.1| hypothetical protein PROSTU_04167 [Providencia stuartii ATCC
          25827]
 gi|188019858|gb|EDU57898.1| hypothetical protein PROSTU_04167 [Providencia stuartii ATCC
          25827]
          Length = 90

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +A +  ++ S+ PV+  A  +G+L+  +Q +TQ+QE TL F  K++AVF +L + + ++ 
Sbjct: 10 KAMLLIVMLSAIPVIV-ATVVGLLVGLIQTVTQLQEQTLPFGIKLLAVFGSLFMISGWLA 68

Query: 71 GQISSFVTLVLS 82
           ++ ++   VL+
Sbjct: 69 DKVMNYALEVLT 80


>gi|315126006|ref|YP_004068009.1| flagellar biosynthetic protein FliQ [Pseudoalteromonas sp.
          SM9913]
 gi|315014520|gb|ADT67858.1| flagellar biosynthetic protein FliQ [Pseudoalteromonas sp.
          SM9913]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 39/62 (62%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+  +A++TI+     ++   + LGI++A +Q  T IQE TLTF+P+++   + ++ +  
Sbjct: 8  ELISSAVYTIIKLILVLIVPGLLLGIVVAIIQGATSIQEQTLTFLPRMLLTLLMVVFAGH 67

Query: 68 FI 69
          ++
Sbjct: 68 WM 69


>gi|15642121|ref|NP_231753.1| flagellar biosynthesis protein FliQ [Vibrio cholerae O1 biovar El
          Tor str. N16961]
 gi|121586789|ref|ZP_01676571.1| flagellar biosynthetic protein FliQ [Vibrio cholerae 2740-80]
 gi|121727200|ref|ZP_01680367.1| flagellar biosynthetic protein FliQ [Vibrio cholerae V52]
 gi|147674176|ref|YP_001217643.1| flagellar biosynthesis protein FliQ [Vibrio cholerae O395]
 gi|153213236|ref|ZP_01948648.1| flagellar biosynthetic protein FliQ [Vibrio cholerae 1587]
 gi|153803033|ref|ZP_01957619.1| flagellar biosynthetic protein FliQ [Vibrio cholerae MZO-3]
 gi|153818983|ref|ZP_01971650.1| flagellar biosynthetic protein FliQ [Vibrio cholerae NCTC 8457]
 gi|153822895|ref|ZP_01975562.1| flagellar biosynthetic protein FliQ [Vibrio cholerae B33]
 gi|153825582|ref|ZP_01978249.1| flagellar biosynthetic protein FliQ [Vibrio cholerae MZO-2]
 gi|153828603|ref|ZP_01981270.1| flagellar biosynthetic protein FliQ [Vibrio cholerae 623-39]
 gi|227082247|ref|YP_002810798.1| flagellar biosynthetic protein FliQ [Vibrio cholerae M66-2]
 gi|229507793|ref|ZP_04397298.1| flagellar biosynthesis protein FliQ [Vibrio cholerae BX 330286]
 gi|229511970|ref|ZP_04401449.1| flagellar biosynthesis protein FliQ [Vibrio cholerae B33]
 gi|229513773|ref|ZP_04403235.1| flagellar biosynthesis protein FliQ [Vibrio cholerae TMA 21]
 gi|229519106|ref|ZP_04408549.1| flagellar biosynthesis protein FliQ [Vibrio cholerae RC9]
 gi|229522075|ref|ZP_04411492.1| flagellar biosynthesis protein FliQ [Vibrio cholerae TM 11079-80]
 gi|229528866|ref|ZP_04418256.1| flagellar biosynthesis protein FliQ [Vibrio cholerae 12129(1)]
 gi|229607338|ref|YP_002877986.1| flagellar biosynthesis protein FliQ [Vibrio cholerae MJ-1236]
 gi|254291358|ref|ZP_04962151.1| flagellar biosynthetic protein FliQ [Vibrio cholerae AM-19226]
 gi|254849207|ref|ZP_05238557.1| flagellar biosynthesis protein FliQ [Vibrio cholerae MO10]
 gi|255745139|ref|ZP_05419088.1| flagellar biosynthesis protein FliQ [Vibrio cholera CIRS 101]
 gi|262153471|ref|ZP_06028601.1| flagellar biosynthesis protein FliQ [Vibrio cholerae INDRE 91/1]
 gi|262167481|ref|ZP_06035187.1| flagellar biosynthesis protein FliQ [Vibrio cholerae RC27]
 gi|262191371|ref|ZP_06049561.1| flagellar biosynthesis protein FliQ [Vibrio cholerae CT 5369-93]
 gi|297582020|ref|ZP_06943939.1| flagellar biosynthetic protein FliQ [Vibrio cholerae RC385]
 gi|298497856|ref|ZP_07007663.1| flagellar biosynthetic protein FliQ [Vibrio cholerae MAK 757]
 gi|9656672|gb|AAF95267.1| flagellar biosynthetic protein FliQ [Vibrio cholerae O1 biovar El
          Tor str. N16961]
 gi|121548956|gb|EAX58995.1| flagellar biosynthetic protein FliQ [Vibrio cholerae 2740-80]
 gi|121630445|gb|EAX62838.1| flagellar biosynthetic protein FliQ [Vibrio cholerae V52]
 gi|124116036|gb|EAY34856.1| flagellar biosynthetic protein FliQ [Vibrio cholerae 1587]
 gi|124121431|gb|EAY40174.1| flagellar biosynthetic protein FliQ [Vibrio cholerae MZO-3]
 gi|126510478|gb|EAZ73072.1| flagellar biosynthetic protein FliQ [Vibrio cholerae NCTC 8457]
 gi|126519591|gb|EAZ76814.1| flagellar biosynthetic protein FliQ [Vibrio cholerae B33]
 gi|146316059|gb|ABQ20598.1| flagellar biosynthetic protein FliQ [Vibrio cholerae O395]
 gi|148875874|gb|EDL74009.1| flagellar biosynthetic protein FliQ [Vibrio cholerae 623-39]
 gi|149740733|gb|EDM54832.1| flagellar biosynthetic protein FliQ [Vibrio cholerae MZO-2]
 gi|150422688|gb|EDN14642.1| flagellar biosynthetic protein FliQ [Vibrio cholerae AM-19226]
 gi|227010135|gb|ACP06347.1| flagellar biosynthetic protein FliQ [Vibrio cholerae M66-2]
 gi|227014018|gb|ACP10228.1| flagellar biosynthetic protein FliQ [Vibrio cholerae O395]
 gi|229332640|gb|EEN98126.1| flagellar biosynthesis protein FliQ [Vibrio cholerae 12129(1)]
 gi|229341000|gb|EEO06005.1| flagellar biosynthesis protein FliQ [Vibrio cholerae TM 11079-80]
 gi|229343795|gb|EEO08770.1| flagellar biosynthesis protein FliQ [Vibrio cholerae RC9]
 gi|229348954|gb|EEO13911.1| flagellar biosynthesis protein FliQ [Vibrio cholerae TMA 21]
 gi|229351935|gb|EEO16876.1| flagellar biosynthesis protein FliQ [Vibrio cholerae B33]
 gi|229355298|gb|EEO20219.1| flagellar biosynthesis protein FliQ [Vibrio cholerae BX 330286]
 gi|229369993|gb|ACQ60416.1| flagellar biosynthesis protein FliQ [Vibrio cholerae MJ-1236]
 gi|254844912|gb|EET23326.1| flagellar biosynthesis protein FliQ [Vibrio cholerae MO10]
 gi|255736969|gb|EET92365.1| flagellar biosynthesis protein FliQ [Vibrio cholera CIRS 101]
 gi|262024053|gb|EEY42748.1| flagellar biosynthesis protein FliQ [Vibrio cholerae RC27]
 gi|262030708|gb|EEY49342.1| flagellar biosynthesis protein FliQ [Vibrio cholerae INDRE 91/1]
 gi|262032746|gb|EEY51294.1| flagellar biosynthesis protein FliQ [Vibrio cholerae CT 5369-93]
 gi|297533715|gb|EFH72557.1| flagellar biosynthetic protein FliQ [Vibrio cholerae RC385]
 gi|297542189|gb|EFH78239.1| flagellar biosynthetic protein FliQ [Vibrio cholerae MAK 757]
 gi|327484650|gb|AEA79057.1| Flagellar biosynthesis protein FliQ [Vibrio cholerae LMA3894-4]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 44/81 (54%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+ + ++W +L     ++  ++ +G+++A  QA T I E TL+F+P++I   + L+    
Sbjct: 8  ELFKESLWLVLIMVCAIIIPSLLVGLVVAIFQAATSINEQTLSFLPRLIITLLALMFFGH 67

Query: 68 FIGGQISSFVTLVLSRIQSSL 88
          ++   +  F   ++ R+   L
Sbjct: 68 WMTQILMDFFYSMIERMPQVL 88


>gi|255321318|ref|ZP_05362480.1| flagellar biosynthetic protein FliQ [Campylobacter showae RM3277]
 gi|255301637|gb|EET80892.1| flagellar biosynthetic protein FliQ [Campylobacter showae RM3277]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLV 80
          S P+L + +  G++I+  QA TQI E+TL+FVPKII V + +I   P++   +  F T +
Sbjct: 20 SFPMLLAGLSAGLIISIFQATTQINEMTLSFVPKIILVVVVIIFLMPWMVSMMVDFTTRM 79

Query: 81 LSRIQS 86
          +  I +
Sbjct: 80 IEFIPN 85


>gi|209920316|ref|YP_002294400.1| putative type III secretion protein [Escherichia coli SE11]
 gi|300815710|ref|ZP_07095934.1| putative surface presentation of antigens protein SpaQ
          [Escherichia coli MS 107-1]
 gi|307310521|ref|ZP_07590169.1| export protein FliQ family 3 [Escherichia coli W]
 gi|312972919|ref|ZP_07787092.1| epaQ [Escherichia coli 1827-70]
 gi|331654350|ref|ZP_08355350.1| surface presentation of antigens protein SpaQ [Escherichia coli
          M718]
 gi|209913575|dbj|BAG78649.1| putative type III secretion protein [Escherichia coli SE11]
 gi|300531639|gb|EFK52701.1| putative surface presentation of antigens protein SpaQ
          [Escherichia coli MS 107-1]
 gi|306909416|gb|EFN39911.1| export protein FliQ family 3 [Escherichia coli W]
 gi|310332861|gb|EFQ00075.1| epaQ [Escherichia coli 1827-70]
 gi|320202505|gb|EFW77075.1| Surface presentation of antigens protein SpaQ [Escherichia coli
          EC4100B]
 gi|323153850|gb|EFZ40086.1| epaQ [Escherichia coli EPECa14]
 gi|324119901|gb|EGC13780.1| export protein 3 [Escherichia coli E1167]
 gi|331047732|gb|EGI19809.1| surface presentation of antigens protein SpaQ [Escherichia coli
          M718]
          Length = 61

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V
Sbjct: 3  DIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCV 56


>gi|171319015|ref|ZP_02908142.1| export protein FliQ family 3 [Burkholderia ambifaria MEX-5]
 gi|171095770|gb|EDT40723.1| export protein FliQ family 3 [Burkholderia ambifaria MEX-5]
          Length = 94

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 16 TILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          +I+  S PV+ +A+ +GIL+   QA+TQ+Q+ ++ +  KI  V   L+I
Sbjct: 16 SIVMVSGPVVLAALVVGILVGIAQAVTQVQDQSIGYGIKIAVVLFILVI 64


>gi|307720025|ref|YP_003891165.1| flagellar biosynthetic protein FliQ [Sulfurimonas autotrophica
          DSM 16294]
 gi|306978118|gb|ADN08153.1| flagellar biosynthetic protein FliQ [Sulfurimonas autotrophica
          DSM 16294]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%)

Query: 27 SAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          + M  G+ I+  QA TQI E+TL+F+PKII V I ++++ P++  +++ F   V + I
Sbjct: 26 TGMLAGLAISIFQATTQINEMTLSFIPKIIGVVIVIVLTMPWMLNEMTDFSIGVFNMI 83


>gi|163750539|ref|ZP_02157777.1| flagellar biosynthetic protein FliQ [Shewanella benthica KT99]
 gi|294140214|ref|YP_003556192.1| flagellar biosynthetic protein FliQ [Shewanella violacea DSS12]
 gi|161329694|gb|EDQ00683.1| flagellar biosynthetic protein FliQ [Shewanella benthica KT99]
 gi|293326683|dbj|BAJ01414.1| flagellar biosynthetic protein FliQ [Shewanella violacea DSS12]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 38/63 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   +++I R A+  I++  + ++   + +G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MNPESLVDIFREALSVIVTIVSLIIVPGLVIGLVVAVFQAATSINEQTLSFLPRLLTTLF 60

Query: 61 TLI 63
           L+
Sbjct: 61 ALM 63


>gi|109899341|ref|YP_662596.1| flagellar biosynthetic protein FliQ [Pseudoalteromonas atlantica
          T6c]
 gi|332305670|ref|YP_004433521.1| flagellar biosynthetic protein FliQ [Glaciecola agarilytica
          4H-3-7+YE-5]
 gi|109701622|gb|ABG41542.1| flagellar biosynthetic protein FliQ [Pseudoalteromonas atlantica
          T6c]
 gi|332172999|gb|AEE22253.1| flagellar biosynthetic protein FliQ [Glaciecola agarilytica
          4H-3-7+YE-5]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 44/77 (57%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I + A+  ++   + ++  ++F+G+++A  QA T I E T++F+P++I   + L     
Sbjct: 8  DILKEALNMVILLVSAIILPSLFVGLIVAVFQAATSINEQTMSFLPRLIVTLLALSWGGH 67

Query: 68 FIGGQISSFVTLVLSRI 84
          ++  Q+  F   ++ RI
Sbjct: 68 WLVQQLMDFTFTMVERI 84


>gi|321399837|emb|CBJ44674.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-721]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 50/83 (60%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + LE+ +  M+ ++  +AP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL  
Sbjct: 2  EALELFKQGMYLVVILTAPPLLVAVLVGVLTSLVQALMQIQDQTLPFGIKLVAVGVTLAA 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  +
Sbjct: 62 TGRWIGVELILFINMAFDLIART 84


>gi|170698144|ref|ZP_02889223.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          IOP40-10]
 gi|170136909|gb|EDT05158.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          IOP40-10]
          Length = 84

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (68%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          G+ +   QA+TQIQE TL F  K++AVF  L++ + +IG ++ +F
Sbjct: 30 GLAVGLFQAVTQIQEQTLPFGIKLLAVFGVLLLLSNWIGEKLLAF 74


>gi|28901398|ref|NP_801053.1| flagellar biosynthetic protein [Vibrio parahaemolyticus RIMD
          2210633]
 gi|153835871|ref|ZP_01988538.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AQ3810]
 gi|260362952|ref|ZP_05775821.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          K5030]
 gi|260880239|ref|ZP_05892594.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AN-5034]
 gi|260895356|ref|ZP_05903852.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          Peru-466]
 gi|260901181|ref|ZP_05909576.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AQ4037]
 gi|28809945|dbj|BAC62886.1| flagellar biosynthetic protein [Vibrio parahaemolyticus RIMD
          2210633]
 gi|149750625|gb|EDM61370.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AQ3810]
 gi|308085740|gb|EFO35435.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          Peru-466]
 gi|308092707|gb|EFO42402.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AN-5034]
 gi|308109349|gb|EFO46889.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          AQ4037]
 gi|308112057|gb|EFO49597.1| flagellar biosynthetic protein FliQ [Vibrio parahaemolyticus
          K5030]
 gi|328469332|gb|EGF40278.1| flagellar biosynthetic protein [Vibrio parahaemolyticus 10329]
          Length = 89

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A+W I+   A ++   + +G+ IA  QA TQI E TL+F+P++I   + +I +  +I
Sbjct: 13 AVWLIILMVAVLVVPGLIVGLGIAVFQAATQINEQTLSFLPRLIVTLLMVIFAGHWI 69


>gi|126176173|ref|YP_001052322.1| export protein FliQ [Shewanella baltica OS155]
 gi|125999378|gb|ABN63453.1| export protein FliQ, family 3 [Shewanella baltica OS155]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 31/48 (64%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
           + LG+++A  QA TQ+ E TL+F+P++I   + ++ S  ++  QIS 
Sbjct: 28 GLILGLIVAVFQAATQVNEQTLSFLPRLIITLLMVLFSGHWLIQQISD 75


>gi|323493115|ref|ZP_08098246.1| flagellar biosynthesis protein FliQ [Vibrio brasiliensis LMG
          20546]
 gi|323312586|gb|EGA65719.1| flagellar biosynthesis protein FliQ [Vibrio brasiliensis LMG
          20546]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A+W I++  A ++   + +G+ IA  QA TQI E TL+F+P+++   + +I +  ++
Sbjct: 13 AVWLIITMVAVLVVPGLIVGLGIAIFQAATQINEQTLSFLPRLLVTLLMVIFAGHWM 69


>gi|223039969|ref|ZP_03610251.1| flagellar biosynthetic protein FliQ [Campylobacter rectus RM3267]
 gi|222878689|gb|EEF13788.1| flagellar biosynthetic protein FliQ [Campylobacter rectus RM3267]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          S P+L + +  G++I+  QA TQI E+TL+FVPK
Sbjct: 20 SFPMLLAGLSAGLIISIFQATTQINEMTLSFVPK 53


>gi|114562371|ref|YP_749884.1| flagellar biosynthetic protein FliQ [Shewanella frigidimarina
          NCIMB 400]
 gi|114333664|gb|ABI71046.1| flagellar biosynthetic protein FliQ [Shewanella frigidimarina
          NCIMB 400]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 38/63 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +++I R A+  I+   + ++   +F+G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MSPESLIDIFREALSVIVLIVSAIILPGLFIGLIVAVFQAATSINEQTLSFLPRLLVTLF 60

Query: 61 TLI 63
           L+
Sbjct: 61 ALM 63


>gi|260779324|ref|ZP_05888216.1| flagellar biosynthesis protein FliQ [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260605488|gb|EEX31783.1| flagellar biosynthesis protein FliQ [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A+W I++  A ++   + +G+ IA  QA TQI E TL+F+P+++   + +I +  ++
Sbjct: 13 AVWLIITMVAVLVVPGLIVGLGIAIFQAATQINEQTLSFLPRLLVTLLMVIFAGHWM 69


>gi|282599888|ref|ZP_05972234.2| surface presentation of antigens protein SpaQ [Providencia
          rustigianii DSM 4541]
 gi|282567504|gb|EFB73039.1| surface presentation of antigens protein SpaQ [Providencia
          rustigianii DSM 4541]
          Length = 91

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          +A +  ++ S+ PV+  A  +G+L+  LQ +TQ+QE TL F  K++AVF  L + + ++ 
Sbjct: 11 KAMLLIVILSAIPVIV-ATVVGLLVGLLQTVTQLQEQTLPFGIKLLAVFGCLFMISGWLA 69

Query: 71 GQISSF 76
           ++ ++
Sbjct: 70 DKVMNY 75


>gi|307945002|ref|ZP_07660339.1| flagellar biosynthetic protein FliQ [Roseibium sp. TrichSKD4]
 gi|307771926|gb|EFO31150.1| flagellar biosynthetic protein FliQ [Roseibium sp. TrichSKD4]
          Length = 146

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 28/42 (66%)

Query: 17  ILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
           I+  S P+L  A  +G++I+  Q LTQIQE TL  + KI+AV
Sbjct: 76  IVEVSVPILAVATIVGLVISIFQVLTQIQEQTLPQIAKIVAV 117


>gi|312602788|ref|YP_004022633.1| type III secretion inner membrane protein SctS [Burkholderia
          rhizoxinica HKI 454]
 gi|306431591|emb|CBK52143.1| type III secretion inner membrane protein SctS [Burkholderia
          rhizoxinica HKI 454]
 gi|312170102|emb|CBW77114.1| type III secretion inner membrane protein SctS [Burkholderia
          rhizoxinica HKI 454]
          Length = 87

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 39/68 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +    M   +  S P++  A  +G+ ++FLQA+T +Q+  L+   K+IAV I
Sbjct: 1  MDINTLIRLTMHGMLLCMYVSLPIVSVAAAVGLAVSFLQAITSMQDQALSHGVKLIAVTI 60

Query: 61 TLIISAPF 68
           +++ AP 
Sbjct: 61 VIVVGAPM 68


>gi|54307252|ref|YP_128272.1| putative flagellar biosynthetic protein [Photobacterium profundum
          SS9]
 gi|46911672|emb|CAG18470.1| putative flagellar biosynthetic protein [Photobacterium profundum
          SS9]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V      A+  I+S    ++  ++ +G++++  QA TQI E TL+F+P+++  F 
Sbjct: 1  MNSEFVATFFGDALMIIVSMVCVLIVPSLLVGLVVSIFQAATQINEQTLSFLPRLLMTFA 60

Query: 61 TLIISAPFIGGQISSFVT 78
           L  + P++   +S   T
Sbjct: 61 MLGFAGPWLLRTLSDLFT 78


>gi|330947802|gb|EGH48224.1| flagellar biosynthesis protein FliQ [Pseudomonas syringae pv.
          pisi str. 1704B]
          Length = 54

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A  QA TQI E TL+F+P+++ + ITLI+  P++
Sbjct: 1  AMFQAATQINEQTLSFLPRLLVMLITLIVIGPWL 34


>gi|330445377|ref|ZP_08309029.1| flagellar biosynthetic protein FliQ [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
 gi|328489568|dbj|GAA03526.1| flagellar biosynthetic protein FliQ [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 35/57 (61%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          EI + A++ +L     ++   + +G+++A  QA T I E TL+F+P+++   + L++
Sbjct: 8  EIFQEALYMVLVMVCAIVIPGLLIGLVVAVFQAATSINEQTLSFLPRLVVTLLALML 64


>gi|170698361|ref|ZP_02889435.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          IOP40-10]
 gi|170136700|gb|EDT04954.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          IOP40-10]
          Length = 87

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 3  EADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          E D L  I    +   LS S PV+  A   G+ I+F+QA+T +Q+ ++++  K++AV  T
Sbjct: 2  ETDTLVRITSQGLLLCLSVSMPVVAVAALSGLAISFVQAITSMQDQSISYAVKLVAVVAT 61

Query: 62 LIISAPFIGGQISSFVTLVLS 82
          ++++  +    I  F   +++
Sbjct: 62 VLMTGAWGAAAILRFANQIIT 82


>gi|172064929|ref|YP_001815641.1| HrpO family type III secretion protein [Burkholderia ambifaria
          MC40-6]
 gi|171997171|gb|ACB68088.1| type III secretion protein, HrpO family [Burkholderia ambifaria
          MC40-6]
          Length = 87

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 3  EADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          E D L  I    +   LS S PV+  A   G+ I+F+QA+T +Q+ ++++  K++AV  T
Sbjct: 2  ETDTLVRITSQGLLLCLSVSMPVVAVAALSGLAISFVQAITSMQDQSISYAVKLVAVVAT 61

Query: 62 LIISAPFIGGQISSF 76
          ++++  +    I  F
Sbjct: 62 VLMTGAWGAAAILRF 76


>gi|157373225|ref|YP_001471825.1| export protein FliQ [Shewanella sediminis HAW-EB3]
 gi|157315599|gb|ABV34697.1| export protein FliQ, family 3 [Shewanella sediminis HAW-EB3]
          Length = 89

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
          ++ +G++IA  QA TQ+ E TL+F+P+++   + ++ S  ++  QIS 
Sbjct: 28 SLLVGLIIAVFQAATQVNEQTLSFLPRLVLTLLMVLFSGQWLLQQISD 75


>gi|301303008|ref|ZP_07209135.1| putative surface presentation of antigens protein SpaQ
          [Escherichia coli MS 124-1]
 gi|300841672|gb|EFK69432.1| putative surface presentation of antigens protein SpaQ
          [Escherichia coli MS 124-1]
          Length = 68

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I 
Sbjct: 3  DIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSIC 59


>gi|261341516|ref|ZP_05969374.1| flagellar biosynthetic protein FliQ [Enterobacter cancerogenus
          ATCC 35316]
 gi|288316314|gb|EFC55252.1| flagellar biosynthetic protein FliQ [Enterobacter cancerogenus
          ATCC 35316]
          Length = 90

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          SA  +  ++ +G+ ++  QA TQI E TL+F+P+++     LII   ++  Q+  F
Sbjct: 22 SAVAIIPSLIVGLCVSIFQATTQINEQTLSFLPRLLVTLAVLIIGGKWMLTQLVDF 77


>gi|89075524|ref|ZP_01161935.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|90579938|ref|ZP_01235746.1| flagellar biosynthesis protein [Vibrio angustum S14]
 gi|89048796|gb|EAR54367.1| flagellar biosynthesis protein [Photobacterium sp. SKA34]
 gi|90438823|gb|EAS64006.1| flagellar biosynthesis protein [Vibrio angustum S14]
          Length = 89

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          EI + A++ +L     ++   + +G+++A  QA T I E TL+F+P+++   + L+    
Sbjct: 8  EIFQEALYMVLIMVCAIVIPGLLIGLVVAVFQAATSINEQTLSFLPRLVVTLLALM---- 63

Query: 68 FIGGQISSFVTLVLSRI 84
          F G  ++  +     RI
Sbjct: 64 FFGHMMTQMLMDYFYRI 80


>gi|251789492|ref|YP_003004213.1| HrpO family type III secretion protein [Dickeya zeae Ech1591]
 gi|247538113|gb|ACT06734.1| type III secretion protein, HrpO family [Dickeya zeae Ech1591]
          Length = 86

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 49/82 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 2  ETLNLFRQAMVLVVMLSAPPLLVAVVVGVLISLLQAVMQLQDQTLPFAVKLVAVGLVLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQS 86
          +  +IG ++     +  + I+ 
Sbjct: 62 TGRWIGVELIQLAMMAFNMIEQ 83


>gi|307718615|ref|YP_003874147.1| flagellar biosynthesis protein [Spirochaeta thermophila DSM 6192]
 gi|306532340|gb|ADN01874.1| flagellar biosynthesis protein [Spirochaeta thermophila DSM 6192]
 gi|315186372|gb|EFU20132.1| flagellar biosynthetic protein FliQ [Spirochaeta thermophila DSM
          6578]
          Length = 89

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 49/76 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   + + + R+ ++ ++  +AP+L   M +G++++  QA T IQE TLTFVPKI+A+ +
Sbjct: 1  MGLGEAIYLLRSGIYELIVIAAPLLLVGMLVGLIVSIFQATTSIQEQTLTFVPKILAILL 60

Query: 61 TLIISAPFIGGQISSF 76
           L++  P++   +S F
Sbjct: 61 VLLLLGPWMLSSLSQF 76


>gi|157147126|ref|YP_001454445.1| hypothetical protein CKO_02903 [Citrobacter koseri ATCC BAA-895]
 gi|157084331|gb|ABV14009.1| hypothetical protein CKO_02903 [Citrobacter koseri ATCC BAA-895]
          Length = 90

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN     +I    +  +L  SA  +  ++ +G+ ++  QA TQI E TL+F+P+++    
Sbjct: 2  MNMDTAGDIMATGIHLVLLISAVAIIPSLIVGLCVSIFQATTQINEQTLSFLPRLVVTLG 61

Query: 61 TLIISAPFIGGQISSF 76
           LI +  ++  Q+  F
Sbjct: 62 VLIFAGKWMLTQLVDF 77


>gi|212637762|ref|YP_002314287.1| flagellar biosynthesis protein FliQ [Shewanella piezotolerans
          WP3]
 gi|212559246|gb|ACJ31700.1| Flagellar biosynthesis protein FliQ [Shewanella piezotolerans
          WP3]
          Length = 89

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
           + +G+LIA  QA TQ+ E TL+F+P+++   + ++ +  ++  QIS 
Sbjct: 28 GLLVGLLIAVFQAATQVNEQTLSFLPRLVLTLLMVLFAGEWLLQQISD 75


>gi|89094444|ref|ZP_01167384.1| flagellar biosynthetic protein FliQ [Oceanospirillum sp. MED92]
 gi|89081336|gb|EAR60568.1| flagellar biosynthetic protein FliQ [Oceanospirillum sp. MED92]
          Length = 89

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 41/69 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +   A W I+   + ++  ++ +G++++  QA TQI E TL+F+P+++   +
Sbjct: 1  MTPEVVLSLFGEAFWLIVVLVSVIIVPSLIVGLIVSTFQAATQINEQTLSFLPRLLVTIL 60

Query: 61 TLIISAPFI 69
           ++ + P++
Sbjct: 61 VIMWTGPWL 69


>gi|91792695|ref|YP_562346.1| flagellar biosynthetic protein FliQ [Shewanella denitrificans
          OS217]
 gi|91714697|gb|ABE54623.1| flagellar biosynthetic protein FliQ [Shewanella denitrificans
          OS217]
          Length = 89

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 38/63 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +++I R A+  I+   + ++   +F+G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MSPEALIDIFREALSVIVLIVSAIILPGLFIGLIVAVFQAATSINEQTLSFLPRLLVTLF 60

Query: 61 TLI 63
           L+
Sbjct: 61 ALM 63


>gi|51587267|emb|CAE53655.1| putative HrcS [Pseudomonas fluorescens bv. I]
          Length = 96

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSS 87
          QAL QIQ+ TL F  K++AV +TLI++  +IG ++   + L    I  S
Sbjct: 36 QALMQIQDQTLPFGIKLVAVGVTLILTGRWIGVELIQLINLTFEMIGRS 84


>gi|126445424|ref|YP_001061221.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          668]
 gi|134280861|ref|ZP_01767571.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          305]
 gi|167725905|ref|ZP_02409141.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          DM98]
 gi|167905064|ref|ZP_02492269.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          NCTC 13177]
 gi|254182914|ref|ZP_04889507.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1655]
 gi|254299709|ref|ZP_04967158.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          406e]
 gi|125657196|gb|ABN48684.1| FliQ [Burkholderia pseudomallei]
 gi|126224915|gb|ABN88420.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          668]
 gi|134247883|gb|EBA47967.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          305]
 gi|157809667|gb|EDO86837.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          406e]
 gi|184213448|gb|EDU10491.1| flagellar biosynthetic protein FliQ [Burkholderia pseudomallei
          1655]
          Length = 90

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 33/56 (58%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSR 83
           + +G+++A  QA TQI E TL+F+P+++A    L+++  ++   +  +     +R
Sbjct: 29 GLLVGLVVALFQAATQINEQTLSFLPRLLATLAILVLAGHWLVQTLMDYCVATFTR 84


>gi|302387778|ref|YP_003823600.1| export protein FliQ family 3 [Clostridium saccharolyticum WM1]
 gi|302198406|gb|ADL05977.1| export protein FliQ family 3 [Clostridium saccharolyticum WM1]
          Length = 86

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%)

Query: 35 IAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          I+ LQA TQI E T+TFVPK+I + + L+I
Sbjct: 35 ISILQAATQIHEQTITFVPKLIVIGLVLLI 64


>gi|28628133|gb|AAO34617.1| HrcS [Erwinia chrysanthemi]
          Length = 104

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 20 ETLNLFRQAMVLVVMLSAPPLLVAVVVGVLISLLQAVMQLQDQTLPFAVKLVAVGLVLAM 79

Query: 65 SAPFIG 70
          +  +IG
Sbjct: 80 TGRWIG 85


>gi|91223204|ref|ZP_01258470.1| flagellar biosynthetic protein [Vibrio alginolyticus 12G01]
 gi|153831770|ref|ZP_01984437.1| flagellar biosynthetic protein FliQ [Vibrio harveyi HY01]
 gi|156976195|ref|YP_001447101.1| flagellar biosynthesis pathway, component FliQ [Vibrio harveyi
          ATCC BAA-1116]
 gi|254228805|ref|ZP_04922228.1| flagellar biosynthetic protein FliQ [Vibrio sp. Ex25]
 gi|262396476|ref|YP_003288329.1| flagellar biosynthesis protein FliQ [Vibrio sp. Ex25]
 gi|269960156|ref|ZP_06174532.1| Flagellar biosynthetic protein fliQ [Vibrio harveyi 1DA3]
 gi|269967107|ref|ZP_06181174.1| Flagellar biosynthetic protein fliQ [Vibrio alginolyticus 40B]
 gi|91192017|gb|EAS78280.1| flagellar biosynthetic protein [Vibrio alginolyticus 12G01]
 gi|148872280|gb|EDL71097.1| flagellar biosynthetic protein FliQ [Vibrio harveyi HY01]
 gi|151938752|gb|EDN57587.1| flagellar biosynthetic protein FliQ [Vibrio sp. Ex25]
 gi|156527789|gb|ABU72874.1| hypothetical protein VIBHAR_04966 [Vibrio harveyi ATCC BAA-1116]
 gi|262340070|gb|ACY53864.1| flagellar biosynthesis protein FliQ [Vibrio sp. Ex25]
 gi|269828244|gb|EEZ82511.1| Flagellar biosynthetic protein fliQ [Vibrio alginolyticus 40B]
 gi|269835127|gb|EEZ89210.1| Flagellar biosynthetic protein fliQ [Vibrio harveyi 1DA3]
          Length = 89

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQ 72
          A+W I+   A ++   + +G+ IA  QA TQI E TL+F+P+++   + +I +  ++  +
Sbjct: 13 AVWLIILMVAVLVVPGLIVGLCIAVFQAATQINEQTLSFLPRLLVTLLMVIFAGHWMLRK 72

Query: 73 ISSFVTLVLSRI 84
          I      +   I
Sbjct: 73 IMELFDFLFHNI 84


>gi|224825751|ref|ZP_03698855.1| flagellar biosynthetic protein FliQ [Lutiella nitroferrum 2002]
 gi|224601975|gb|EEG08154.1| flagellar biosynthetic protein FliQ [Lutiella nitroferrum 2002]
          Length = 90

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSR 83
          G++++ +QA TQI E TL+F+P+++    T+ ++  ++ G +  F   +  R
Sbjct: 33 GVVVSLIQAATQINEQTLSFLPRLLITLGTIALAGHWMTGLLMDFCIDMFHR 84


>gi|120597288|ref|YP_961862.1| flagellar biosynthetic protein FliQ [Shewanella sp. W3-18-1]
 gi|146294567|ref|YP_001184991.1| flagellar biosynthetic protein FliQ [Shewanella putrefaciens
          CN-32]
 gi|120557381|gb|ABM23308.1| flagellar biosynthetic protein FliQ [Shewanella sp. W3-18-1]
 gi|145566257|gb|ABP77192.1| flagellar biosynthetic protein FliQ [Shewanella putrefaciens
          CN-32]
          Length = 89

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
           + LG+++A  QA TQ+ E TL+F+P++I   + ++ S  ++  Q+S 
Sbjct: 28 GLILGLIVAVFQAATQVNEQTLSFLPRLIITLLMVLFSGHWLIQQLSD 75


>gi|194443974|ref|YP_002041245.1| flagellar biosynthesis protein FliQ [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|205360268|ref|ZP_02681706.2| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Hadar str. RI_05P066]
 gi|194402637|gb|ACF62859.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|205351044|gb|EDZ37675.1| flagellar biosynthetic protein FliQ [Salmonella enterica subsp.
          enterica serovar Hadar str. RI_05P066]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKI+AVFI +II+ P++   +  +V  + S +
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIVAVFIAIIIAGPWMLNLLLDYVRTLFSNL 84


>gi|315140237|gb|ADT81110.1| RscS [Pseudomonas fluorescens]
 gi|321399626|emb|CBJ44635.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTE-48-204]
 gi|321399630|emb|CBJ44638.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTE-48-205]
          Length = 88

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 47/74 (63%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + LE+ +  M+ ++  +AP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL  
Sbjct: 2  EALELFKQGMYLVVILTAPPLLVAVLVGVLTSLVQALMQIQDQTLPFGIKLVAVGVTLAA 61

Query: 65 SAPFIGGQISSFVT 78
          +  +IG ++  F+ 
Sbjct: 62 TGRWIGVELILFIN 75


>gi|289663756|ref|ZP_06485337.1| hypothetical protein XcampvN_11949 [Xanthomonas campestris pv.
          vasculorum NCPPB702]
 gi|289668178|ref|ZP_06489253.1| hypothetical protein XcampmN_06705 [Xanthomonas campestris pv.
          musacearum NCPPB4381]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++     A+   L  S PV+  A   G+LIAF+QA+  +Q+ +++F  K++ V  
Sbjct: 1  MDHDDLVRFTSEALLLCLKVSLPVVAVAALAGLLIAFIQAVMSLQDASISFALKLVVVVA 60

Query: 61 TLIISAPFIGGQISSF 76
           + ++AP+    I  F
Sbjct: 61 AIAVTAPWGASAIMQF 76


>gi|304412525|ref|ZP_07394131.1| export protein FliQ family 3 [Shewanella baltica OS183]
 gi|307307184|ref|ZP_07586922.1| export protein FliQ family 3 [Shewanella baltica BA175]
 gi|304349167|gb|EFM13579.1| export protein FliQ family 3 [Shewanella baltica OS183]
 gi|306910423|gb|EFN40854.1| export protein FliQ family 3 [Shewanella baltica BA175]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISS 75
           + LG+++A  QA TQ+ E TL+F+P++I   + ++ S  ++  Q+S 
Sbjct: 28 GLILGLIVAVFQAATQVNEQTLSFLPRLIITLLMVLFSGHWLIQQLSD 75


>gi|21241174|ref|NP_640756.1| HrcS protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|5679189|gb|AAD46903.1|AF160974_6 HrcS homolog [Xanthomonas campestris pv. glycines]
 gi|30524905|gb|AAP34350.1|AF499777_18 HrcS [Xanthomonas axonopodis pv. glycines]
 gi|21106481|gb|AAM35292.1| HrcS protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++     A+   L  S PV+  A   G+LIAF+QA+  +Q+ +++F  K++ V  
Sbjct: 1  MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFIQAVMSLQDASISFALKLVVVVA 60

Query: 61 TLIISAPFIGGQISSF 76
           + ++AP+    I  F
Sbjct: 61 AIAVTAPWGASAIMQF 76


>gi|311279109|ref|YP_003941340.1| flagellar biosynthetic protein FliQ [Enterobacter cloacae SCF1]
 gi|308748304|gb|ADO48056.1| flagellar biosynthetic protein FliQ [Enterobacter cloacae SCF1]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKIIAVF+ +II+ P++   +  +V  + S +
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFVAIIIAGPWMLNLLLDYVRTLFSNL 84


>gi|257457602|ref|ZP_05622769.1| flagellar biosynthetic protein FliQ [Treponema vincentii ATCC
          35580]
 gi|257444988|gb|EEV20064.1| flagellar biosynthetic protein FliQ [Treponema vincentii ATCC
          35580]
          Length = 90

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAV 58
          G+++A  QA T IQE TLTFVPKI+ +
Sbjct: 32 GLIVAIFQATTSIQEQTLTFVPKILTI 58


>gi|71278547|ref|YP_268255.1| flagellar biosynthetic protein FliQ [Colwellia psychrerythraea
          34H]
 gi|71144287|gb|AAZ24760.1| flagellar biosynthetic protein FliQ [Colwellia psychrerythraea
          34H]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 38/63 (60%)

Query: 24 VLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSR 83
          ++  ++ +G+++A  QA T I E TL+F+P++I   + LII   ++  ++  +   +++ 
Sbjct: 24 IILPSLAVGLMVAVFQAATSINEQTLSFLPRLIVTLLALIIGGHWLVQKVMDYTIRLIAS 83

Query: 84 IQS 86
          I S
Sbjct: 84 IPS 86


>gi|283834477|ref|ZP_06354218.1| flagellar biosynthetic protein FliQ [Citrobacter youngae ATCC
          29220]
 gi|291070024|gb|EFE08133.1| flagellar biosynthetic protein FliQ [Citrobacter youngae ATCC
          29220]
          Length = 90

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          ++ +G+L++  QA+TQI E TL+F+P++I     L I   ++  Q+S  
Sbjct: 29 SLLVGMLVSIFQAVTQINEQTLSFLPRLIVTLAVLGICGKWMIVQLSDL 77


>gi|58579703|ref|YP_198719.1| hypothetical protein XOO0080 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|84621753|ref|YP_449125.1| HrcS protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|12802686|gb|AAK08057.1|AF320050_1 HrcS [Xanthomonas oryzae pv. oryzae]
 gi|15341497|gb|AAK95646.1|AF404818_1 HrcS [Xanthomonas oryzae pv. oryzae]
 gi|7288132|dbj|BAA92827.1| hrpD3 [Xanthomonas oryzae pv. oryzae]
 gi|9711594|dbj|BAB07863.1| HrcS [Xanthomonas oryzae pv. oryzae]
 gi|24251299|gb|AAN46418.1| HrcS [Xanthomonas oryzae pv. oryzae]
 gi|50428357|dbj|BAD29994.1| HrcS [Xanthomonas oryzae pv. oryzae]
 gi|58424297|gb|AAW73334.1| HrcS protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84365693|dbj|BAE66851.1| HrcS protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++     A+   L  S PV+  A   G+LIAF+QA+  +Q+ +++F  K++ V  
Sbjct: 1  MDHDDLVRFTSEALLLCLKVSLPVVGVAALTGLLIAFVQAVMSLQDASISFALKLVVVVA 60

Query: 61 TLIISAPFIGGQISSF 76
           + ++AP+    I  F
Sbjct: 61 AIAVTAPWGASAIMQF 76


>gi|166714031|ref|ZP_02245238.1| HrcS [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|15341499|gb|AAK95647.1|AF404819_1 HrcS [Xanthomonas oryzae pv. oryzicola]
 gi|111146914|gb|ABH07399.1| HrcS [Xanthomonas oryzae pv. oryzicola]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++     A+   L  S PV+  A   G+LIAF+QA+  +Q+ +++F  K++ V  
Sbjct: 1  MDHDDLVRFTSEALLLCLKVSLPVVSVAALTGLLIAFVQAVMSLQDASISFALKLVVVVA 60

Query: 61 TLIISAPFIGGQISSF 76
           + ++AP+    I  F
Sbjct: 61 AIAVTAPWGASAIMQF 76


>gi|182412232|ref|YP_001817298.1| export protein FliQ [Opitutus terrae PB90-1]
 gi|177839446|gb|ACB73698.1| export protein FliQ family 3 [Opitutus terrae PB90-1]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          MN    ++  +  +   L  +AP L   + +G++ + LQ++T +QE TLTF+PK
Sbjct: 1  MNPELAIDFFKTTVVFALYIAAPFLLLTLVIGLVTSLLQSITSLQEQTLTFIPK 54


>gi|77165626|ref|YP_344151.1| flagellar biosynthesis protein FliQ [Nitrosococcus oceani ATCC
          19707]
 gi|254434890|ref|ZP_05048398.1| flagellar biosynthetic protein FliQ [Nitrosococcus oceani AFC27]
 gi|300113614|ref|YP_003760189.1| flagellar biosynthetic protein FliQ [Nitrosococcus watsonii
          C-113]
 gi|76883940|gb|ABA58621.1| Flagellar biosynthesis protein FliQ [Nitrosococcus oceani ATCC
          19707]
 gi|207091223|gb|EDZ68494.1| flagellar biosynthetic protein FliQ [Nitrosococcus oceani AFC27]
 gi|299539551|gb|ADJ27868.1| flagellar biosynthetic protein FliQ [Nitrosococcus watsonii
          C-113]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 32/39 (82%)

Query: 31 LGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          +G+L++  QA TQI E+TL+F+PK++AV +TL ++ P++
Sbjct: 31 VGVLVSMFQAATQINEMTLSFIPKLLAVLLTLGLAGPWM 69


>gi|78045977|ref|YP_362152.1| HrcS protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|325927672|ref|ZP_08188900.1| HrcS protein [Xanthomonas perforans 91-118]
 gi|4494849|gb|AAD21322.1| HrcS [Xanthomonas euvesicatoria]
 gi|78034407|emb|CAJ22052.1| HrcS protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|159024058|gb|ABW87286.1| HrcS [Xanthomonas fuscans subsp. fuscans]
 gi|325541873|gb|EGD13387.1| HrcS protein [Xanthomonas perforans 91-118]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++     A+   L  S PV+  A   G+LIAF+QA+  +Q+ +++F  K++ V  
Sbjct: 1  MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFVQAVMSLQDASISFALKLVVVVA 60

Query: 61 TLIISAPFIGGQISSF 76
           + ++AP+    I  F
Sbjct: 61 AIAVTAPWGASAIMQF 76


>gi|218554529|ref|YP_002387442.1| flagellar biosynthesis protein FliQ [Escherichia coli IAI1]
 gi|256017858|ref|ZP_05431723.1| flagellar biosynthesis protein FliQ [Shigella sp. D9]
 gi|332278884|ref|ZP_08391297.1| flagellar biosynthesis protein [Shigella sp. D9]
 gi|218361297|emb|CAQ98881.1| flagellar biosynthesis protein [Escherichia coli IAI1]
 gi|332101236|gb|EGJ04582.1| flagellar biosynthesis protein [Shigella sp. D9]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 40/53 (75%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++   +  +V+ + + +
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYVSTLFTNL 84


>gi|119775421|ref|YP_928161.1| flagellar biosynthetic protein FliQ [Shewanella amazonensis SB2B]
 gi|119767921|gb|ABM00492.1| flagellar biosynthetic protein FliQ [Shewanella amazonensis SB2B]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 43/76 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +++I R A+  I+   A ++   + +G+++A  QA T I E TL+F+P+++   +
Sbjct: 1  MTPEALIDIFREALAVIVMMVAVIIVPGLVVGLIVAVFQAATSINEQTLSFLPRLLVTLL 60

Query: 61 TLIISAPFIGGQISSF 76
           L+++  ++   +  F
Sbjct: 61 ALMMAGHWLVRTMMDF 76


>gi|34498078|ref|NP_902293.1| surface presentation of antigens secretory protein
          [Chromobacterium violaceum ATCC 12472]
 gi|34103933|gb|AAQ60293.1| surface presentation of antigens; secretory proteins
          [Chromobacterium violaceum ATCC 12472]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          D++     A++ +L  SA  +  A  +G+L+   Q +TQ+QE TL F  K++ V + L +
Sbjct: 3  DLVFAGNKALYLVLMMSAWPIIVATVIGLLVGLFQTVTQLQEQTLPFGIKLLGVSVCLFL 62

Query: 65 SAPFIGGQISSF 76
           + + G  + +F
Sbjct: 63 LSGWYGETLLAF 74


>gi|283784009|ref|YP_003363874.1| lateral flagellar export/assembly protein [Citrobacter rodentium
          ICC168]
 gi|282947463|emb|CBG87010.1| lateral flagellar export/assembly protein [Citrobacter rodentium
          ICC168]
          Length = 90

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSF 76
          ++ +G+L++  QA+TQI E TL+F+P++I   + L +   ++  Q+   
Sbjct: 29 SLLVGLLVSIFQAVTQINEQTLSFLPRLIVTLVVLGVCGKWMIVQLDDL 77


>gi|66044458|ref|YP_234299.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          syringae B728a]
 gi|63255165|gb|AAY36261.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          syringae B728a]
 gi|330969105|gb|EGH69171.1| type III secretion protein HrcS [Pseudomonas syringae pv. aceris
          str. M302273PT]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLAVAVLVGVVTSLLQALMQIQDQTLPFGIKLGAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIEFINMAFDLIARS 84


>gi|313610167|gb|EFR85469.1| flagellar biosynthesis protein FliP [Listeria monocytogenes FSL
          F2-208]
          Length = 83

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 38 LQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          L A+ QIQ+ +LTF+PKIIA  + L I  P++   ++     + S++
Sbjct: 31 LMAMMQIQDQSLTFLPKIIAFVVALFILGPWMFEHMTDLFVGIFSKL 77


>gi|167567197|ref|ZP_02360113.1| flagellar biosynthetic protein FliQ [Burkholderia oklahomensis
          EO147]
 gi|167574621|ref|ZP_02367495.1| flagellar biosynthetic protein FliQ [Burkholderia oklahomensis
          C6786]
          Length = 90

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 42/76 (55%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          E+   A+  I+   A ++   + +G+++A  QA TQI E TL+F+P+++A    L+ +  
Sbjct: 9  ELVGNAIRIIVVMVALIIAPGLVIGLVVALFQAATQINEQTLSFLPRLLATLGVLVFAGH 68

Query: 68 FIGGQISSFVTLVLSR 83
          ++   +  +   + +R
Sbjct: 69 WLVQTLMDYCVAIFTR 84


>gi|293446329|ref|ZP_06662751.1| flagellar biosynthetic protein FliQ [Escherichia coli B088]
 gi|291323159|gb|EFE62587.1| flagellar biosynthetic protein FliQ [Escherichia coli B088]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 40/53 (75%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++   +  +V+ + + +
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYVSTLFTNL 84


>gi|271500420|ref|YP_003333445.1| type III secretion protein, HrpO family [Dickeya dadantii Ech586]
 gi|270343975|gb|ACZ76740.1| type III secretion protein, HrpO family [Dickeya dadantii Ech586]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 49/82 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + R AM  ++  SAP L  A+ +G+LI+ LQA+ Q+Q+ TL F  K++AV + L +
Sbjct: 2  ETLTLFRQAMVLVVMLSAPPLLVAVVVGVLISLLQAVMQLQDQTLPFAVKLVAVGLVLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQS 86
          +  +IG ++     +  + I+ 
Sbjct: 62 TGRWIGVELIQLAVMAFNMIEQ 83


>gi|170769378|ref|ZP_02903831.1| flagellar biosynthetic protein FliQ [Escherichia albertii
          TW07627]
 gi|170121702|gb|EDS90633.1| flagellar biosynthetic protein FliQ [Escherichia albertii
          TW07627]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWM 69


>gi|12331291|emb|CAC24707.1| HrcS protein [Pseudomonas fluorescens]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLGVAVLVGVVTSLLQALMQIQDQTLPFGIKLGAVGLTLAL 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIQFINMAFDLIARS 84


>gi|254253709|ref|ZP_04947026.1| Type III secretory pathway component EscS [Burkholderia dolosa
          AUO158]
 gi|124898354|gb|EAY70197.1| Type III secretory pathway component EscS [Burkholderia dolosa
          AUO158]
          Length = 87

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 3  EADVL-EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          E D L  I    +   LS S PV+  A   G+ I+F+QA+T +Q+ ++++  K++AV  T
Sbjct: 2  ETDTLVRITSQGLLLCLSVSMPVVAVAALSGLAISFVQAITSMQDQSISYAVKLVAVVAT 61

Query: 62 LII 64
          +++
Sbjct: 62 VLM 64


>gi|268592374|ref|ZP_06126595.1| surface presentation of antigens protein SpaQ [Providencia
          rettgeri DSM 1131]
 gi|291312160|gb|EFE52613.1| surface presentation of antigens protein SpaQ [Providencia
          rettgeri DSM 1131]
          Length = 90

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 20 SSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTL 79
          S+ PV+  A  +G+L+  LQ +TQ+QE TL F  K++AVF +L + + ++  ++ +F   
Sbjct: 19 SAIPVIV-ATAVGLLVGLLQTVTQLQEQTLPFGIKLLAVFGSLFMISGWLSDKVMNFALE 77

Query: 80 VLS 82
           LS
Sbjct: 78 TLS 80


>gi|17549080|ref|NP_522420.1| Hrp conserved HRCS transmembrane protein [Ralstonia solanacearum
          GMI1000]
 gi|83747861|ref|ZP_00944894.1| HrcS [Ralstonia solanacearum UW551]
 gi|207724579|ref|YP_002254976.1| hrp protein hrcs [Ralstonia solanacearum MolK2]
 gi|207739215|ref|YP_002257608.1| hrp protein hrcs [Ralstonia solanacearum IPO1609]
 gi|300693805|ref|YP_003749778.1| type III secretion protein hrcs [Ralstonia solanacearum PSI07]
 gi|300697460|ref|YP_003748121.1| type III secretion protein HrcS [Ralstonia solanacearum CFBP2957]
 gi|6066700|emb|CAB58246.1| HrpU protein [Ralstonia solanacearum]
 gi|17431331|emb|CAD18010.1| hrp conserved hrcs transmembrane protein [Ralstonia solanacearum
          GMI1000]
 gi|83725508|gb|EAP72653.1| HrcS [Ralstonia solanacearum UW551]
 gi|206589801|emb|CAQ36762.1| hrp conserved protein hrcs [Ralstonia solanacearum MolK2]
 gi|206592588|emb|CAQ59494.1| hrp conserved protein hrcs [Ralstonia solanacearum IPO1609]
 gi|219566949|dbj|BAH04980.1| Hrp conserved transmembrane protein [Ralstonia solanacearum]
 gi|299069225|emb|CBJ40485.1| Type III secretion protein HrcS [Ralstonia solanacearum CMR15]
 gi|299074184|emb|CBJ53729.1| Type III secretion protein HrcS [Ralstonia solanacearum CFBP2957]
 gi|299075842|emb|CBJ35151.1| Type III secretion protein HrcS [Ralstonia solanacearum PSI07]
 gi|1097279|prf||2113360E hrpU gene
          Length = 86

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 45/81 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  ++  +   A+   L  S P +  A   G+LI+FLQA+T +Q+ +++   K+I V +
Sbjct: 1  MDYDNITRLTSTALLLCLLVSLPAVGVAAIAGLLISFLQAITSLQDSSISHGLKLIIVSL 60

Query: 61 TLIISAPFIGGQISSFVTLVL 81
           ++++AP+    I  F   ++
Sbjct: 61 VIVVAAPWGAAAILQFANSIM 81


>gi|187730771|ref|YP_001879728.1| flagellar biosynthesis protein FliQ [Shigella boydii CDC 3083-94]
 gi|187427763|gb|ACD07037.1| flagellar biosynthetic protein FliQ [Shigella boydii CDC 3083-94]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWM 69


>gi|15802384|ref|NP_288410.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          EDL933]
 gi|15831942|ref|NP_310715.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. Sakai]
 gi|16129896|ref|NP_416459.1| flagellar biosynthesis protein [Escherichia coli str. K-12
          substr. MG1655]
 gi|24113324|ref|NP_707834.1| flagellar biosynthesis protein FliQ [Shigella flexneri 2a str.
          301]
 gi|26248218|ref|NP_754258.1| flagellar biosynthesis protein FliQ [Escherichia coli CFT073]
 gi|30063387|ref|NP_837558.1| flagellar biosynthesis protein FliQ [Shigella flexneri 2a str.
          2457T]
 gi|74312489|ref|YP_310908.1| flagellar biosynthesis protein FliQ [Shigella sonnei Ss046]
 gi|82543590|ref|YP_407537.1| flagellar biosynthesis protein FliQ [Shigella boydii Sb227]
 gi|89108781|ref|AP_002561.1| flagellar biosynthesis protein [Escherichia coli str. K-12
          substr. W3110]
 gi|91211167|ref|YP_541153.1| flagellar biosynthesis protein FliQ [Escherichia coli UTI89]
 gi|110642055|ref|YP_669785.1| flagellar biosynthesis protein FliQ [Escherichia coli 536]
 gi|110805918|ref|YP_689438.1| flagellar biosynthesis protein FliQ [Shigella flexneri 5 str.
          8401]
 gi|117624089|ref|YP_853002.1| flagellar biosynthesis protein FliQ [Escherichia coli APEC O1]
 gi|157157753|ref|YP_001463251.1| flagellar biosynthesis protein FliQ [Escherichia coli E24377A]
 gi|157161420|ref|YP_001458738.1| flagellar biosynthesis protein FliQ [Escherichia coli HS]
 gi|168751878|ref|ZP_02776900.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4113]
 gi|168758263|ref|ZP_02783270.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4401]
 gi|168764425|ref|ZP_02789432.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4501]
 gi|168771556|ref|ZP_02796563.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4486]
 gi|168777376|ref|ZP_02802383.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4196]
 gi|168783346|ref|ZP_02808353.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4076]
 gi|168790291|ref|ZP_02815298.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC869]
 gi|168802296|ref|ZP_02827303.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC508]
 gi|170019718|ref|YP_001724672.1| flagellar biosynthesis protein FliQ [Escherichia coli ATCC 8739]
 gi|170081593|ref|YP_001730913.1| flagellar biosynthesis protein [Escherichia coli str. K-12
          substr. DH10B]
 gi|170681533|ref|YP_001743296.1| flagellar biosynthesis protein FliQ [Escherichia coli SMS-3-5]
 gi|188495287|ref|ZP_03002557.1| flagellar biosynthetic protein FliQ [Escherichia coli 53638]
 gi|191168276|ref|ZP_03030069.1| flagellar biosynthetic protein FliQ [Escherichia coli B7A]
 gi|191173323|ref|ZP_03034853.1| flagellar biosynthetic protein FliQ [Escherichia coli F11]
 gi|193066381|ref|ZP_03047429.1| flagellar biosynthetic protein FliQ [Escherichia coli E22]
 gi|193071131|ref|ZP_03052055.1| flagellar biosynthetic protein FliQ [Escherichia coli E110019]
 gi|194429935|ref|ZP_03062445.1| flagellar biosynthetic protein FliQ [Escherichia coli B171]
 gi|194434954|ref|ZP_03067197.1| flagellar biosynthetic protein FliQ [Shigella dysenteriae 1012]
 gi|194439595|ref|ZP_03071668.1| flagellar biosynthetic protein FliQ [Escherichia coli 101-1]
 gi|195939255|ref|ZP_03084637.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. EC4024]
 gi|208810716|ref|ZP_03252592.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4206]
 gi|208816873|ref|ZP_03257993.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4045]
 gi|208821456|ref|ZP_03261776.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4042]
 gi|209398388|ref|YP_002271066.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4115]
 gi|209919371|ref|YP_002293455.1| flagellar biosynthesis protein FliQ [Escherichia coli SE11]
 gi|215487149|ref|YP_002329580.1| flagellar biosynthesis protein FliQ [Escherichia coli O127:H6
          str. E2348/69]
 gi|217328972|ref|ZP_03445053.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. TW14588]
 gi|218558806|ref|YP_002391719.1| flagellar biosynthesis protein FliQ [Escherichia coli S88]
 gi|218689944|ref|YP_002398156.1| flagellar biosynthesis protein FliQ [Escherichia coli ED1a]
 gi|218695554|ref|YP_002403221.1| flagellar biosynthesis protein FliQ [Escherichia coli 55989]
 gi|218705442|ref|YP_002412961.1| flagellar biosynthesis protein FliQ [Escherichia coli UMN026]
 gi|227885622|ref|ZP_04003427.1| flagellar biosynthesis protein FliQ [Escherichia coli 83972]
 gi|237705908|ref|ZP_04536389.1| flagellar biosynthetic protein FliQ [Escherichia sp. 3_2_53FAA]
 gi|238901154|ref|YP_002926950.1| flagellar biosynthesis protein [Escherichia coli BW2952]
 gi|253773102|ref|YP_003035933.1| flagellar biosynthesis protein FliQ [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|254793599|ref|YP_003078436.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. TW14359]
 gi|256022393|ref|ZP_05436258.1| flagellar biosynthesis protein FliQ [Escherichia sp. 4_1_40B]
 gi|260844348|ref|YP_003222126.1| flagellar biosynthesis protein FliQ [Escherichia coli O103:H2
          str. 12009]
 gi|260855924|ref|YP_003229815.1| flagellar biosynthesis protein FliQ [Escherichia coli O26:H11
          str. 11368]
 gi|260868542|ref|YP_003234944.1| flagellar biosynthesis protein FliQ [Escherichia coli O111:H-
          str. 11128]
 gi|261227556|ref|ZP_05941837.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. FRIK2000]
 gi|261254620|ref|ZP_05947153.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. FRIK966]
 gi|291283126|ref|YP_003499944.1| hypothetical protein G2583_2400 [Escherichia coli O55:H7 str.
          CB9615]
 gi|293405432|ref|ZP_06649424.1| fliQ [Escherichia coli FVEC1412]
 gi|293410305|ref|ZP_06653881.1| flagellar biosynthetic protein FliQ [Escherichia coli B354]
 gi|293415259|ref|ZP_06657902.1| flagellar biosynthetic protein FliQ [Escherichia coli B185]
 gi|298381076|ref|ZP_06990675.1| fliQ [Escherichia coli FVEC1302]
 gi|300818631|ref|ZP_07098839.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 107-1]
 gi|300822281|ref|ZP_07102422.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 119-7]
 gi|300899206|ref|ZP_07117482.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 198-1]
 gi|300904839|ref|ZP_07122665.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 84-1]
 gi|300920168|ref|ZP_07136618.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 115-1]
 gi|300923888|ref|ZP_07139903.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 182-1]
 gi|300931162|ref|ZP_07146509.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 187-1]
 gi|300940404|ref|ZP_07154989.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 21-1]
 gi|300951574|ref|ZP_07165407.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 116-1]
 gi|300956535|ref|ZP_07168817.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 175-1]
 gi|300975536|ref|ZP_07173047.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 45-1]
 gi|300994266|ref|ZP_07180818.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 200-1]
 gi|301018201|ref|ZP_07182716.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 69-1]
 gi|301029406|ref|ZP_07192500.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 196-1]
 gi|301050690|ref|ZP_07197551.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 185-1]
 gi|301304256|ref|ZP_07210371.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 124-1]
 gi|301327736|ref|ZP_07220941.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 78-1]
 gi|301644592|ref|ZP_07244581.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 146-1]
 gi|306814228|ref|ZP_07448394.1| flagellar biosynthesis protein FliQ [Escherichia coli NC101]
 gi|307312465|ref|ZP_07592099.1| flagellar biosynthetic protein FliQ [Escherichia coli W]
 gi|309795944|ref|ZP_07690357.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 145-7]
 gi|312967146|ref|ZP_07781364.1| flagellar biosynthetic protein FliQ [Escherichia coli 2362-75]
 gi|312973834|ref|ZP_07788006.1| flagellar biosynthetic protein FliQ [Escherichia coli 1827-70]
 gi|331642570|ref|ZP_08343705.1| flagellar biosynthetic protein FliQ [Escherichia coli H736]
 gi|331647543|ref|ZP_08348635.1| flagellar biosynthetic protein FliQ [Escherichia coli M605]
 gi|331653361|ref|ZP_08354366.1| flagellar biosynthetic protein FliQ [Escherichia coli M718]
 gi|331657995|ref|ZP_08358957.1| flagellar biosynthetic protein FliQ [Escherichia coli TA206]
 gi|331663445|ref|ZP_08364355.1| flagellar biosynthetic protein FliQ [Escherichia coli TA143]
 gi|331668640|ref|ZP_08369488.1| flagellar biosynthetic protein FliQ [Escherichia coli TA271]
 gi|331673462|ref|ZP_08374230.1| flagellar biosynthetic protein FliQ [Escherichia coli TA280]
 gi|331677831|ref|ZP_08378506.1| flagellar biosynthetic protein FliQ [Escherichia coli H591]
 gi|331683501|ref|ZP_08384102.1| flagellar biosynthetic protein FliQ [Escherichia coli H299]
 gi|81175291|sp|P0AC09|FLIQ_ECO57 RecName: Full=Flagellar biosynthetic protein FliQ
 gi|81175292|sp|P0AC08|FLIQ_ECOL6 RecName: Full=Flagellar biosynthetic protein FliQ
 gi|81175293|sp|P0AC07|FLIQ_ECOLI RecName: Full=Flagellar biosynthetic protein FliQ
 gi|81175294|sp|P0AC10|FLIQ_SHIFL RecName: Full=Flagellar biosynthetic protein FliQ
 gi|12516056|gb|AAG56964.1|AE005417_6 flagellar biosynthesis [Escherichia coli O157:H7 str. EDL933]
 gi|26108622|gb|AAN80825.1|AE016762_78 Flagellar biosynthetic protein fliQ [Escherichia coli CFT073]
 gi|347244|gb|AAC36860.1| fliQ [Escherichia coli]
 gi|1736615|dbj|BAA15774.1| flagellar biosynthesis protein [Escherichia coli str. K12 substr.
          W3110]
 gi|1788260|gb|AAC75016.1| flagellar biosynthesis protein [Escherichia coli str. K-12
          substr. MG1655]
 gi|13362156|dbj|BAB36111.1| putative export protein FliQ [Escherichia coli O157:H7 str.
          Sakai]
 gi|24052335|gb|AAN43541.1| flagellar biosynthetic protein FliQ [Shigella flexneri 2a str.
          301]
 gi|30041639|gb|AAP17367.1| flagellar biosynthetic protein FliQ [Shigella flexneri 2a str.
          2457T]
 gi|73855966|gb|AAZ88673.1| flagellar biosynthesis [Shigella sonnei Ss046]
 gi|81245001|gb|ABB65709.1| flagellar biosynthesis [Shigella boydii Sb227]
 gi|91072741|gb|ABE07622.1| flagellar biosynthetic protein FliQ [Escherichia coli UTI89]
 gi|110343647|gb|ABG69884.1| flagellar biosynthetic protein FliQ [Escherichia coli 536]
 gi|110615466|gb|ABF04133.1| flagellar biosynthetic protein FliQ [Shigella flexneri 5 str.
          8401]
 gi|115513213|gb|ABJ01288.1| flagellar biosynthetic protein FliQ [Escherichia coli APEC O1]
 gi|157067100|gb|ABV06355.1| flagellar biosynthetic protein FliQ [Escherichia coli HS]
 gi|157079783|gb|ABV19491.1| flagellar biosynthetic protein FliQ [Escherichia coli E24377A]
 gi|169754646|gb|ACA77345.1| flagellar biosynthetic protein FliQ [Escherichia coli ATCC 8739]
 gi|169889428|gb|ACB03135.1| flagellar biosynthesis protein [Escherichia coli str. K-12
          substr. DH10B]
 gi|170519251|gb|ACB17429.1| flagellar biosynthetic protein FliQ [Escherichia coli SMS-3-5]
 gi|187767409|gb|EDU31253.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4196]
 gi|188014155|gb|EDU52277.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4113]
 gi|188490486|gb|EDU65589.1| flagellar biosynthetic protein FliQ [Escherichia coli 53638]
 gi|188999287|gb|EDU68273.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4076]
 gi|189354877|gb|EDU73296.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4401]
 gi|189359735|gb|EDU78154.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4486]
 gi|189365574|gb|EDU83990.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4501]
 gi|189370190|gb|EDU88606.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC869]
 gi|189375705|gb|EDU94121.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC508]
 gi|190901648|gb|EDV61404.1| flagellar biosynthetic protein FliQ [Escherichia coli B7A]
 gi|190906440|gb|EDV66049.1| flagellar biosynthetic protein FliQ [Escherichia coli F11]
 gi|192925966|gb|EDV80612.1| flagellar biosynthetic protein FliQ [Escherichia coli E22]
 gi|192955526|gb|EDV86005.1| flagellar biosynthetic protein FliQ [Escherichia coli E110019]
 gi|194412024|gb|EDX28336.1| flagellar biosynthetic protein FliQ [Escherichia coli B171]
 gi|194416789|gb|EDX32915.1| flagellar biosynthetic protein FliQ [Shigella dysenteriae 1012]
 gi|194421504|gb|EDX37518.1| flagellar biosynthetic protein FliQ [Escherichia coli 101-1]
 gi|208725232|gb|EDZ74939.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4206]
 gi|208731216|gb|EDZ79905.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4045]
 gi|208741579|gb|EDZ89261.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4042]
 gi|209159788|gb|ACI37221.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. EC4115]
 gi|209766778|gb|ACI81701.1| putative export protein FliQ [Escherichia coli]
 gi|209766780|gb|ACI81702.1| putative export protein FliQ [Escherichia coli]
 gi|209766782|gb|ACI81703.1| putative export protein FliQ [Escherichia coli]
 gi|209766784|gb|ACI81704.1| putative export protein FliQ [Escherichia coli]
 gi|209766786|gb|ACI81705.1| putative export protein FliQ [Escherichia coli]
 gi|209912630|dbj|BAG77704.1| flagellar biosynthetic protein FliQ [Escherichia coli SE11]
 gi|215265221|emb|CAS09611.1| flagellar biosynthesis protein [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217318319|gb|EEC26746.1| flagellar biosynthetic protein FliQ [Escherichia coli O157:H7
          str. TW14588]
 gi|218352286|emb|CAU98043.1| flagellar biosynthesis protein [Escherichia coli 55989]
 gi|218365575|emb|CAR03302.1| flagellar biosynthesis protein [Escherichia coli S88]
 gi|218427508|emb|CAR08403.2| flagellar biosynthesis protein [Escherichia coli ED1a]
 gi|218432539|emb|CAR13432.1| flagellar biosynthesis protein [Escherichia coli UMN026]
 gi|222033688|emb|CAP76429.1| flagellar biosynthetic protein fliQ [Escherichia coli LF82]
 gi|226900665|gb|EEH86924.1| flagellar biosynthetic protein FliQ [Escherichia sp. 3_2_53FAA]
 gi|227837195|gb|EEJ47661.1| flagellar biosynthesis protein FliQ [Escherichia coli 83972]
 gi|238861099|gb|ACR63097.1| flagellar biosynthesis protein [Escherichia coli BW2952]
 gi|253324146|gb|ACT28748.1| flagellar biosynthetic protein FliQ [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|254592999|gb|ACT72360.1| flagellar biosynthesis protein [Escherichia coli O157:H7 str.
          TW14359]
 gi|257754573|dbj|BAI26075.1| flagellar biosynthesis protein FliQ [Escherichia coli O26:H11
          str. 11368]
 gi|257759495|dbj|BAI30992.1| flagellar biosynthesis protein FliQ [Escherichia coli O103:H2
          str. 12009]
 gi|257764898|dbj|BAI36393.1| flagellar biosynthesis protein FliQ [Escherichia coli O111:H-
          str. 11128]
 gi|260448938|gb|ACX39360.1| flagellar biosynthetic protein FliQ [Escherichia coli DH1]
 gi|281179011|dbj|BAI55341.1| flagellar biosynthetic protein FliQ [Escherichia coli SE15]
 gi|281601388|gb|ADA74372.1| Flagellar biosynthetic protein fliQ [Shigella flexneri 2002017]
 gi|284921857|emb|CBG34932.1| flagellar biosynthesis protein FliQ [Escherichia coli 042]
 gi|290762999|gb|ADD56960.1| hypothetical protein G2583_2400 [Escherichia coli O55:H7 str.
          CB9615]
 gi|291427640|gb|EFF00667.1| fliQ [Escherichia coli FVEC1412]
 gi|291432907|gb|EFF05886.1| flagellar biosynthetic protein FliQ [Escherichia coli B185]
 gi|291470773|gb|EFF13257.1| flagellar biosynthetic protein FliQ [Escherichia coli B354]
 gi|294494041|gb|ADE92797.1| flagellar biosynthetic protein FliQ [Escherichia coli IHE3034]
 gi|298278518|gb|EFI20032.1| fliQ [Escherichia coli FVEC1302]
 gi|299877710|gb|EFI85921.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 196-1]
 gi|300297613|gb|EFJ53998.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 185-1]
 gi|300304931|gb|EFJ59451.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 200-1]
 gi|300316635|gb|EFJ66419.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 175-1]
 gi|300357187|gb|EFJ73057.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 198-1]
 gi|300399788|gb|EFJ83326.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 69-1]
 gi|300403266|gb|EFJ86804.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 84-1]
 gi|300410305|gb|EFJ93843.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 45-1]
 gi|300412825|gb|EFJ96135.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 115-1]
 gi|300419851|gb|EFK03162.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 182-1]
 gi|300449201|gb|EFK12821.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 116-1]
 gi|300454798|gb|EFK18291.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 21-1]
 gi|300461019|gb|EFK24512.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 187-1]
 gi|300525164|gb|EFK46233.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 119-7]
 gi|300528803|gb|EFK49865.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 107-1]
 gi|300840513|gb|EFK68273.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 124-1]
 gi|300845736|gb|EFK73496.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 78-1]
 gi|301077067|gb|EFK91873.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 146-1]
 gi|305852387|gb|EFM52838.1| flagellar biosynthesis protein FliQ [Escherichia coli NC101]
 gi|306907636|gb|EFN38139.1| flagellar biosynthetic protein FliQ [Escherichia coli W]
 gi|307553962|gb|ADN46737.1| flagellar biosynthetic protein FliQ [Escherichia coli ABU 83972]
 gi|307626575|gb|ADN70879.1| flagellar biosynthesis protein FliQ [Escherichia coli UM146]
 gi|308120394|gb|EFO57656.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 145-7]
 gi|309702238|emb|CBJ01555.1| flagellar biosynthesis protein FliQ [Escherichia coli ETEC
          H10407]
 gi|310332429|gb|EFP99664.1| flagellar biosynthetic protein FliQ [Escherichia coli 1827-70]
 gi|312288610|gb|EFR16512.1| flagellar biosynthetic protein FliQ [Escherichia coli 2362-75]
 gi|312946542|gb|ADR27369.1| flagellar biosynthesis protein FliQ [Escherichia coli O83:H1 str.
          NRG 857C]
 gi|313650171|gb|EFS14584.1| flagellar biosynthetic protein FliQ [Shigella flexneri 2a str.
          2457T]
 gi|315061249|gb|ADT75576.1| flagellar biosynthesis protein [Escherichia coli W]
 gi|315136586|dbj|BAJ43745.1| hypothetical protein ECDH1ME8569_1889 [Escherichia coli DH1]
 gi|315257219|gb|EFU37187.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 85-1]
 gi|315286655|gb|EFU46088.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 110-3]
 gi|315290266|gb|EFU49644.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 153-1]
 gi|315296483|gb|EFU55780.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 16-3]
 gi|320182734|gb|EFW57618.1| Flagellar biosynthesis protein FliQ [Shigella boydii ATCC 9905]
 gi|320184487|gb|EFW59291.1| Flagellar biosynthesis protein FliQ [Shigella flexneri CDC
          796-83]
 gi|320191923|gb|EFW66570.1| Flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. EC1212]
 gi|320194338|gb|EFW68969.1| Flagellar biosynthesis protein FliQ [Escherichia coli WV_060327]
 gi|320198640|gb|EFW73240.1| Flagellar biosynthesis protein FliQ [Escherichia coli EC4100B]
 gi|320641797|gb|EFX11185.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. G5101]
 gi|320647156|gb|EFX15989.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H-
          str. 493-89]
 gi|320652440|gb|EFX20738.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H-
          str. H 2687]
 gi|320658042|gb|EFX25804.1| flagellar biosynthesis protein FliQ [Escherichia coli O55:H7 str.
          3256-97 TW 07815]
 gi|320658614|gb|EFX26308.1| flagellar biosynthesis protein FliQ [Escherichia coli O55:H7 str.
          USDA 5905]
 gi|320668512|gb|EFX35339.1| flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. LSU-61]
 gi|323152720|gb|EFZ38992.1| flagellar biosynthetic protein FliQ [Escherichia coli EPECa14]
 gi|323158572|gb|EFZ44586.1| flagellar biosynthetic protein FliQ [Escherichia coli E128010]
 gi|323174671|gb|EFZ60291.1| flagellar biosynthetic protein FliQ [Escherichia coli LT-68]
 gi|323180798|gb|EFZ66338.1| flagellar biosynthetic protein FliQ [Escherichia coli 1180]
 gi|323186705|gb|EFZ72027.1| flagellar biosynthetic protein FliQ [Escherichia coli RN587/1]
 gi|323378174|gb|ADX50442.1| flagellar biosynthetic protein FliQ [Escherichia coli KO11]
 gi|323937219|gb|EGB33499.1| flagellar biosynthetic protein FliQ [Escherichia coli E1520]
 gi|323940392|gb|EGB36583.1| flagellar biosynthetic protein FliQ [Escherichia coli E482]
 gi|323948347|gb|EGB44334.1| flagellar biosynthetic protein FliQ [Escherichia coli H120]
 gi|323952442|gb|EGB48315.1| flagellar biosynthetic protein FliQ [Escherichia coli H252]
 gi|323956345|gb|EGB52088.1| flagellar biosynthetic protein FliQ [Escherichia coli H263]
 gi|323961993|gb|EGB57592.1| flagellar biosynthetic protein FliQ [Escherichia coli H489]
 gi|323968365|gb|EGB63772.1| flagellar biosynthetic protein FliQ [Escherichia coli M863]
 gi|323972751|gb|EGB67951.1| flagellar biosynthetic protein FliQ [Escherichia coli TA007]
 gi|323977870|gb|EGB72956.1| flagellar biosynthetic protein FliQ [Escherichia coli TW10509]
 gi|324005852|gb|EGB75071.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 57-2]
 gi|324013504|gb|EGB82723.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 60-1]
 gi|324018858|gb|EGB88077.1| flagellar biosynthetic protein FliQ [Escherichia coli MS 117-3]
 gi|324118998|gb|EGC12887.1| flagellar biosynthetic protein FliQ [Escherichia coli E1167]
 gi|326342360|gb|EGD66141.1| Flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. 1044]
 gi|326344864|gb|EGD68611.1| Flagellar biosynthesis protein FliQ [Escherichia coli O157:H7
          str. 1125]
 gi|327253081|gb|EGE64735.1| flagellar biosynthetic protein FliQ [Escherichia coli STEC_7v]
 gi|330911755|gb|EGH40265.1| flagellar biosynthesis protein FliQ [Escherichia coli AA86]
 gi|331039368|gb|EGI11588.1| flagellar biosynthetic protein FliQ [Escherichia coli H736]
 gi|331043267|gb|EGI15405.1| flagellar biosynthetic protein FliQ [Escherichia coli M605]
 gi|331049459|gb|EGI21531.1| flagellar biosynthetic protein FliQ [Escherichia coli M718]
 gi|331056243|gb|EGI28252.1| flagellar biosynthetic protein FliQ [Escherichia coli TA206]
 gi|331059244|gb|EGI31221.1| flagellar biosynthetic protein FliQ [Escherichia coli TA143]
 gi|331063834|gb|EGI35745.1| flagellar biosynthetic protein FliQ [Escherichia coli TA271]
 gi|331069660|gb|EGI41047.1| flagellar biosynthetic protein FliQ [Escherichia coli TA280]
 gi|331074291|gb|EGI45611.1| flagellar biosynthetic protein FliQ [Escherichia coli H591]
 gi|331079716|gb|EGI50913.1| flagellar biosynthetic protein FliQ [Escherichia coli H299]
 gi|332093094|gb|EGI98158.1| flagellar biosynthetic protein FliQ [Shigella boydii 5216-82]
 gi|332096903|gb|EGJ01892.1| flagellar biosynthetic protein FliQ [Shigella boydii 3594-74]
 gi|332343675|gb|AEE57009.1| flagellar biosynthetic protein FliQ [Escherichia coli UMNK88]
 gi|332756105|gb|EGJ86458.1| flagellar biosynthetic protein FliQ [Shigella flexneri 4343-70]
 gi|332757329|gb|EGJ87666.1| flagellar biosynthetic protein FliQ [Shigella flexneri 2747-71]
 gi|332757515|gb|EGJ87850.1| flagellar biosynthetic protein FliQ [Shigella flexneri K-671]
 gi|332766687|gb|EGJ96891.1| flagellar biosynthetic protein FliQ [Shigella flexneri 2930-71]
 gi|333003045|gb|EGK22599.1| flagellar biosynthetic protein FliQ [Shigella flexneri VA-6]
 gi|333003261|gb|EGK22807.1| flagellar biosynthetic protein FliQ [Shigella flexneri K-218]
 gi|333004054|gb|EGK23588.1| flagellar biosynthetic protein FliQ [Shigella flexneri K-272]
 gi|333017622|gb|EGK36934.1| flagellar biosynthetic protein FliQ [Shigella flexneri K-304]
 gi|333017827|gb|EGK37134.1| flagellar biosynthetic protein FliQ [Shigella flexneri K-227]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWM 69


>gi|307138616|ref|ZP_07497972.1| flagellar biosynthesis protein FliQ [Escherichia coli H736]
 gi|323168930|gb|EFZ54610.1| flagellar biosynthetic protein FliQ [Shigella sonnei 53G]
 gi|323183933|gb|EFZ69320.1| flagellar biosynthetic protein FliQ [Escherichia coli 1357]
 gi|332095493|gb|EGJ00509.1| flagellar biosynthetic protein FliQ [Shigella dysenteriae 155-74]
          Length = 83

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++
Sbjct: 26 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWM 63


>gi|188992475|ref|YP_001904485.1| hypothetical protein xccb100_3080 [Xanthomonas campestris pv.
          campestris str. B100]
 gi|325917010|ref|ZP_08179249.1| HrcS protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325921930|ref|ZP_08183741.1| HrcS protein [Xanthomonas gardneri ATCC 19865]
 gi|167734235|emb|CAP52443.1| putative membrane protein [Xanthomonas campestris pv. campestris]
 gi|325536761|gb|EGD08518.1| HrcS protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325547632|gb|EGD18675.1| HrcS protein [Xanthomonas gardneri ATCC 19865]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  D++     A+   L  S PV+  A   G+LIAF+QA+  +Q+ +++F  K++ V  
Sbjct: 1  MDHDDLVRFTSEALLLCLKVSLPVVGVAAVAGLLIAFIQAVMSLQDASISFALKLVVVVA 60

Query: 61 TLIISAPFIGGQISSF 76
           + ++AP+    I  F
Sbjct: 61 AIAVTAPWGASAIMQF 76


>gi|268589971|ref|ZP_06124192.1| flagellar biosynthetic protein FliQ [Providencia rettgeri DSM
          1131]
 gi|291314688|gb|EFE55141.1| flagellar biosynthetic protein FliQ [Providencia rettgeri DSM
          1131]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 37/51 (72%)

Query: 34 LIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          +I+ LQA TQ+ E+TL+F+PKI++V   +II+ P++   ++ ++  +LS +
Sbjct: 34 IISLLQAATQVNEMTLSFIPKILSVISVIIIAGPWMLNLLTDYMRSLLSNL 84


>gi|218699490|ref|YP_002407119.1| flagellar biosynthesis protein FliQ [Escherichia coli IAI39]
 gi|218369476|emb|CAR17241.1| flagellar biosynthesis protein [Escherichia coli IAI39]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/38 (60%), Positives = 33/38 (86%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          G++I+ LQA TQI E+TL+F+PKIIAVFI +II+ P++
Sbjct: 32 GLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWM 69


>gi|238898598|ref|YP_002924279.1| type III needle complex export protein [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|75906095|gb|ABA29438.1| putative type III secretion system protein [Candidatus
          Hamiltonella defensa]
 gi|229466357|gb|ACQ68131.1| type III needle complex export protein [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN  D++     A++ IL+ SA  +  A  +G++I  +Q +TQ+QE TL F  K+++V +
Sbjct: 1  MN--DLVFAGNKALYLILTLSAIPVAVATAVGLIIGLIQTVTQLQEQTLPFGIKLLSVSL 58

Query: 61 TLIISAPFIGGQISSF 76
           L + A + G  + ++
Sbjct: 59 CLFLLAGWYGDTLLAY 74


>gi|321399654|emb|CBJ44656.1| putative type III secretion system protein HrcS [Pseudomonas sp.
          MTR-J5-327]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + LE+ +  M+  +  +AP L  A+ +G+L + +QAL QIQ+ TL F  K++AV +TL  
Sbjct: 2  EALELFKQGMYLAVILTAPPLLVAVLVGVLTSLVQALMQIQDQTLPFGIKLVAVGVTLAA 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  +
Sbjct: 62 TGRWIGVELILFINMAFDLIART 84


>gi|315639269|ref|ZP_07894431.1| flagellar biosynthetic protein FliQ [Campylobacter upsaliensis
          JV21]
 gi|315480595|gb|EFU71237.1| flagellar biosynthetic protein FliQ [Campylobacter upsaliensis
          JV21]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+  QA TQI E+TL+FVPKII V + +I   P++   +  F   +L++I +
Sbjct: 32 GLIISIFQATTQINEMTLSFVPKIILVVVVIIFLMPWMTSTMIDFTANILNQIPT 86


>gi|289678000|ref|ZP_06498890.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. syringae FF5]
 gi|818892|gb|AAB05076.1| HrpO [Pseudomonas syringae pv. syringae]
 gi|51587247|emb|CAE53640.1| putative HrcS [Pseudomonas syringae pv. syringae]
 gi|148562541|gb|ABQ88360.1| HrcS [Pseudomonas syringae pv. syringae]
 gi|330937036|gb|EGH41124.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. pisi str. 1704B]
 gi|330950825|gb|EGH51085.1| type III secretion component protein HrcS [Pseudomonas syringae
          Cit 7]
 gi|330975863|gb|EGH75929.1| type III secretion component protein HrcS [Pseudomonas syringae
          pv. aptata str. DSM 50252]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 49/83 (59%)

Query: 5  DVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLII 64
          + L + +  M+ ++  +AP L  A+ +G++ + LQAL QIQ+ TL F  K+ AV +TL +
Sbjct: 2  EALALFKQGMFLVVILTAPPLAVAVLVGVVTSLLQALMQIQDQTLPFGIKLGAVGLTLAM 61

Query: 65 SAPFIGGQISSFVTLVLSRIQSS 87
          +  +IG ++  F+ +    I  S
Sbjct: 62 TGRWIGVELIQFINMAFDLIARS 84


>gi|57505303|ref|ZP_00371232.1| flagellar biosynthetic protein FliQ [Campylobacter upsaliensis
          RM3195]
 gi|57016439|gb|EAL53224.1| flagellar biosynthetic protein FliQ [Campylobacter upsaliensis
          RM3195]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQS 86
          G++I+  QA TQI E+TL+FVPKII V + +I   P++   +  F   +L++I +
Sbjct: 32 GLIISIFQATTQINEMTLSFVPKIILVVVIIIFLMPWMTSTMIDFTANILNQIPT 86


>gi|16799760|ref|NP_470028.1| flagellar biosynthesis protein FliQ [Listeria innocua Clip11262]
 gi|217965225|ref|YP_002350903.1| flagellar biosynthesis protein [Listeria monocytogenes HCC23]
 gi|254830332|ref|ZP_05234987.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          10403S]
 gi|289433955|ref|YP_003463827.1| flagellar biosynthetic protein FliQ [Listeria seeligeri serovar
          1/2b str. SLCC3954]
 gi|290892877|ref|ZP_06555868.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes FSL
          J2-071]
 gi|315281328|ref|ZP_07869976.1| flagellar biosynthesis protein FliQ [Listeria marthii FSL S4-120]
 gi|315301907|ref|ZP_07872920.1| flagellar biosynthesis protein FliQ [Listeria ivanovii FSL
          F6-596]
 gi|16413137|emb|CAC95917.1| lin0685 [Listeria innocua Clip11262]
 gi|217334495|gb|ACK40289.1| flagellar biosynthesis protein [Listeria monocytogenes HCC23]
 gi|289170199|emb|CBH26739.1| flagellar biosynthetic protein FliQ [Listeria seeligeri serovar
          1/2b str. SLCC3954]
 gi|290557689|gb|EFD91212.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes FSL
          J2-071]
 gi|307570216|emb|CAR83395.1| flagellar biosynthetic protein [Listeria monocytogenes L99]
 gi|313615026|gb|EFR88522.1| flagellar biosynthesis protein FliQ [Listeria marthii FSL S4-120]
 gi|313620097|gb|EFR91602.1| flagellar biosynthesis protein FliQ [Listeria innocua FSL S4-378]
 gi|313624919|gb|EFR94827.1| flagellar biosynthesis protein FliQ [Listeria innocua FSL J1-023]
 gi|313629723|gb|EFR97843.1| flagellar biosynthesis protein FliQ [Listeria ivanovii FSL
          F6-596]
 gi|313634414|gb|EFS01001.1| flagellar biosynthesis protein FliQ [Listeria seeligeri FSL
          N1-067]
 gi|313639092|gb|EFS04068.1| flagellar biosynthesis protein FliQ [Listeria seeligeri FSL
          S4-171]
          Length = 90

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 38 LQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          L A+ QIQ+ +LTF+PKIIA  + L I  P++   ++     + S++
Sbjct: 38 LMAMMQIQDQSLTFLPKIIAFVVALFILGPWMFEHMTDLFVGIFSKL 84


>gi|85711031|ref|ZP_01042091.1| Flagellar biosynthesis protein FliQ [Idiomarina baltica OS145]
 gi|85694944|gb|EAQ32882.1| Flagellar biosynthesis protein FliQ [Idiomarina baltica OS145]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          ++ +G+++A  QA T I E TL+F+P+++     + +   FI G +  F   + +RI
Sbjct: 28 SLLVGLMVAVFQAATSINEQTLSFLPRLLVTLAVIGLGGHFIVGLLMDFTIEMYNRI 84


>gi|292488068|ref|YP_003530945.1| surface presentation of antigens protein spaQ [Erwinia amylovora
          CFBP1430]
 gi|292899279|ref|YP_003538648.1| type III secretion system protein [Erwinia amylovora ATCC 49946]
 gi|291199127|emb|CBJ46241.1| type III secretion system protein [Erwinia amylovora ATCC 49946]
 gi|291553492|emb|CBA20537.1| Surface presentation of antigens protein spaQ [Erwinia amylovora
          CFBP1430]
 gi|312172196|emb|CBX80453.1| Surface presentation of antigens protein spaQ [Erwinia amylovora
          ATCC BAA-2158]
          Length = 84

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 5  DVLEIARAAMWTILSSSA-PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          + L I+ AA+  +L  +A PV F+ + +GI++   Q + QIQE TL F  K++AVF ++ 
Sbjct: 3  NTLFISNAALVVVLKLTAVPVAFATL-VGIVVGLFQTIMQIQEQTLPFGLKMLAVFASIF 61

Query: 64 ISAPFIGGQISSFVTLVLS 82
          +   +   ++ +F     S
Sbjct: 62 MLIEWFSAEMLNFANQAFS 80


>gi|188590018|ref|YP_001920218.1| flagellar biosynthetic protein FliQ [Clostridium botulinum E3
          str. Alaska E43]
 gi|251779783|ref|ZP_04822703.1| flagellar biosynthetic protein FliQ [Clostridium botulinum E1
          str. 'BoNT E Beluga']
 gi|188500299|gb|ACD53435.1| flagellar biosynthetic protein FliQ [Clostridium botulinum E3
          str. Alaska E43]
 gi|243084098|gb|EES49988.1| flagellar biosynthetic protein FliQ [Clostridium botulinum E1
          str. 'BoNT E Beluga']
          Length = 89

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIA 57
          +AP+L   + +G+LI+ +QA TQIQE TLTFVPK+IA
Sbjct: 21 AAPILLVVLIVGLLISIIQATTQIQEQTLTFVPKLIA 57


>gi|33592491|ref|NP_880135.1| flagellar biosynthetic protein FliQ [Bordetella pertussis Tohama
          I]
 gi|33596148|ref|NP_883791.1| flagellar biosynthetic protein FliQ [Bordetella parapertussis
          12822]
 gi|33601554|ref|NP_889114.1| flagellar biosynthetic protein FliQ [Bordetella bronchiseptica
          RB50]
 gi|33572137|emb|CAE41680.1| flagellar biosynthetic protein FliQ [Bordetella pertussis Tohama
          I]
 gi|33573151|emb|CAE36801.1| flagellar biosynthetic protein FliQ [Bordetella parapertussis]
 gi|33575990|emb|CAE33070.1| flagellar biosynthetic protein FliQ [Bordetella bronchiseptica
          RB50]
 gi|332381909|gb|AEE66756.1| flagellar biosynthetic protein FliQ [Bordetella pertussis CS]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 25/30 (83%)

Query: 29 MFLGILIAFLQALTQIQEVTLTFVPKIIAV 58
          + +G++I+  QA TQI E+TL+F+PK++A+
Sbjct: 29 LIVGLVISIFQAATQINEMTLSFIPKLLAM 58


>gi|187934309|ref|YP_001885057.1| flagellar biosynthetic protein FliQ [Clostridium botulinum B str.
          Eklund 17B]
 gi|187722462|gb|ACD23683.1| flagellar biosynthetic protein FliQ [Clostridium botulinum B str.
          Eklund 17B]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%)

Query: 21 SAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIA 57
          +AP+L   + +G+LI+ +QA TQIQE TLTFVPK+IA
Sbjct: 21 AAPILLVVLIVGLLISIIQATTQIQEQTLTFVPKLIA 57


>gi|829081|dbj|BAA09163.1| ORF23 [Shigella sonnei]
          Length = 80

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSS 87
          A  +G+ I  LQ +TQ+QE TL F  K+I V I+L++ + + G  + SF   ++  I+S 
Sbjct: 20 ATVIGLSIGLLQTVTQLQEQTLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLIKSG 79


>gi|225871937|ref|YP_002753391.1| flagellar biosynthetic protein FliQ [Acidobacterium capsulatum
          ATCC 51196]
 gi|225792083|gb|ACO32173.1| flagellar biosynthetic protein FliQ [Acidobacterium capsulatum
          ATCC 51196]
          Length = 91

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 35 IAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++ LQ LT IQ+ T++ VP+++A  + L++ AP++   ++ +   + S     L
Sbjct: 35 LSLLQTLTSIQDQTISTVPRLLATTVVLLVGAPWLLRHLAGYTLELFSNFHRYL 88


>gi|126175117|ref|YP_001051266.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS155]
 gi|153001441|ref|YP_001367122.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS185]
 gi|160876166|ref|YP_001555482.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS195]
 gi|304409948|ref|ZP_07391567.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS183]
 gi|307302339|ref|ZP_07582097.1| flagellar biosynthetic protein FliQ [Shewanella baltica BA175]
 gi|125998322|gb|ABN62397.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS155]
 gi|151366059|gb|ABS09059.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS185]
 gi|160861688|gb|ABX50222.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS195]
 gi|304351357|gb|EFM15756.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS183]
 gi|306914377|gb|EFN44798.1| flagellar biosynthetic protein FliQ [Shewanella baltica BA175]
 gi|315268362|gb|ADT95215.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS678]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 46/84 (54%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +++I R A+  I+   + ++   + +G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MSPEALIDIFREALAVIVMMVSAIVLPGLGIGLIVAVFQAATSINEQTLSFLPRLLVTLF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+    ++   +  F   +++RI
Sbjct: 61 GLMFMGHWLVETLMDFFVEMVNRI 84


>gi|308048763|ref|YP_003912329.1| flagellar biosynthetic protein FliQ [Ferrimonas balearica DSM
          9799]
 gi|307630953|gb|ADN75255.1| flagellar biosynthetic protein FliQ [Ferrimonas balearica DSM
          9799]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 35/56 (62%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          +I R A+  I+   + ++   + +G+++A  QA T I E TL+F+P+++   +T++
Sbjct: 8  DIFRHALQVIVMMVSAIIVPGLVVGLIVAVFQAATSINEQTLSFLPRLLVTLVTMM 63


>gi|255027835|ref|ZP_05299821.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes FSL
          J2-003]
          Length = 87

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 38 LQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          L A+ QIQ+ +LTF+PKI+A  + L I  P++   ++     + S++
Sbjct: 38 LMAMMQIQDQSLTFLPKIVAFVVALFILGPWMFEHMTDLFVGIFSKL 84


>gi|119947196|ref|YP_944876.1| flagellar biosynthetic protein FliQ [Psychromonas ingrahamii 37]
 gi|119865800|gb|ABM05277.1| flagellar biosynthetic protein FliQ [Psychromonas ingrahamii 37]
          Length = 89

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 34/54 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPK 54
          M+   V+ +   ++W I+   A ++  ++ +G+++A  QA TQ+ E TL+F+P+
Sbjct: 1  MSPEFVVSLLSQSIWLIIKFVAVLVLPSLVVGLIVAVFQAATQVNEQTLSFLPR 54


>gi|170725984|ref|YP_001760010.1| flagellar biosynthetic protein FliQ [Shewanella woodyi ATCC
          51908]
 gi|169811331|gb|ACA85915.1| flagellar biosynthetic protein FliQ [Shewanella woodyi ATCC
          51908]
          Length = 89

 Score = 34.7 bits (78), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 38/63 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +++I R A+  I++  + ++   + +G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MSPESLVDIFREALSVIVTIVSLIILPGLVIGLIVAVFQAATSINEQTLSFLPRLLTTLF 60

Query: 61 TLI 63
           L+
Sbjct: 61 ALM 63


>gi|259908637|ref|YP_002648993.1| Type III secretion apparatus [Erwinia pyrifoliae Ep1/96]
 gi|224964259|emb|CAX55766.1| Type III secretion apparatus [Erwinia pyrifoliae Ep1/96]
 gi|283478609|emb|CAY74525.1| Surface presentation of antigens protein spaQ [Erwinia pyrifoliae
          DSM 12163]
          Length = 84

 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 5  DVLEIARAAMWTILSSSA-PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          + L I+ AA+  +L  +A P+ F+ + +GI++   Q + QIQE TL F  K++AVF ++ 
Sbjct: 3  NTLFISNAALVVVLKLTAVPIAFATL-VGIIVGLFQTIMQIQEQTLPFGLKMLAVFASIF 61

Query: 64 ISAPFIGGQISSFVTLVLS 82
          +   +   ++ +F     S
Sbjct: 62 MLIEWFSAEMLNFANQAFS 80


>gi|16802719|ref|NP_464204.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          EGD-e]
 gi|46906928|ref|YP_013317.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          serotype 4b str. F2365]
 gi|47091640|ref|ZP_00229436.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes str.
          4b H7858]
 gi|47095242|ref|ZP_00232853.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes str.
          1/2a F6854]
 gi|116872066|ref|YP_848847.1| flagellar biosynthesis protein FliQ [Listeria welshimeri serovar
          6b str. SLCC5334]
 gi|224498760|ref|ZP_03667109.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          Finland 1988]
 gi|224502018|ref|ZP_03670325.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes FSL
          R2-561]
 gi|226223308|ref|YP_002757415.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          Clip81459]
 gi|254824043|ref|ZP_05229044.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          J1-194]
 gi|254829334|ref|ZP_05234021.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          N3-165]
 gi|254853118|ref|ZP_05242466.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          R2-503]
 gi|254900087|ref|ZP_05260011.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          J0161]
 gi|254911360|ref|ZP_05261372.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          J2818]
 gi|254932043|ref|ZP_05265402.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes
          HPB2262]
 gi|254935687|ref|ZP_05267384.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes
          F6900]
 gi|254992442|ref|ZP_05274632.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes FSL
          J2-064]
 gi|255028551|ref|ZP_05300502.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes LO28]
 gi|255521626|ref|ZP_05388863.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes FSL
          J1-175]
 gi|284801007|ref|YP_003412872.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          08-5578]
 gi|284994149|ref|YP_003415917.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          08-5923]
 gi|300764488|ref|ZP_07074481.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          N1-017]
 gi|16410066|emb|CAC98755.1| lmo0677 [Listeria monocytogenes EGD-e]
 gi|46880194|gb|AAT03494.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes
          serotype 4b str. F2365]
 gi|47016313|gb|EAL07235.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes str.
          1/2a F6854]
 gi|47019959|gb|EAL10696.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes str.
          4b H7858]
 gi|116740944|emb|CAK20064.1| flagellar biosynthetic protein FliQ, putative [Listeria
          welshimeri serovar 6b str. SLCC5334]
 gi|225875770|emb|CAS04473.1| Putative flagellar biosynthesis protein FliQ [Listeria
          monocytogenes serotype 4b str. CLIP 80459]
 gi|258601746|gb|EEW15071.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          N3-165]
 gi|258606469|gb|EEW19077.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          R2-503]
 gi|258608269|gb|EEW20877.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes
          F6900]
 gi|284056569|gb|ADB67510.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          08-5578]
 gi|284059616|gb|ADB70555.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          08-5923]
 gi|293583596|gb|EFF95628.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes
          HPB2262]
 gi|293589296|gb|EFF97630.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes
          J2818]
 gi|293593272|gb|EFG01033.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          J1-194]
 gi|300514842|gb|EFK41896.1| flagellar biosynthetic protein FliQ [Listeria monocytogenes FSL
          N1-017]
 gi|328467246|gb|EGF38326.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes 1816]
 gi|328475642|gb|EGF46391.1| flagellar biosynthesis protein FliQ [Listeria monocytogenes 220]
 gi|332311102|gb|EGJ24197.1| Export protein FliQ family 3 [Listeria monocytogenes str. Scott
          A]
          Length = 90

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 38 LQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          L A+ QIQ+ +LTF+PKI+A  + L I  P++   ++     + S++
Sbjct: 38 LMAMMQIQDQSLTFLPKIVAFVVALFILGPWMFEHMTDLFVGIFSKL 84


>gi|258622509|ref|ZP_05717531.1| Flagellar biosynthetic protein fliQ [Vibrio mimicus VM573]
 gi|258624668|ref|ZP_05719603.1| Flagellar biosynthetic protein fliQ [Vibrio mimicus VM603]
 gi|262173375|ref|ZP_06041052.1| flagellar biosynthesis protein FliQ [Vibrio mimicus MB-451]
 gi|258583060|gb|EEW07874.1| Flagellar biosynthetic protein fliQ [Vibrio mimicus VM603]
 gi|258585209|gb|EEW09936.1| Flagellar biosynthetic protein fliQ [Vibrio mimicus VM573]
 gi|261890733|gb|EEY36720.1| flagellar biosynthesis protein FliQ [Vibrio mimicus MB-451]
          Length = 89

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A+W I+   A ++   + +G+ IA  QA TQI E TL+F+P+++A  + +I +  ++
Sbjct: 13 AVWMIIIIVAVLVVPGLIVGLGIAVFQAATQINEQTLSFLPRLLATLLMVIFAGHWM 69


>gi|57504669|ref|ZP_00370747.1| flagellar biosynthetic protein FliQ [Campylobacter coli RM2228]
 gi|305432627|ref|ZP_07401788.1| flagellar biosynthetic protein FliQ [Campylobacter coli JV20]
 gi|57019438|gb|EAL56133.1| flagellar biosynthetic protein FliQ [Campylobacter coli RM2228]
 gi|304444338|gb|EFM36990.1| flagellar biosynthetic protein FliQ [Campylobacter coli JV20]
          Length = 89

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%)

Query: 32 GILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRI 84
          G++I+  QA TQI E+TL+FVPKII V I +I   P++   +  F   +L++I
Sbjct: 32 GLIISIFQATTQINEMTLSFVPKIILVVIVIIFLMPWMTTTMIDFTENILNQI 84


>gi|217972627|ref|YP_002357378.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS223]
 gi|217497762|gb|ACK45955.1| flagellar biosynthetic protein FliQ [Shewanella baltica OS223]
          Length = 89

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 46/84 (54%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   +++I R A+  I+   + ++   + +G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MSPEALIDIFREALAVIVMMVSAIVLPGLGIGLIVAVFQAATSINEQTLSFLPRLLVTLF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+    ++   +  F   +++RI
Sbjct: 61 GLMFMGHWLVETLMDFFIEMVNRI 84


>gi|254575133|gb|ACT68034.1| type III secretion apparatus [Pantoea stewartii subsp. stewartii
          DC283]
          Length = 84

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 5  DVLEIARAAMWTILSSSA-PVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLI 63
          +VL I   A+  +L  +A P+ F+ + +GI++   Q + QIQE TL F  K++AVF ++ 
Sbjct: 3  NVLFIGNTALIVVLKLTAVPIAFATV-VGIIVGLFQTIMQIQEQTLPFGLKMLAVFASIF 61

Query: 64 ISAPFIGGQISSF 76
          +   +   ++ +F
Sbjct: 62 MLIEWFSAEMMNF 74


>gi|262273548|ref|ZP_06051362.1| flagellar biosynthesis protein FliQ [Grimontia hollisae CIP
          101886]
 gi|262222526|gb|EEY73837.1| flagellar biosynthesis protein FliQ [Grimontia hollisae CIP
          101886]
          Length = 89

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 35/57 (61%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFI 69
          A++ I+S    ++   + +G++++  QA TQI E TL+F+P+++     L  + P++
Sbjct: 13 ALFMIVSMVCVLILPGLLVGLVVSIFQAATQINEQTLSFLPRLLVTLAMLGFAGPWM 69


>gi|308050043|ref|YP_003913609.1| export protein FliQ family 3 [Ferrimonas balearica DSM 9799]
 gi|307632233|gb|ADN76535.1| export protein FliQ family 3 [Ferrimonas balearica DSM 9799]
          Length = 89

 Score = 33.9 bits (76), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 39/64 (60%)

Query: 13 AMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQ 72
           ++ +++    ++   M +G++IA LQA TQ+ E TL+F+P+++   + ++ +  ++  Q
Sbjct: 13 GIYLVVAMVGVLIMPGMVVGLVIAVLQAATQVNEQTLSFLPRLLITLLMVLFAGNWLLQQ 72

Query: 73 ISSF 76
          ++  
Sbjct: 73 LADL 76


>gi|325917837|ref|ZP_08180016.1| flagellar biosynthesis pathway, component FliQ [Xanthomonas
          vesicatoria ATCC 35937]
 gi|325535948|gb|EGD07765.1| flagellar biosynthesis pathway, component FliQ [Xanthomonas
          vesicatoria ATCC 35937]
          Length = 89

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%)

Query: 11 RAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          R  + T+L  + P+L + + +G++I  +QA TQ+ E T+ FV K +A+  TL  +   + 
Sbjct: 11 RGGLVTVLWIAGPMLLAVLIVGVVIGVVQAATQLNEPTIGFVAKAVALTATLFATGSMLL 70

Query: 71 GQISSFVTLVLSRI 84
          G +  F   +  RI
Sbjct: 71 GHLVEFTIALFQRI 84


>gi|167743327|ref|ZP_02416101.1| type III secretion protein, HrpO family [Burkholderia
          pseudomallei 14]
          Length = 87

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M   D++ +    M   L  S PV+  A   G+ I+FLQA+T +QE ++++  K++AV +
Sbjct: 1  MEIDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQEQSISYGVKLVAVTV 60

Query: 61 TLIISAPFIGGQISSF 76
           + I+ P+   +I  F
Sbjct: 61 AVAIAGPWAAAEILHF 76


>gi|332533115|ref|ZP_08408984.1| flagellar biosynthetic protein FliQ [Pseudoalteromonas
          haloplanktis ANT/505]
 gi|332037397|gb|EGI73851.1| flagellar biosynthetic protein FliQ [Pseudoalteromonas
          haloplanktis ANT/505]
          Length = 89

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 40/71 (56%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I   A++ ++   + ++   + +G+++A  QA T I E TL+F+P+++     LI+   
Sbjct: 8  DILSDALFLVIKLVSAIVVPGLIIGLVVAVFQAATSINEQTLSFLPRLLITISALIVGGH 67

Query: 68 FIGGQISSFVT 78
          ++  ++  F T
Sbjct: 68 WLTQELMDFFT 78


>gi|330903476|gb|EGH34048.1| type III secretion protein HrcS [Pseudomonas syringae pv.
          japonica str. M301072PT]
          Length = 73

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 36 AFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIGGQISSFVTLVLSRIQSS 87
          + LQAL QIQ+ TL F  K+ AV +TL ++  +IG ++  F+ +    I  S
Sbjct: 18 SLLQALMQIQDQTLPFGIKLGAVGLTLAMTGRWIGVELIQFINMAFDLIARS 69


>gi|293416350|ref|ZP_06658989.1| type III secretion protein SctS [Escherichia coli B185]
 gi|291431706|gb|EFF04689.1| type III secretion protein SctS [Escherichia coli B185]
          Length = 86

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE  ++     A++ +L  SA  +  A  +G+LI   Q +TQ+QE TL F  K++ + +
Sbjct: 1  MNE--LVFAGNKALYLVLCLSAWPVAVATLIGLLIGIFQTVTQLQEQTLPFGLKLLGICL 58

Query: 61 TLIISAPFIGGQISSF 76
             + + + G  + +F
Sbjct: 59 CFFLLSGWYGDALLAF 74


>gi|120598261|ref|YP_962835.1| flagellar biosynthetic protein FliQ [Shewanella sp. W3-18-1]
 gi|146293661|ref|YP_001184085.1| flagellar biosynthetic protein FliQ [Shewanella putrefaciens
          CN-32]
 gi|120558354|gb|ABM24281.1| flagellar biosynthetic protein FliQ [Shewanella sp. W3-18-1]
 gi|145565351|gb|ABP76286.1| flagellar biosynthetic protein FliQ [Shewanella putrefaciens
          CN-32]
 gi|319427060|gb|ADV55134.1| flagellar biosynthetic protein FliQ [Shewanella putrefaciens 200]
          Length = 89

 Score = 33.5 bits (75), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 45/84 (53%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    +++I R A+  I+   + ++   + +G+++A  QA T I E TL+F+P+++    
Sbjct: 1  MTPEALIDIFREALAVIVMMVSAIVLPGLGIGLVVAVFQAATSINEQTLSFLPRLLVTLF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+    ++   +  F   +++RI
Sbjct: 61 GLMFMGHWLVQTLMDFFIEMVNRI 84


>gi|254255058|ref|ZP_04948375.1| Type III secretory pathway component EscS [Burkholderia dolosa
          AUO158]
 gi|124899703|gb|EAY71546.1| Type III secretory pathway component EscS [Burkholderia dolosa
          AUO158]
          Length = 84

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%)

Query: 28 AMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPFIG 70
          A  +G+++  +Q +TQ+QE TL+F  K++AV + L + A + G
Sbjct: 26 ATIVGLVVGLIQTVTQLQEQTLSFGVKVLAVSLCLFLLAGWYG 68


>gi|315127308|ref|YP_004069311.1| flagellar biosynthesis [Pseudoalteromonas sp. SM9913]
 gi|315015822|gb|ADT69160.1| flagellar biosynthesis [Pseudoalteromonas sp. SM9913]
          Length = 89

 Score = 33.5 bits (75), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 8  EIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAP 67
          +I   A++ ++   + ++   + +G+++A  QA T I E TL+F+P+++     + ISA 
Sbjct: 8  DILSGALFLVIKLVSAIVVPGLIIGLVVAVFQAATSINEQTLSFLPRLL-----ITISAL 62

Query: 68 FIGGQ 72
           +GG 
Sbjct: 63 IVGGH 67


Searching..................................................done


Results from round 2




>gi|217976246|ref|YP_002360393.1| flagellar biosynthesis protein FliQ [Methylocella silvestris BL2]
 gi|217501622|gb|ACK49031.1| flagellar biosynthetic protein FliQ [Methylocella silvestris BL2]
          Length = 88

 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 63/87 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD LE+ R+A+WTI+  S P + +AMF+G++IA LQALTQIQE TLTFVPKI+ +F+
Sbjct: 1  MNEADALELIRSAIWTIIVGSGPPVAAAMFVGLIIALLQALTQIQETTLTFVPKIVVIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L    PFIG QI +F   V  RI+  
Sbjct: 61 VLSFGGPFIGAQIFAFTEHVYGRIEKG 87


>gi|167040313|ref|YP_001663298.1| flagellar biosynthesis protein FliQ [Thermoanaerobacter sp. X514]
 gi|256750757|ref|ZP_05491642.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus CCSD1]
 gi|300914397|ref|ZP_07131713.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X561]
 gi|307724367|ref|YP_003904118.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X513]
 gi|166854553|gb|ABY92962.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X514]
 gi|256750340|gb|EEU63359.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus CCSD1]
 gi|300889332|gb|EFK84478.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X561]
 gi|307581428|gb|ADN54827.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter sp. X513]
          Length = 89

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L  ++P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGVVIDIGREALTVALKVASPLLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +LI+  P++   + ++   +   I + +
Sbjct: 61 SLILFGPWMLTTLVNYTQRLFLNINNFI 88


>gi|307264884|ref|ZP_07546446.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter wiegelii
          Rt8.B1]
 gi|306920142|gb|EFN50354.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter wiegelii
          Rt8.B1]
          Length = 89

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L  + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGMVIDIGREALTIALKVATPLLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +LI+  P++   + ++   +   I + +
Sbjct: 61 SLILFGPWMLTTLVNYTQRLFLNINNFI 88


>gi|85716545|ref|ZP_01047515.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85696546|gb|EAQ34434.1| flagellar biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 105

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 37/87 (42%), Positives = 60/87 (68%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           M  A+ L++AR A+WTI+  S P+L   + +G+ I+ +QALTQIQE TL FVPKI+A+F+
Sbjct: 19  MTGAETLDVARDAIWTIVLVSGPLLGVGLIVGVAISLVQALTQIQEQTLVFVPKILAIFV 78

Query: 61  TLIISAPFIGGQISSFVTLVLSRIQSS 87
           T++++ PF+   + + +  + SRI   
Sbjct: 79  TMVLALPFMADALHAEMIRISSRIIGG 105


>gi|288553048|ref|YP_003424983.1| flagellar biosynthesis protein FliQ [Bacillus pseudofirmus OF4]
 gi|288544208|gb|ADC48091.1| flagellar biosynthesis protein FliQ [Bacillus pseudofirmus OF4]
          Length = 89

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A   +WT+L  + P+L  A+ LG+L++  QA TQIQE TL F+PKI+ V  
Sbjct: 1  MSSEFVISMAENGVWTVLIVAGPLLIVALGLGLLVSIFQATTQIQEQTLAFIPKIVGVLA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I  P++  Q+++F   + S +   +
Sbjct: 61 SLVIFGPWMLSQVTNFAYQIFSNLHRFI 88


>gi|311030114|ref|ZP_07708204.1| flagellar biosynthesis protein FliQ [Bacillus sp. m3-13]
          Length = 89

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A   ++TIL  SAP+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSPEFVISMAERGVYTILLISAPLLILALVVGLIVSIFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P++   + S+   + + I   +
Sbjct: 61 GLVVFGPWMLSNMLSYALEIFNNIHRYV 88


>gi|288942624|ref|YP_003444864.1| flagellar biosynthetic protein FliQ [Allochromatium vinosum DSM
          180]
 gi|288897996|gb|ADC63832.1| flagellar biosynthetic protein FliQ [Allochromatium vinosum DSM
          180]
          Length = 89

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++ + A   I+  SAP L + + +G++I+  QA TQIQE+TLTF+PK++ V  
Sbjct: 1  MTPEMVLDVGKEAGEVIILMSAPPLLAGLIIGLIISLFQAATQIQEMTLTFIPKLVGVGA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           LI + P++   ++ +VT +   I   +
Sbjct: 61 ALIFAGPWMLTLVTDYVTRLYESIPGMI 88


>gi|78358621|ref|YP_390070.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          subsp. desulfuricans str. G20]
 gi|78221026|gb|ABB40375.1| flagellar biosynthetic protein FliQ [Desulfovibrio desulfuricans
          subsp. desulfuricans str. G20]
          Length = 89

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+   L+ S P+L   + +G+ ++ +QA TQIQE TL+F+PKI+++F+
Sbjct: 1  MTPEFVVGFARQAIELALTISLPMLGIGLAVGVFVSVIQAATQIQETTLSFIPKIVSIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++S P+I  ++ +F   V   I + +
Sbjct: 61 ALLVSFPWIMDKMLAFTREVFINIPNYV 88


>gi|17548595|ref|NP_521935.1| flagellar biosynthesis protein FliQ [Ralstonia solanacearum
          GMI1000]
 gi|17430843|emb|CAD17525.1| probable flagellar biosynthetic fliq transmembrane protein
          [Ralstonia solanacearum GMI1000]
          Length = 89

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLNMARQAMQVAMMIGAPMLLVSLIVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+I++ P++ G I  +   VL+ I + +
Sbjct: 61 TMILAGPWVLGVIVDYTRDVLTNIPNYV 88


>gi|260438789|ref|ZP_05792605.1| flagellar biosynthetic protein FliQ [Butyrivibrio crossotus DSM
          2876]
 gi|292808778|gb|EFF67983.1| flagellar biosynthetic protein FliQ [Butyrivibrio crossotus DSM
          2876]
          Length = 91

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 59/88 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  +++I+R A++ I+  SAP+L  ++ +G++I+  Q +T IQE TLTFVPKIIAVFI
Sbjct: 1  MSEQQIIDISRKALYLIIQCSAPILIISLVVGLVISIFQTMTSIQEQTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++   ++   I+S++  + S     +
Sbjct: 61 GVMLFGSWMLNNITSYMNELWSNFNMYI 88


>gi|152979930|ref|YP_001353120.1| FliQ component of flagellar biosynthesis pathway
          [Janthinobacterium sp. Marseille]
 gi|151280007|gb|ABR88417.1| FliQ component of flagellar biosynthesis pathway
          [Janthinobacterium sp. Marseille]
          Length = 98

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 52/85 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R A+   L  +AP+L  A+ +G++++  QA TQI E TL+F+PK+I +F+
Sbjct: 10 MTPETVMTMGRHAIEVTLMVAAPMLLVALGIGLIVSIFQAATQINETTLSFIPKLIGIFV 69

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           L+++ P++   +  ++  + + I 
Sbjct: 70 ALVVAGPWMLTVLLDYMREMFTNIP 94


>gi|295706269|ref|YP_003599344.1| flagellar biosynthetic protein FliQ [Bacillus megaterium DSM 319]
 gi|294803928|gb|ADF40994.1| flagellar biosynthetic protein FliQ [Bacillus megaterium DSM 319]
          Length = 89

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A   ++TIL  S P+L  A+ +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MNGEFVISLAEKGVYTILIVSGPLLLLALVVGLIISIFQATTQIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++  ++ SF   + S +
Sbjct: 61 GIVFFGPWMLSKMISFTHEIFSNL 84


>gi|167464151|ref|ZP_02329240.1| FliQ [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322382377|ref|ZP_08056284.1| flagellar biosynthesis protein FliQ [Paenibacillus larvae subsp.
          larvae B-3650]
 gi|321153730|gb|EFX46105.1| flagellar biosynthesis protein FliQ [Paenibacillus larvae subsp.
          larvae B-3650]
          Length = 89

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 58/88 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++++A  A++T+L +S P+L  A+ +G+L++  QA TQIQE TL FVPKIIAV +
Sbjct: 1  MSSEFIIKLAGDAVYTVLKASGPMLIIALVVGLLVSIFQATTQIQEQTLAFVPKIIAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++II  P+I   +  +   +L+ +   +
Sbjct: 61 SVIIFGPWILNTLVDYTFNLLNNLHRFI 88


>gi|90422630|ref|YP_531000.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisB18]
 gi|90104644|gb|ABD86681.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          BisB18]
          Length = 88

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 42/88 (47%), Positives = 61/88 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+I + A+WTI+  S P + +AM +G+ IA LQALTQ+QE+TLTF+PKI+ + I
Sbjct: 1  MNERDALDIVQQAIWTIIVVSGPAVGAAMAVGVAIALLQALTQVQEMTLTFIPKIVVMLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + +S  F+G  I +F  L+ SRI+   
Sbjct: 61 VVAVSGSFMGAHIYAFTELLYSRIEHGF 88


>gi|110632634|ref|YP_672842.1| flagellar biosynthesis protein FliQ [Mesorhizobium sp. BNC1]
 gi|110283618|gb|ABG61677.1| flagellar biosynthetic protein FliQ [Chelativorans sp. BNC1]
          Length = 88

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 66/88 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +S P +  AM +G+ IA +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAIWTVLLASGPAVIVAMVVGVGIALVQALTQVQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + +S PF+G QISSF  ++  RI++  
Sbjct: 61 AIALSGPFVGTQISSFTNVIFQRIENGF 88


>gi|289578417|ref|YP_003477044.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter italicus
          Ab9]
 gi|297544693|ref|YP_003676995.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter mathranii
          subsp. mathranii str. A3]
 gi|289528130|gb|ADD02482.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter italicus
          Ab9]
 gi|296842468|gb|ADH60984.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter mathranii
          subsp. mathranii str. A3]
          Length = 89

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L+ + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGVVIDIGREALTVTLTVATPLLAVALVVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +LI+  P++   + ++   +   I + +
Sbjct: 61 SLILFGPWMLTTLVNYTQRLFLNINNFI 88


>gi|90415341|ref|ZP_01223275.1| Flagellar biosynthesis/type III secretory pathway protein [marine
          gamma proteobacterium HTCC2207]
 gi|90332664|gb|EAS47834.1| Flagellar biosynthesis/type III secretory pathway protein [marine
          gamma proteobacterium HTCC2207]
          Length = 89

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A V+++ R A+W  +  ++P+L  A+ +G+++   QA T IQE+TL+F+PK+  + +
Sbjct: 1  MDPALVIDLGREALWVAVMVASPLLGVALGVGLIVGIFQAATSIQEMTLSFIPKLGIMVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+I   +  G +  ++  +  RI +  
Sbjct: 61 ALLIFGSWQIGVMVDYIQRIYERIPALF 88


>gi|309388835|gb|ADO76715.1| flagellar biosynthetic protein FliQ [Halanaerobium praevalens DSM
          2228]
          Length = 89

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M EA VL+I R A++T++    PVL + +  G+L+A  QA TQIQE TL FVPKI AV  
Sbjct: 1  MGEAVVLDIGRQALFTVIIVVFPVLGAGLITGLLVAIFQATTQIQEQTLAFVPKIFAVLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++    P+I   +  FV  +L  I + L
Sbjct: 61 SIAFFGPWIMRTVIEFVQELLRNIPTYL 88


>gi|212639550|ref|YP_002316070.1| flagellar biosynthesis protein FliQ [Anoxybacillus flavithermus
          WK1]
 gi|212561030|gb|ACJ34085.1| Flagellar biosynthesis pathway, component FliQ [Anoxybacillus
          flavithermus WK1]
          Length = 92

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++A   ++ +L    P++  A+ +G+LI+ LQA TQIQE TL FVPKI+AV +
Sbjct: 4  MSPDFVIQVAERGVYMVLVVCGPLMLLALAVGLLISILQATTQIQEQTLAFVPKIVAVLL 63

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L+   P++  ++ S+   + S +
Sbjct: 64 GLVFFGPWMLSRMVSYAYNIFSNL 87


>gi|167037652|ref|YP_001665230.1| flagellar biosynthesis protein FliQ [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|320116067|ref|YP_004186226.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
 gi|326389466|ref|ZP_08211033.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus JW 200]
 gi|166856486|gb|ABY94894.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          pseudethanolicus ATCC 33223]
 gi|319929158|gb|ADV79843.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter brockii
          subsp. finnii Ako-1]
 gi|325994471|gb|EGD52896.1| flagellar biosynthetic protein FliQ [Thermoanaerobacter
          ethanolicus JW 200]
          Length = 89

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V++I R A+   L+ + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+A+ I
Sbjct: 1  MNTGMVIDIGREALTIALTVATPLLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAILI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +LI+  P++   + ++   +   I + +
Sbjct: 61 SLILFGPWMLTTLVNYTQRLFLNINNFI 88


>gi|187926924|ref|YP_001893269.1| flagellar biosynthetic protein FliQ [Ralstonia pickettii 12J]
 gi|241665253|ref|YP_002983612.1| flagellar biosynthesis protein FliQ [Ralstonia pickettii 12D]
 gi|187728678|gb|ACD29842.1| flagellar biosynthetic protein FliQ [Ralstonia pickettii 12J]
 gi|240867280|gb|ACS64940.1| flagellar biosynthetic protein FliQ [Ralstonia pickettii 12D]
          Length = 89

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E +L+F+PK++AV  
Sbjct: 1  MTPEYVLDMARQAMQVAMMVGAPMLLVSLIVGLLVAVFQAATQLNEQSLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T++++ P+I   I  +   +L+ I S +
Sbjct: 61 TMVLAGPWILSVIVDYTRNLLTNIPSYV 88


>gi|119503676|ref|ZP_01625759.1| flagellar biosynthesis protein Q [marine gamma proteobacterium
          HTCC2080]
 gi|119460738|gb|EAW41830.1| flagellar biosynthesis protein Q [marine gamma proteobacterium
          HTCC2080]
          Length = 89

 Score = 72.2 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++ R A+W  +  + P+L +A+ +G+ I  +QA TQIQE+TL+F+PK++A+ +
Sbjct: 1  MGPETVLDLGRDALWLAVLLAGPLLGAALAVGLFIGVIQAATQIQEMTLSFIPKLLALVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL +  P++   +++F   +   I   +
Sbjct: 61 TLFVIGPWMLRILTTFAQRLFMDIPGLV 88


>gi|20807872|ref|NP_623043.1| flagellar biosynthesis protein FliQ [Thermoanaerobacter
          tengcongensis MB4]
 gi|20516436|gb|AAM24647.1| Flagellar biosynthesis/type III secretory pathway protein
          [Thermoanaerobacter tengcongensis MB4]
          Length = 89

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ +  +++ R A+   L+ + P+L  A+ +G+LI+  QA TQIQE TL+FVPKI+AV +
Sbjct: 1  MSSSMAVDLGREALSVALTVATPMLAVALGVGLLISIFQATTQIQEQTLSFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +LI+  P++   + ++   +   I + +
Sbjct: 61 SLILFGPWMLTTLVNYTQRLFLNINNFI 88


>gi|115523199|ref|YP_780110.1| flagellar biosynthesis protein FliQ [Rhodopseudomonas palustris
          BisA53]
 gi|115517146|gb|ABJ05130.1| flagellar biosynthetic protein FliQ [Rhodopseudomonas palustris
          BisA53]
          Length = 88

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 64/88 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+IA+ A+WTI+ +S P + +AMF+GI IA LQALTQ+QE+TLTF+PKI+ + I
Sbjct: 1  MNERDALDIAQQAVWTIIVASGPAVAAAMFVGIAIALLQALTQVQEMTLTFIPKIVVMLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + +S  F+G  I +F  L+ SRI+   
Sbjct: 61 VVAVSGSFMGAHIYAFTELLYSRIEHGF 88


>gi|294500923|ref|YP_003564623.1| flagellar biosynthetic protein FliQ [Bacillus megaterium QM
          B1551]
 gi|294350860|gb|ADE71189.1| flagellar biosynthetic protein FliQ [Bacillus megaterium QM
          B1551]
          Length = 89

 Score = 71.4 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A   ++TIL  S P+L  A+ +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MNGEFVISLAEKGVYTILIVSGPLLLLALVIGLIISIFQATTQIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++  ++ SF   + S +
Sbjct: 61 GIVFFGPWMLSKMISFTYEIFSNL 84


>gi|311695202|gb|ADP98075.1| flagellar biosynthetic protein FliQ [marine bacterium HP15]
          Length = 89

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 48/85 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  ++ ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWMIVLLASIIIGPGLVIGLVVSTFQAATQINEQTLSFLPRLLVTLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           +I+  P++  Q+      +   I 
Sbjct: 61 VIIVWGPWMLTQLLDHANRLFGNIP 85


>gi|295696129|ref|YP_003589367.1| flagellar biosynthetic protein FliQ [Bacillus tusciae DSM 2912]
 gi|295411731|gb|ADG06223.1| flagellar biosynthetic protein FliQ [Bacillus tusciae DSM 2912]
          Length = 89

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 52/88 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+  +VL+I +  +   L  S P L   + +G++I+  QA+TQIQE TLTF+PK++AVF 
Sbjct: 1  MSPDNVLQIGQETLRIALLLSLPFLGFTLVVGLIISIFQAVTQIQEPTLTFLPKVLAVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++  P++   +  +   +  ++   +
Sbjct: 61 VILLLGPWMLHTLLDYTEGIFGQLSGFI 88


>gi|186477689|ref|YP_001859159.1| flagellar biosynthetic protein FliQ [Burkholderia phymatum
          STM815]
 gi|184194148|gb|ACC72113.1| flagellar biosynthetic protein FliQ [Burkholderia phymatum
          STM815]
          Length = 89

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 52/86 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V  +A  AM+  L  +AP LF  + +G++++  QA TQI E TL+F+PK+ A+ +
Sbjct: 1  MTPETVTTLAHEAMYIALLLAAPPLFVGLVVGLIVSLFQAATQINEATLSFIPKLFAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL++  P++  ++  ++  + + I +
Sbjct: 61 TLVLIGPWMLAKMLDYMRHMFTSIPT 86


>gi|300693348|ref|YP_003749321.1| fliq: flagellar biosynthesis protein. fliq/mopd/spaq family
          [Ralstonia solanacearum PSI07]
 gi|299075385|emb|CBJ34680.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum PSI07]
          Length = 89

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLNMARQAMQVAMMIGAPMLLVSLIVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+I++ P++ G I  +   VL  I + +
Sbjct: 61 TMILAGPWVLGVIVDYTRDVLINIPNYV 88


>gi|296445190|ref|ZP_06887150.1| flagellar biosynthetic protein FliQ [Methylosinus trichosporium
          OB3b]
 gi|296257364|gb|EFH04431.1| flagellar biosynthetic protein FliQ [Methylosinus trichosporium
          OB3b]
          Length = 88

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 68/88 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD LEI + A++T+L  S PV+ +AM +G++IA LQALTQ+QE+TLTFVPKIIA+F+
Sbjct: 1  MNEADALEIMQRAIFTVLVVSGPVVGAAMLVGVVIALLQALTQVQEMTLTFVPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L +SAPFIG QIS+F     ++I+   
Sbjct: 61 ALGLSAPFIGSQISAFTDYAYAKIEKGF 88


>gi|220932508|ref|YP_002509416.1| flagellar biosynthetic protein FliQ [Halothermothrix orenii H
          168]
 gi|219993818|gb|ACL70421.1| flagellar biosynthetic protein FliQ [Halothermothrix orenii H
          168]
          Length = 89

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++A V++I R A++ +L   APV+   +  G+L+A  QA TQIQE TL FVPKI+AV I
Sbjct: 1  MDKALVIDIGRNALFVVLKIIAPVIGFGLITGLLVAIFQATTQIQEQTLAFVPKILAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++ I  P++   I  FVT +   I + +
Sbjct: 61 SIAIFGPWMLSTIVDFVTSLFQHIPTYI 88


>gi|222053617|ref|YP_002535979.1| flagellar biosynthetic protein FliQ [Geobacter sp. FRC-32]
 gi|221562906|gb|ACM18878.1| flagellar biosynthetic protein FliQ [Geobacter sp. FRC-32]
          Length = 89

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 51/86 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++AR +  T L  SAP+L  ++ +G+LI+  QA+T I E TL F PKI AV +
Sbjct: 1  MTSDLVVQLARRSFETTLLLSAPLLTFSLVVGLLISIFQAITSINEATLAFAPKIAAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           LII  P++   +S F   + + I +
Sbjct: 61 ALIIFFPWMMSYMSDFTREIYNMIPN 86


>gi|188586036|ref|YP_001917581.1| flagellar biosynthetic protein FliQ [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|179350723|gb|ACB84993.1| flagellar biosynthetic protein FliQ [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 89

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  VL + R A+ T+L ++AP+L SA+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MTEEFVLHLGREALITVLLAAAPMLASALIVGLMVSIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++    P++   ++ F   + S I   +
Sbjct: 61 SVAFFGPWMYTLLTEFAINIFSNINQFI 88


>gi|256833224|ref|YP_003161951.1| flagellar biosynthetic protein FliQ [Jonesia denitrificans DSM
          20603]
 gi|256686755|gb|ACV09648.1| flagellar biosynthetic protein FliQ [Jonesia denitrificans DSM
          20603]
          Length = 90

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I   A+W      AP+L +A+ +G  I+ LQ++TQ+QEVTL+FVPK + V I
Sbjct: 1  MDTTAVLDIGLQALWLTAKLCAPILITALAVGFAISLLQSITQVQEVTLSFVPKALGVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + IS  ++  +  +F   + +RI + L
Sbjct: 61 VIYISGHWMIEETVAFTNEMFNRIPTLL 88


>gi|254517018|ref|ZP_05129076.1| flagellar biosynthetic protein FliQ [gamma proteobacterium
          NOR5-3]
 gi|219674523|gb|EED30891.1| flagellar biosynthetic protein FliQ [gamma proteobacterium
          NOR5-3]
          Length = 89

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + + A+W  +  + P+L SA+ +G+LI   QA TQIQE+TL+F+PK++A+ +
Sbjct: 1  MGPETVLAVGKDALWLAVLLAGPLLLSALAVGLLIGIFQAATQIQEMTLSFIPKLLALVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+++ P++   + SF T +   I S L
Sbjct: 61 ALLVAGPWMIQVVVSFSTRLFREIPSLL 88


>gi|52080239|ref|YP_079030.1| flagellar biosynthesis protein FliQ [Bacillus licheniformis ATCC
          14580]
 gi|52785616|ref|YP_091445.1| flagellar biosynthesis protein FliQ [Bacillus licheniformis ATCC
          14580]
 gi|319645982|ref|ZP_08000212.1| FliQ protein [Bacillus sp. BT1B_CT2]
 gi|52003450|gb|AAU23392.1| flagellar protein [Bacillus licheniformis ATCC 14580]
 gi|52348118|gb|AAU40752.1| FliQ [Bacillus licheniformis ATCC 14580]
 gi|317391732|gb|EFV72529.1| FliQ protein [Bacillus sp. BT1B_CT2]
          Length = 89

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 53/87 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MNSEFVISMAERAVYVTLLISGPLLALALLVGLIVSVFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L++  P++   I SF T + S +   
Sbjct: 61 GLVVFGPWMLSTILSFATELFSNLNRF 87


>gi|304404261|ref|ZP_07385923.1| flagellar biosynthetic protein FliQ [Paenibacillus
          curdlanolyticus YK9]
 gi|304347239|gb|EFM13071.1| flagellar biosynthetic protein FliQ [Paenibacillus
          curdlanolyticus YK9]
          Length = 89

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++TIL +SAP+L   + +G++++  QA TQIQE TL FVPKI+AVF+
Sbjct: 1  MSAEFIIGLAGQAIYTILKASAPMLIIGLVVGLIVSIFQATTQIQEQTLAFVPKIVAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          ++II  P+I   +  F   +L+ +
Sbjct: 61 SMIIFGPWILNTLVDFTFNLLNNL 84


>gi|269796381|ref|YP_003315836.1| flagellar biosynthetic protein FliQ [Sanguibacter keddieii DSM
          10542]
 gi|269098566|gb|ACZ23002.1| flagellar biosynthetic protein FliQ [Sanguibacter keddieii DSM
          10542]
          Length = 90

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ + VL+I    +       APVL +A+ +G  ++ LQ++TQIQEVTL+FVPK IAV +
Sbjct: 1  MDTSAVLDIGVQGLIIAAKLCAPVLITALVVGFAVSLLQSITQIQEVTLSFVPKAIAVSL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+IS  ++  ++ SF   +  RI   L
Sbjct: 61 ALLISGHWMISEMISFTHELFGRIPGLL 88


>gi|319649550|ref|ZP_08003706.1| flagellar biosynthesis protein Q [Bacillus sp. 2_A_57_CT2]
 gi|317398712|gb|EFV79394.1| flagellar biosynthesis protein Q [Bacillus sp. 2_A_57_CT2]
          Length = 89

 Score = 71.0 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 49/84 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ IA   + T+L    P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MTPETVISIAERGIITVLMICGPLLILALVVGLVVSIFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++   + S+   + S +
Sbjct: 61 GVVFFGPWMLSHMLSYANEIFSNL 84


>gi|163758038|ref|ZP_02165126.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43]
 gi|162284327|gb|EDQ34610.1| flagellar biosynthesis protein Q [Hoeflea phototrophica DFL-43]
          Length = 88

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +S P +  AMF+G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQTAIWTVLVASGPAVGVAMFIGVGIAFVQALTQVQEMTLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ +SAPF+G QIS+F  +V  RI+S  
Sbjct: 61 TVAVSAPFVGAQISTFTNIVFQRIESGF 88


>gi|260466597|ref|ZP_05812785.1| flagellar biosynthetic protein FliQ [Mesorhizobium opportunistum
          WSM2075]
 gi|259029603|gb|EEW30891.1| flagellar biosynthetic protein FliQ [Mesorhizobium opportunistum
          WSM2075]
          Length = 88

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L++SAPV+  AM +GI IA +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQVQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + ++ PFIGGQIS+F  ++  RIQ+  
Sbjct: 61 VVALTGPFIGGQISAFTNVIFERIQNGF 88


>gi|302343743|ref|YP_003808272.1| flagellar biosynthetic protein FliQ [Desulfarculus baarsii DSM
          2075]
 gi|301640356|gb|ADK85678.1| flagellar biosynthetic protein FliQ [Desulfarculus baarsii DSM
          2075]
          Length = 89

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   ++  AR  M   L  +APVL   M +G+L++  Q++TQIQE+TLTFVPKI+AV +
Sbjct: 1  MNVDFIIGFARQGMEITLLMAAPVLGVGMVVGLLVSIFQSVTQIQEMTLTFVPKILAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+   P++  ++ ++   ++  I + +
Sbjct: 61 ALLFFGPWMLAKMMNYTESIIQNIPTYI 88


>gi|56419770|ref|YP_147088.1| flagellar biosynthesis protein FliQ [Geobacillus kaustophilus
          HTA426]
 gi|261419435|ref|YP_003253117.1| flagellar biosynthesis protein FliQ [Geobacillus sp. Y412MC61]
 gi|297530590|ref|YP_003671865.1| flagellar biosynthetic protein FliQ [Geobacillus sp. C56-T3]
 gi|319766250|ref|YP_004131751.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y412MC52]
 gi|56379612|dbj|BAD75520.1| flagellar protein required for flagellar formation [Geobacillus
          kaustophilus HTA426]
 gi|261375892|gb|ACX78635.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y412MC61]
 gi|297253842|gb|ADI27288.1| flagellar biosynthetic protein FliQ [Geobacillus sp. C56-T3]
 gi|317111116|gb|ADU93608.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y412MC52]
          Length = 89

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A   ++ +L    P+L  ++ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSADFIIRLAEQGVYIVLVVCGPLLLLSLAVGLVVSIFQAATQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+   P++  ++ S+   + + + S +
Sbjct: 61 GLVFFGPWMLSKMVSYAHDIFNNLASFI 88


>gi|27381963|ref|NP_773492.1| flagellar biosynthesis protein FliQ [Bradyrhizobium japonicum
          USDA 110]
 gi|27355133|dbj|BAC52117.1| flagellar biosynthetic protein [Bradyrhizobium japonicum USDA
          110]
          Length = 88

 Score = 70.3 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 63/88 (71%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+I +AA+WTI+ +S P + +AM +G +IA +QALTQIQEVTLTFVPKII + +
Sbjct: 1  MNERDALDIVQAAIWTIIVASGPAVGAAMLVGTIIALIQALTQIQEVTLTFVPKIIVILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + IS  FIG  +S+F  +V S I+   
Sbjct: 61 VVAISGSFIGAHLSTFTEMVYSHIERGF 88


>gi|114320139|ref|YP_741822.1| flagellar biosynthetic protein FliQ [Alkalilimnicola ehrlichii
          MLHE-1]
 gi|114226533|gb|ABI56332.1| flagellar biosynthetic protein FliQ [Alkalilimnicola ehrlichii
          MLHE-1]
          Length = 89

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 46/88 (52%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +E+ + A+   +  + P+L SA+  G+LI   QA TQI E TL+FVPK+  + +
Sbjct: 1  MTPELAIELGKQALTVAVLLAGPILLSALITGLLIGLFQAATQINEQTLSFVPKLGVMAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L I  P++   ++ F   +   I   +
Sbjct: 61 VLFIMTPWMHTILTDFTRQLYRGIPGFI 88


>gi|224370773|ref|YP_002604937.1| FliQ [Desulfobacterium autotrophicum HRM2]
 gi|223693490|gb|ACN16773.1| FliQ [Desulfobacterium autotrophicum HRM2]
          Length = 89

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E A+ A+   +  S P+L   +  G++I+  QA+T IQE+TLTFVPKIIAVF+
Sbjct: 1  MTPEFVIEFAKQAILLTIYLSMPMLGLGLAAGLIISIFQAVTSIQEMTLTFVPKIIAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+  AP++  +++SF   V+  I   +
Sbjct: 61 GLLFFAPWMLDEMTSFTRRVIENIPMYI 88


>gi|239826629|ref|YP_002949253.1| flagellar biosynthesis protein FliQ [Geobacillus sp. WCH70]
 gi|239806922|gb|ACS23987.1| flagellar biosynthetic protein FliQ [Geobacillus sp. WCH70]
          Length = 89

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A   ++ IL    P+L  A+ +G++++  QA+TQIQE TL FVPKI+AV I
Sbjct: 1  MSADFVIHMAERGVYMILIVCGPLLLLALAVGLIVSIFQAMTQIQEQTLAFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           LI   P++  ++ S+   + + +
Sbjct: 61 GLIFFGPWMLSRMVSYAYEIFNNL 84


>gi|170748119|ref|YP_001754379.1| flagellar biosynthesis protein FliQ [Methylobacterium
          radiotolerans JCM 2831]
 gi|170654641|gb|ACB23696.1| flagellar biosynthetic protein FliQ [Methylobacterium
          radiotolerans JCM 2831]
          Length = 88

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 65/88 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D LE+ R+A+WTI+ +S P + +AM +GILIA  QALTQIQEVTLTFVPKI+ V I
Sbjct: 1  MNEIDALELVRSAIWTIIVASGPAVGAAMVVGILIALFQALTQIQEVTLTFVPKIVVVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +I++  F+GGQI +F  +V  RI S  
Sbjct: 61 VMIVTGSFVGGQIYAFTEMVYGRIVSGF 88


>gi|295399825|ref|ZP_06809806.1| flagellar biosynthetic protein FliQ [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|312111663|ref|YP_003989979.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y4.1MC1]
 gi|294978228|gb|EFG53825.1| flagellar biosynthetic protein FliQ [Geobacillus
          thermoglucosidasius C56-YS93]
 gi|311216764|gb|ADP75368.1| flagellar biosynthetic protein FliQ [Geobacillus sp. Y4.1MC1]
          Length = 89

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A   ++ IL  S P+L  ++ +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSADFVIRMAEQGVYAILIVSGPLLLLSLAVGLIISIFQATTQIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+   P++  +I S+   +L+ +   +
Sbjct: 61 GLVFFGPWMLTKIVSYAYEILNNLTKYI 88


>gi|298530623|ref|ZP_07018025.1| flagellar biosynthetic protein FliQ [Desulfonatronospira
          thiodismutans ASO3-1]
 gi|298509997|gb|EFI33901.1| flagellar biosynthetic protein FliQ [Desulfonatronospira
          thiodismutans ASO3-1]
          Length = 89

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 39/88 (44%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+ T L  S P+L   M +GI I+ LQA TQIQE+TLT VPKIIA+F+
Sbjct: 1  MTPEFVVGFARHAIETTLMISLPMLGIGMIVGITISILQAATQIQEMTLTIVPKIIAIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+ S P+I  ++ +F T + + I + +
Sbjct: 61 ALLFSFPWIMEKMVTFTTDLFNNIPNYI 88


>gi|153011502|ref|YP_001372716.1| flagellar biosynthesis protein FliQ [Ochrobactrum anthropi ATCC
          49188]
 gi|239834421|ref|ZP_04682749.1| flagellar biosynthetic protein FliQ [Ochrobactrum intermedium LMG
          3301]
 gi|151563390|gb|ABS16887.1| flagellar biosynthetic protein FliQ [Ochrobactrum anthropi ATCC
          49188]
 gi|239822484|gb|EEQ94053.1| flagellar biosynthetic protein FliQ [Ochrobactrum intermedium LMG
          3301]
          Length = 88

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 65/88 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I  +A+WT+L +S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+
Sbjct: 1  MNEADALDIVNSAIWTVLMASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L ++APF+G QI+SF  L  SRI+   
Sbjct: 61 VLALTAPFVGAQINSFTLLAYSRIEKGF 88


>gi|108757472|ref|YP_630668.1| FliQ/MopD/SpaQ family protein [Myxococcus xanthus DK 1622]
 gi|108461352|gb|ABF86537.1| FliQ/MopD/SpaQ family protein [Myxococcus xanthus DK 1622]
          Length = 87

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 51/80 (63%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          I + A++ +L +SAP +  ++ +G +I+  QA TQIQE TLTF PK++AVF  L ++ P+
Sbjct: 7  ITQEALFLVLVASAPPVLMSLLVGFIISLFQATTQIQEQTLTFAPKVVAVFGVLALAGPW 66

Query: 69 IGGQISSFVTLVLSRIQSSL 88
          IG Q+  F   V  R  + +
Sbjct: 67 IGSQLVRFTFHVFDRFPALI 86


>gi|206603141|gb|EDZ39621.1| flagellar biosynthesis protein FliQ [Leptospirillum sp. Group II
           '5-way CG']
          Length = 112

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 47/86 (54%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           MN    +++   A+   L  + PVL  ++ +G+L++  QA+TQI E TL+F+PK+  V  
Sbjct: 24  MNVQTAIDLTHNALVMALILTLPVLVVSLVIGVLVSLFQAVTQINETTLSFLPKVAGVVG 83

Query: 61  TLIISAPFIGGQISSFVTLVLSRIQS 86
            L++  P++  Q+  +   +   +  
Sbjct: 84  VLLVLMPWMVRQLIDYTATLFRELPG 109


>gi|311068158|ref|YP_003973081.1| flagellar biosynthesis protein FliQ [Bacillus atrophaeus 1942]
 gi|310868675|gb|ADP32150.1| flagellar biosynthesis protein FliQ [Bacillus atrophaeus 1942]
          Length = 89

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 52/87 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLLISGPLLAIALLVGLVVSIFQATTQIQEQTLAFIPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           LI   P++   I SF T + S +   
Sbjct: 61 GLIFFGPWMLSTILSFTTELFSNLNRF 87


>gi|51894126|ref|YP_076817.1| flagellar biosynthetic protein [Symbiobacterium thermophilum IAM
          14863]
 gi|51857815|dbj|BAD41973.1| flagellar biosynthetic protein [Symbiobacterium thermophilum IAM
          14863]
          Length = 89

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     L++A+ A+   L  +APV+  ++ +G++I+  QA TQ+ E +L FVPKI+A   
Sbjct: 1  MTPEFALDLAQEAVRVALYVAAPVIGLSLLVGLIISLFQATTQVHEPSLQFVPKILAAVA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P++   +  F   V+  +   +
Sbjct: 61 GLVVFGPWMLTTLMDFARRVMDLLPRMV 88


>gi|152965633|ref|YP_001361417.1| export protein FliQ family 3 [Kineococcus radiotolerans SRS30216]
 gi|151360150|gb|ABS03153.1| export protein FliQ family 3 [Kineococcus radiotolerans SRS30216]
          Length = 92

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 52/88 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ I   A+      SAP+L +A+ +G  I+  Q++TQ+QE T+ FVPK +AV I
Sbjct: 1  MTDVTVIHIGMTALVLAAKLSAPMLLTALAVGFGISLFQSVTQLQEQTIAFVPKAVAVGI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++   ++  +++ F + +  +I S L
Sbjct: 61 AIVVCGKWMLHELTGFTSTLYGQIPSLL 88


>gi|13472598|ref|NP_104165.1| flagellar biosynthesis protein FliQ [Mesorhizobium loti
          MAFF303099]
 gi|14023344|dbj|BAB49951.1| flagellar biosynthesis protein; FliQ [Mesorhizobium loti
          MAFF303099]
          Length = 88

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L++SAPV+  AM +GI IA +QALTQIQE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQIQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + ++ PFIGGQIS+F  ++  RIQ+  
Sbjct: 61 VVALTGPFIGGQISAFTNVIFQRIQNGF 88


>gi|148266208|ref|YP_001232914.1| flagellar biosynthetic protein FliQ [Geobacter uraniireducens
          Rf4]
 gi|146399708|gb|ABQ28341.1| flagellar biosynthetic protein FliQ [Geobacter uraniireducens
          Rf4]
          Length = 89

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 48/86 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++AR +    L  SAP+L  ++ +G+LI+  QA+T I E TL F PKI AV +
Sbjct: 1  MTPELVVQLARRSFEATLLLSAPLLIFSLVVGLLISIFQAVTSINEATLAFAPKIAAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+I  P++   +  F   +   I +
Sbjct: 61 ALVIFFPWMMSYMGDFTREIYGMIAN 86


>gi|17988509|ref|NP_541142.1| flagellar biosynthesis protein FliQ [Brucella melitensis bv. 1
          str. 16M]
 gi|23500848|ref|NP_700288.1| flagellar biosynthesis protein FliQ [Brucella suis 1330]
 gi|62317951|ref|YP_223804.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 1 str.
          9-941]
 gi|83269928|ref|YP_419219.1| flagellar biosynthesis protein FliQ [Brucella melitensis biovar
          Abortus 2308]
 gi|148558765|ref|YP_001257998.1| flagellar biosynthesis protein FliQ [Brucella ovis ATCC 25840]
 gi|161621176|ref|YP_001595062.1| flagellar biosynthesis protein FliQ [Brucella canis ATCC 23365]
 gi|163845451|ref|YP_001623106.1| flagellar biosynthesis protein FliQ [Brucella suis ATCC 23445]
 gi|225628423|ref|ZP_03786457.1| flagellar biosynthetic protein FliQ [Brucella ceti str. Cudo]
 gi|225686879|ref|YP_002734851.1| flagellar biosynthesis protein FliQ [Brucella melitensis ATCC
          23457]
 gi|237817496|ref|ZP_04596487.1| flagellar biosynthetic protein FliQ [Brucella abortus str. 2308
          A]
 gi|254691617|ref|ZP_05154871.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 6 str.
          870]
 gi|254695087|ref|ZP_05156915.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 3 str.
          Tulya]
 gi|254698183|ref|ZP_05160011.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254699257|ref|ZP_05161085.1| flagellar biosynthesis protein FliQ [Brucella suis bv. 5 str.
          513]
 gi|254702377|ref|ZP_05164205.1| flagellar biosynthesis protein FliQ [Brucella suis bv. 3 str.
          686]
 gi|254711213|ref|ZP_05173024.1| flagellar biosynthesis protein FliQ [Brucella pinnipedialis
          B2/94]
 gi|254711812|ref|ZP_05173623.1| flagellar biosynthesis protein FliQ [Brucella ceti M644/93/1]
 gi|254714881|ref|ZP_05176692.1| flagellar biosynthesis protein FliQ [Brucella ceti M13/05/1]
 gi|254720779|ref|ZP_05182590.1| flagellar biosynthesis protein FliQ [Brucella sp. 83/13]
 gi|254731628|ref|ZP_05190206.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 4 str.
          292]
 gi|256015892|ref|YP_003105901.1| flagellar biosynthesis protein FliQ [Brucella microti CCM 4915]
 gi|256030158|ref|ZP_05443772.1| flagellar biosynthesis protein FliQ [Brucella pinnipedialis
          M292/94/1]
 gi|256042860|ref|ZP_05445806.1| flagellar biosynthesis protein FliQ [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256059810|ref|ZP_05450005.1| flagellar biosynthesis protein FliQ [Brucella neotomae 5K33]
 gi|256112182|ref|ZP_05453103.1| flagellar biosynthesis protein FliQ [Brucella melitensis bv. 3
          str. Ether]
 gi|256158337|ref|ZP_05456241.1| flagellar biosynthesis protein FliQ [Brucella ceti M490/95/1]
 gi|256252729|ref|ZP_05458265.1| flagellar biosynthesis protein FliQ [Brucella ceti B1/94]
 gi|256256804|ref|ZP_05462340.1| flagellar biosynthesis protein FliQ [Brucella abortus bv. 9 str.
          C68]
 gi|256261984|ref|ZP_05464516.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 2
          str. 63/9]
 gi|260166790|ref|ZP_05753601.1| flagellar biosynthesis protein FliQ [Brucella sp. F5/99]
 gi|260544136|ref|ZP_05819957.1| flagellar biosynthetic protein FliQ [Brucella abortus NCTC 8038]
 gi|260564097|ref|ZP_05834582.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. 16M]
 gi|260568720|ref|ZP_05839189.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 4 str. 40]
 gi|260757248|ref|ZP_05869596.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 6 str.
          870]
 gi|260759387|ref|ZP_05871735.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 4 str.
          292]
 gi|260762630|ref|ZP_05874962.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260883052|ref|ZP_05894666.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 9 str.
          C68]
 gi|261215438|ref|ZP_05929719.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 3 str.
          Tulya]
 gi|261216571|ref|ZP_05930852.1| flagellar biosynthetic protein FliQ [Brucella ceti M13/05/1]
 gi|261219807|ref|ZP_05934088.1| flagellar biosynthetic protein FliQ [Brucella ceti B1/94]
 gi|261318804|ref|ZP_05958001.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          B2/94]
 gi|261319441|ref|ZP_05958638.1| flagellar biosynthetic protein FliQ [Brucella ceti M644/93/1]
 gi|261323790|ref|ZP_05962987.1| flagellar biosynthetic protein FliQ [Brucella neotomae 5K33]
 gi|261749696|ref|ZP_05993405.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 5 str.
          513]
 gi|261752940|ref|ZP_05996649.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 3 str.
          686]
 gi|261756167|ref|ZP_05999876.1| flagellar biosynthetic protein FliQ [Brucella sp. F5/99]
 gi|265985837|ref|ZP_06098572.1| flagellar biosynthetic protein FliQ [Brucella sp. 83/13]
 gi|265987189|ref|ZP_06099746.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M292/94/1]
 gi|265989295|ref|ZP_06101852.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. Rev.1]
 gi|265993609|ref|ZP_06106166.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 3
          str. Ether]
 gi|265996852|ref|ZP_06109409.1| flagellar biosynthetic protein FliQ [Brucella ceti M490/95/1]
 gi|294852962|ref|ZP_06793634.1| flagellar biosynthetic protein FliQ [Brucella sp. NVSL 07-0026]
 gi|297250157|ref|ZP_06933858.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 5 str.
          B3196]
 gi|306845413|ref|ZP_07477987.1| flagellar biosynthetic protein FliQ [Brucella sp. BO1]
 gi|17984301|gb|AAL53406.1| flagellar biosynthetic protein fliq [Brucella melitensis bv. 1
          str. 16M]
 gi|23464512|gb|AAN34293.1| flagellar biosynthesis protein FliQ [Brucella suis 1330]
 gi|62198144|gb|AAX76443.1| FliQ, flagellar biosynthesis protein [Brucella abortus bv. 1 str.
          9-941]
 gi|82940202|emb|CAJ13258.1| Bacterial export protein FliQ, family 3:Flagellar biosynthesis
          protein FliQ [Brucella melitensis biovar Abortus 2308]
 gi|148370050|gb|ABQ62922.1| flagellar biosynthetic protein FliQ [Brucella ovis ATCC 25840]
 gi|161337987|gb|ABX64291.1| flagellar biosynthetic protein FliQ [Brucella canis ATCC 23365]
 gi|163676174|gb|ABY40284.1| flagellar biosynthetic protein FliQ [Brucella suis ATCC 23445]
 gi|225616269|gb|EEH13317.1| flagellar biosynthetic protein FliQ [Brucella ceti str. Cudo]
 gi|225642984|gb|ACO02897.1| flagellar biosynthetic protein FliQ [Brucella melitensis ATCC
          23457]
 gi|237787331|gb|EEP61548.1| flagellar biosynthetic protein FliQ [Brucella abortus str. 2308
          A]
 gi|255998552|gb|ACU50239.1| flagellar biosynthesis protein FliQ [Brucella microti CCM 4915]
 gi|260097407|gb|EEW81281.1| flagellar biosynthetic protein FliQ [Brucella abortus NCTC 8038]
 gi|260151740|gb|EEW86833.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. 16M]
 gi|260155385|gb|EEW90466.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 4 str. 40]
 gi|260669705|gb|EEX56645.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 4 str.
          292]
 gi|260673051|gb|EEX59872.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260677356|gb|EEX64177.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 6 str.
          870]
 gi|260872580|gb|EEX79649.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 9 str.
          C68]
 gi|260917045|gb|EEX83906.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 3 str.
          Tulya]
 gi|260918391|gb|EEX85044.1| flagellar biosynthetic protein FliQ [Brucella ceti B1/94]
 gi|260921660|gb|EEX88228.1| flagellar biosynthetic protein FliQ [Brucella ceti M13/05/1]
 gi|261292131|gb|EEX95627.1| flagellar biosynthetic protein FliQ [Brucella ceti M644/93/1]
 gi|261298027|gb|EEY01524.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          B2/94]
 gi|261299770|gb|EEY03267.1| flagellar biosynthetic protein FliQ [Brucella neotomae 5K33]
 gi|261736151|gb|EEY24147.1| flagellar biosynthetic protein FliQ [Brucella sp. F5/99]
 gi|261739449|gb|EEY27375.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 5 str.
          513]
 gi|261742693|gb|EEY30619.1| flagellar biosynthetic protein FliQ [Brucella suis bv. 3 str.
          686]
 gi|262551149|gb|EEZ07310.1| flagellar biosynthetic protein FliQ [Brucella ceti M490/95/1]
 gi|262764479|gb|EEZ10511.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 3
          str. Ether]
 gi|262999964|gb|EEZ12654.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 1
          str. Rev.1]
 gi|263091468|gb|EEZ16004.1| flagellar biosynthetic protein FliQ [Brucella melitensis bv. 2
          str. 63/9]
 gi|264659386|gb|EEZ29647.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M292/94/1]
 gi|264664429|gb|EEZ34690.1| flagellar biosynthetic protein FliQ [Brucella sp. 83/13]
 gi|294818617|gb|EFG35617.1| flagellar biosynthetic protein FliQ [Brucella sp. NVSL 07-0026]
 gi|297174026|gb|EFH33390.1| flagellar biosynthetic protein FliQ [Brucella abortus bv. 5 str.
          B3196]
 gi|306274156|gb|EFM55972.1| flagellar biosynthetic protein FliQ [Brucella sp. BO1]
 gi|326411297|gb|ADZ68361.1| flagellar biosynthesis protein FliQ [Brucella melitensis M28]
 gi|326554586|gb|ADZ89225.1| flagellar biosynthesis protein FliQ [Brucella melitensis M5-90]
          Length = 88

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 66/88 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I  +A+WT+L++S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+
Sbjct: 1  MNEADALDIVNSAIWTVLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L ++APF+G QI++F  L  SRI+   
Sbjct: 61 VLALTAPFVGAQINAFTLLAYSRIEKGF 88


>gi|88704276|ref|ZP_01101990.1| Bacterial export protein FliQ, family 3 [Congregibacter litoralis
          KT71]
 gi|88701327|gb|EAQ98432.1| Bacterial export protein FliQ, family 3 [Congregibacter litoralis
          KT71]
          Length = 89

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL + + A+W  +  + P+L SA+ +G+LI   QA TQIQE+TL+F+PK++A+ +
Sbjct: 1  MGPETVLAVGQDALWLAVLLAGPLLLSALAVGLLIGIFQAATQIQEMTLSFIPKLLALVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L ++ P++   + SF   +   I S L
Sbjct: 61 ALFVAGPWMIQVVVSFSRRLFLEIPSLL 88


>gi|251797427|ref|YP_003012158.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. JDR-2]
 gi|247545053|gb|ACT02072.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. JDR-2]
          Length = 89

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 57/84 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A+ T+L +SAP+L  A+ +G++I+  QA TQIQE TL FVPKI+AVF+
Sbjct: 1  MSADFIIGLAGQAISTVLKASAPMLVLALVVGLIISIFQATTQIQEQTLAFVPKIVAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +LII  P+I   I  F   +L+ +
Sbjct: 61 SLIIFGPWILNVIVDFTYNLLNNL 84


>gi|326204609|ref|ZP_08194465.1| flagellar biosynthetic protein FliQ [Clostridium papyrosolvens
          DSM 2782]
 gi|325985176|gb|EGD46016.1| flagellar biosynthetic protein FliQ [Clostridium papyrosolvens
          DSM 2782]
          Length = 89

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E+ ++ IA+ A+  IL  SAP+L  +M +G++I+  QA TQIQE TLTFVPKI++V  
Sbjct: 1  MDESSIINIAQEALKVILYVSAPILVISMVVGLVISIFQATTQIQEQTLTFVPKILSVVA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + +   ++   +  +   +   I   +
Sbjct: 61 AIALFGSWMLRVLIEYTQNIFININQFI 88


>gi|261855325|ref|YP_003262608.1| flagellar biosynthetic protein FliQ [Halothiobacillus
          neapolitanus c2]
 gi|261835794|gb|ACX95561.1| flagellar biosynthetic protein FliQ [Halothiobacillus
          neapolitanus c2]
          Length = 89

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL++ R AM  IL  S P+L +A+ +G+L+   QA TQI E+TL+F+PK+ AV +
Sbjct: 1  MSPDTVLDLTRQAMVIILLLSMPILLTALAVGLLVGMFQAATQINEMTLSFIPKLFAVVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++++ P++   +  F T +  RI   +
Sbjct: 61 AILLAGPWMLHLLVDFTTDLFHRIPGLI 88


>gi|222084891|ref|YP_002543420.1| flagellar biosynthesis transmembrane protein [Agrobacterium
          radiobacter K84]
 gi|221722339|gb|ACM25495.1| flagellar biosynthesis transmembrane protein [Agrobacterium
          radiobacter K84]
          Length = 88

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT+L +S P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV +
Sbjct: 1  MNEADALDIFQAAIWTVLVASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ ISAPF+G QIS F  LV SRIQS  
Sbjct: 61 TVGISAPFVGSQISIFTNLVFSRIQSGF 88


>gi|256376456|ref|YP_003100116.1| export protein FliQ family 3 [Actinosynnema mirum DSM 43827]
 gi|255920759|gb|ACU36270.1| export protein FliQ family 3 [Actinosynnema mirum DSM 43827]
          Length = 90

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  V+E+   AM      +APVL +A+ +G  I+  Q++TQIQEVTL+FVPK   V +
Sbjct: 1  MNDTTVVELGSNAMMITAKLAAPVLLTALLIGFTISLFQSVTQIQEVTLSFVPKAAGVCV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++S  ++  +I +F T +  RI S +
Sbjct: 61 ALLLSGSWMVHEIITFTTDLFGRIPSLV 88


>gi|319781659|ref|YP_004141135.1| flagellar biosynthetic protein FliQ [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317167547|gb|ADV11085.1| flagellar biosynthetic protein FliQ [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 88

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 68/88 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I + A+WT+L +SAPV+  AM +GI IA +QALTQ+QE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIVQYAVWTVLVASAPVVLVAMVVGIGIALIQALTQVQEITLTFVPKIVAIML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + ++ PFIG QIS+F  ++  RIQ+  
Sbjct: 61 VVALTGPFIGSQISAFTNVIFERIQNGF 88


>gi|126653732|ref|ZP_01725650.1| flagellar biosynthesis protein Q [Bacillus sp. B14905]
 gi|126589696|gb|EAZ83832.1| flagellar biosynthesis protein Q [Bacillus sp. B14905]
          Length = 89

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 51/88 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  A+  IL +S P+L  A+  G+ ++  QA T IQE TL FVPKIIAVF+
Sbjct: 1  MTGELVISVAERAIMIILLTSGPLLLVALITGLAVSIFQATTSIQEQTLAFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++   P++  Q++S+   +   +   +
Sbjct: 61 AIVFFGPWMLSQVTSYARDIFENLTRYI 88


>gi|332702321|ref|ZP_08422409.1| flagellar biosynthetic protein FliQ [Desulfovibrio africanus str.
          Walvis Bay]
 gi|332552470|gb|EGJ49514.1| flagellar biosynthetic protein FliQ [Desulfovibrio africanus str.
          Walvis Bay]
          Length = 89

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  AR A+   L+ S P+L   M +GI ++ LQA TQIQE+TLTFVPKIIA+FI
Sbjct: 1  MTPEFVIGFARQAIELTLTISLPLLGIGMIVGIFVSVLQAATQIQEMTLTFVPKIIAIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P+I  ++ ++   +L    S L
Sbjct: 61 ALLLFFPWIMDKMITYTRDLLINFPSYL 88


>gi|39545584|gb|AAR27891.1| AscS [Aeromonas hydrophila]
          Length = 105

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 53/85 (62%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           M+ AD+L      +W +L  S P +  A  +G L++ LQALTQIQE TL FV K+IAV I
Sbjct: 18  MSHADILHFTSQTLWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLIAVVI 77

Query: 61  TLIISAPFIGGQISSFVTLVLSRIQ 85
           TL  +  ++G ++ SF  +VL ++ 
Sbjct: 78  TLFATTAWLGNELYSFADMVLFKVP 102


>gi|254473481|ref|ZP_05086878.1| flagellar biosynthetic protein FliQ [Pseudovibrio sp. JE062]
 gi|211957597|gb|EEA92800.1| flagellar biosynthetic protein FliQ [Pseudovibrio sp. JE062]
          Length = 88

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 65/88 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I R A+WT+++++ P +  AMF+G++IA  QALTQIQE+TLTF+PKI+ +FI
Sbjct: 1  MNEADALDIVRTAIWTVITATGPAVAGAMFVGLIIALFQALTQIQEMTLTFIPKIVVIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + ++ PFIG QI S   +V  RI+   
Sbjct: 61 LIAMTGPFIGSQIFSLTEMVYGRIEHGF 88


>gi|308173599|ref|YP_003920304.1| flagellar export protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606463|emb|CBI42834.1| component of the flagellar export machinery [Bacillus
          amyloliquefaciens DSM 7]
 gi|328553469|gb|AEB23961.1| flagellar biosynthesis protein FliQ [Bacillus amyloliquefaciens
          TA208]
          Length = 89

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 51/87 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L    P+L  A+ +G+L++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLMICGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           LI   P++   I SF T + S +   
Sbjct: 61 GLIFFGPWMLSTILSFTTDLFSHLNRF 87


>gi|121602368|ref|YP_989377.1| flagellar biosynthesis protein FliQ [Bartonella bacilliformis
          KC583]
 gi|120614545|gb|ABM45146.1| flagellar biosynthetic protein FliQ [Bartonella bacilliformis
          KC583]
          Length = 88

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 68/88 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WT+L +S P + +AM +GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTVLIASGPAVLAAMSVGIIIALFQALTQIQEMTLTFIPKIIVIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIEAGF 88


>gi|304316892|ref|YP_003852037.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302778394|gb|ADL68953.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 89

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 57/88 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I R A+   +  SAP+L  ++ +G++I+  QA TQIQE TLTFVPKI+A+F 
Sbjct: 1  MDPGVVLDIGREALMVTMIVSAPLLIVSLLIGLIISIFQATTQIQEQTLTFVPKILAIFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++I+  P++   + ++   ++  I + +
Sbjct: 61 SIILFGPWMLTILINYTQKLILNINNFI 88


>gi|237653573|ref|YP_002889887.1| flagellar biosynthesis protein FliQ [Thauera sp. MZ1T]
 gi|237624820|gb|ACR01510.1| flagellar biosynthetic protein FliQ [Thauera sp. MZ1T]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 57/88 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E+ R A+   L  SAP+  +A+  G++I+  QA TQI E+TL+FVPK++A+F+
Sbjct: 1  MTPTTVIELGRQAIEVTLMVSAPLFLAALVTGLIISIFQAATQINEMTLSFVPKLVAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL+++ P++   ++ F+  +   I + +
Sbjct: 61 TLVLAGPWMITLLTDFIRRLFESIPAMI 88


>gi|319409163|emb|CBI82807.1| Flagellar biosynthetic protein FliQ [Bartonella schoenbuchensis
          R1]
          Length = 88

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 68/88 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL +S P + +AM +GI IA  QALTQ+QE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILIASGPAVLAAMSIGICIALFQALTQVQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L ++APFIGGQI +F  LV +RI++  
Sbjct: 61 VLALTAPFIGGQIYAFTQLVYNRIETGF 88


>gi|149182520|ref|ZP_01860993.1| flagellar biosynthesis protein Q [Bacillus sp. SG-1]
 gi|148849780|gb|EDL63957.1| flagellar biosynthesis protein Q [Bacillus sp. SG-1]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 52/88 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+ +A   ++T L    P+L  A+ +G+ ++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MNAESVIALAERGVYTTLVICGPLLLLALVVGLAVSIFQATTQIQEQTLAFIPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++   P++  ++ ++ + + S +   +
Sbjct: 61 GVVFFGPWMLTKLVTYASDIFSNLNRFV 88


>gi|319407000|emb|CBI80637.1| Flagellar biosynthetic protein fliQ [Bartonella sp. 1-1C]
          Length = 88

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL++S P +F+AM +GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILTASGPAVFAAMSVGIIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|319405427|emb|CBI79046.1| Flagellar biosynthetic protein FliQ [Bartonella sp. AR 15-3]
          Length = 88

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 69/88 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WT+L++S P +F+AM  GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTVLTASGPAVFAAMSTGIIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|205373390|ref|ZP_03226194.1| flagellar biosynthesis protein FliQ [Bacillus coahuilensis m4-4]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   V+++A   ++T L  SAP+L  A+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MNAETVIKLAEQGVYTTLIISAPLLLLALIVGLIVSIFQATTQIQEQTLAFVPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           LI   P++   + ++   +   +   +
Sbjct: 61 GLIFFGPWMLTTLVTYTLNIFQNLSRYI 88


>gi|296133032|ref|YP_003640279.1| flagellar biosynthetic protein FliQ [Thermincola sp. JR]
 gi|296031610|gb|ADG82378.1| flagellar biosynthetic protein FliQ [Thermincola potens JR]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 52/88 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    ++ I R A+ T+L  S P+L +++ +G++I+  QA T IQE TLTFVPKI+ +  
Sbjct: 1  MTPETIIGIGRDALITVLLISTPILATSLLIGVIISVFQAATHIQEQTLTFVPKILGILG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++   ++   + S+ + +   + S +
Sbjct: 61 AIVLFGSWMLNVLLSYTSNIFINLPSYI 88


>gi|317129192|ref|YP_004095474.1| flagellar biosynthetic protein FliQ [Bacillus cellulosilyticus
          DSM 2522]
 gi|315474140|gb|ADU30743.1| flagellar biosynthetic protein FliQ [Bacillus cellulosilyticus
          DSM 2522]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+  V+ +A   ++T++  + P+L +A+ +G+L++  QA TQIQE TL F+PKI+ V +
Sbjct: 1  MNQETVISLAERGVYTVIMIAGPLLITALAIGLLVSIFQATTQIQEQTLAFIPKIVGVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           LI+  P++   I SF   + S +   +
Sbjct: 61 ALIVFGPWMLSIIISFAEQIFSNLHHFI 88


>gi|242281273|ref|YP_002993402.1| flagellar biosynthetic protein FliQ [Desulfovibrio salexigens DSM
          2638]
 gi|242124167|gb|ACS81863.1| flagellar biosynthetic protein FliQ [Desulfovibrio salexigens DSM
          2638]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+  A+ ++   L+ + P+L   + +GI ++ +QA TQIQE+TLTFVPKI+++F+
Sbjct: 1  MTPEFVIGFAKQSIELALTLALPMLMVGLVVGIFVSVIQAATQIQEMTLTFVPKIVSMFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+ + P+I  ++  F   +   + + +
Sbjct: 61 ALLFAFPWIMDKMIDFTRNIFLNLPNYI 88


>gi|225375340|ref|ZP_03752561.1| hypothetical protein ROSEINA2194_00965 [Roseburia inulinivorans
          DSM 16841]
 gi|225212829|gb|EEG95183.1| hypothetical protein ROSEINA2194_00965 [Roseburia inulinivorans
          DSM 16841]
          Length = 90

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 58/87 (66%)

Query: 2  NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
           E  VL+IA+ A++ I+  SAPVL  ++ +G++I+  Q +T IQE TLTFVPKI+AVFI 
Sbjct: 3  TEGQVLDIAKDAIYYIIICSAPVLIISLVVGLIISIFQTVTSIQEQTLTFVPKIVAVFIG 62

Query: 62 LIISAPFIGGQISSFVTLVLSRIQSSL 88
          L++   +I  Q+S FVT + S     L
Sbjct: 63 LMVCGSWILNQLSEFVTTLWSNFSIYL 89


>gi|138894756|ref|YP_001125209.1| flagellar biosynthesis protein FliQ [Geobacillus
          thermodenitrificans NG80-2]
 gi|196247622|ref|ZP_03146324.1| flagellar biosynthetic protein FliQ [Geobacillus sp. G11MC16]
 gi|134266269|gb|ABO66464.1| Flagellar protein required for Flagellar formation [Geobacillus
          thermodenitrificans NG80-2]
 gi|196212406|gb|EDY07163.1| flagellar biosynthetic protein FliQ [Geobacillus sp. G11MC16]
          Length = 89

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A   ++ +L    P+L  ++ +G++++  QA TQIQE TLTFVPKIIAV +
Sbjct: 1  MSADLIIRLAEQGVYIVLIVCGPLLLLSLIVGLVVSIFQAATQIQEQTLTFVPKIIAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P++  ++ S+   + + + S +
Sbjct: 61 GLVLFGPWMLSKMVSYAHDIFNNLASFI 88


>gi|312135837|ref|YP_004003175.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          owensensis OL]
 gi|311775888|gb|ADQ05375.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          owensensis OL]
          Length = 89

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/88 (40%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN   VLEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MNTELVLEIARQAILTAFYVAGPILLVSMVVGIVISILQAATQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I   ++  ++  F   +   I   +
Sbjct: 61 SLLIFGQWMLAKVVEFTRYLWVNINQFI 88


>gi|319403984|emb|CBI77572.1| Flagellar biosynthetic protein FliQ [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 88

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 69/88 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL++S P +F+AM  GI+IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILTASGPAVFAAMSAGIIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|319898662|ref|YP_004158755.1| flagellar biosynthetic protein FliQ [Bartonella clarridgeiae 73]
 gi|319402626|emb|CBI76171.1| Flagellar biosynthetic protein FliQ [Bartonella clarridgeiae 73]
          Length = 88

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 68/88 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD +++  AA+WTIL++S P + +AM  G++IA  QALTQIQE+TLTF+PKII +F+
Sbjct: 1  MNEADAIDMVTAAIWTILTASGPAVLAAMSAGVIIALFQALTQIQEMTLTFIPKIIIIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L  +APF+GGQI +F  LV +RI++  
Sbjct: 61 VLAFTAPFVGGQIYAFTQLVYNRIETGF 88


>gi|121533745|ref|ZP_01665572.1| flagellar biosynthetic protein FliQ [Thermosinus carboxydivorans
          Nor1]
 gi|121307736|gb|EAX48651.1| flagellar biosynthetic protein FliQ [Thermosinus carboxydivorans
          Nor1]
          Length = 89

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    ++I R A+  ++  SAP+L   + +GI+I+  QA TQIQE TL+FVPKIIAVF+
Sbjct: 1  MSGDLAIQIGRDALMMVMLVSAPMLGLGLLVGIIISIFQATTQIQEQTLSFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++  P++   +  +   +   + + +
Sbjct: 61 AILLFGPWMLSLMVDYTRQIFISLPNLI 88


>gi|89098627|ref|ZP_01171509.1| flagellar biosynthesis protein Q [Bacillus sp. NRRL B-14911]
 gi|89086589|gb|EAR65708.1| flagellar biosynthesis protein Q [Bacillus sp. NRRL B-14911]
          Length = 89

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ IA   + ++L  S P+L  A+ +G++++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSPETVISIAEQGIMSVLYISGPLLVLALVVGLIVSIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++   P++   + S+   + S +
Sbjct: 61 GVVFFGPWMLSHMLSYTNEIFSNL 84


>gi|218680427|ref|ZP_03528324.1| flagellar biosynthesis protein FliQ [Rhizobium etli CIAT 894]
          Length = 88

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 69/88 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L +S P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV +
Sbjct: 1  MNEADALDLFQAAIWTVLIASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + ++APF+G Q+S F  LV SRIQS  
Sbjct: 61 VVGVTAPFVGSQVSIFTNLVFSRIQSGF 88


>gi|253573535|ref|ZP_04850878.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. oral taxon
          786 str. D14]
 gi|251847063|gb|EES75068.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. oral taxon
          786 str. D14]
          Length = 89

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 57/88 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++T+L  SAP+L  A+ +G+L++  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MSSEFIIGLAGQAVYTVLKVSAPMLVIALVVGLLVSIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P+I   +  F   +L+ + S +
Sbjct: 61 ALLLFGPWILTTLVDFTYGILNNLSSYI 88


>gi|86356336|ref|YP_468228.1| flagellar biosynthesis protein FliQ [Rhizobium etli CFN 42]
 gi|86280438|gb|ABC89501.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CFN
          42]
          Length = 88

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 51/88 (57%), Positives = 69/88 (78%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L +S P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV +
Sbjct: 1  MNEADALDLFQAAIWTVLIASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + I+APF+G QIS F  LV SRIQS  
Sbjct: 61 VVGITAPFVGSQISIFTNLVFSRIQSGF 88


>gi|78224288|ref|YP_386035.1| flagellar biosynthesis protein FliQ [Geobacter metallireducens
          GS-15]
 gi|78195543|gb|ABB33310.1| Flagellar biosynthesis protein FliQ [Geobacter metallireducens
          GS-15]
          Length = 89

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 52/86 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++AR +    L  SAP+L S + +G+LI+  QA+T IQE TL F PKII V +
Sbjct: 1  MSPDLVVQLARRSFEVTLLLSAPLLISGLVVGLLISIFQAVTSIQEATLAFAPKIIIVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           ++I  P++   +S F   + + I +
Sbjct: 61 AMVIFFPWMMSYMSDFTRELYALIPN 86


>gi|154686053|ref|YP_001421214.1| flagellar biosynthesis protein FliQ [Bacillus amyloliquefaciens
          FZB42]
 gi|154351904|gb|ABS73983.1| FliQ [Bacillus amyloliquefaciens FZB42]
          Length = 89

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 52/87 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L  S P+L  A+ +G+L++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLMISGPLLAIALIVGLLVSIFQATTQIQEQTLAFIPKIVAVML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           LI   P++   I SF T + S +   
Sbjct: 61 GLIFFGPWMLSTILSFTTDLFSHLNRF 87


>gi|254706502|ref|ZP_05168330.1| flagellar biosynthesis protein FliQ [Brucella pinnipedialis
          M163/99/10]
 gi|261313956|ref|ZP_05953153.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M163/99/10]
 gi|261302982|gb|EEY06479.1| flagellar biosynthetic protein FliQ [Brucella pinnipedialis
          M163/99/10]
          Length = 88

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 65/88 (73%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L+I  +A+WT+L++S P + +AM  GI IA  QALTQIQE+TLTFVPKII +F+
Sbjct: 1  MNEVDALDIVNSAIWTVLTASGPAVLAAMLAGIGIALFQALTQIQEMTLTFVPKIIVIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L ++APF+G QI++F  L  SRI+   
Sbjct: 61 VLALTAPFVGAQINAFTLLAYSRIEKGF 88


>gi|157692316|ref|YP_001486778.1| flagellar biosynthesis protein FliQ [Bacillus pumilus SAFR-032]
 gi|194014415|ref|ZP_03053032.1| flagellar biosynthetic protein FliQ [Bacillus pumilus ATCC 7061]
 gi|157681074|gb|ABV62218.1| flagellar biosynthesis protein FliQ [Bacillus pumilus SAFR-032]
 gi|194013441|gb|EDW23006.1| flagellar biosynthetic protein FliQ [Bacillus pumilus ATCC 7061]
          Length = 89

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  +++ +L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV I
Sbjct: 1  MSSEFVITMAERSVYVVLLVSGPLLALALIVGLIVSVFQATTQIQEQTLAFIPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P++   I SF T + S +
Sbjct: 61 GLVVFGPWMLSTIVSFTTELFSNL 84


>gi|291613057|ref|YP_003523214.1| flagellar biosynthetic protein FliQ [Sideroxydans lithotrophicus
          ES-1]
 gi|291583169|gb|ADE10827.1| flagellar biosynthetic protein FliQ [Sideroxydans lithotrophicus
          ES-1]
          Length = 89

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 54/85 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ I + A+   +  SAP L +A+ +G+L++  QA TQI E+TL+F+PK++  F+
Sbjct: 1  MTPESVMTIGQQALELTIMVSAPPLLTALIIGLLVSIFQAATQINELTLSFIPKLLGAFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           LIIS P++ G +  ++T + S I 
Sbjct: 61 VLIISGPWMIGILLDYITRLFSSIP 85


>gi|16078699|ref|NP_389518.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221309514|ref|ZP_03591361.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|221313838|ref|ZP_03595643.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. NCIB 3610]
 gi|221318761|ref|ZP_03600055.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. JH642]
 gi|221323033|ref|ZP_03604327.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          subtilis str. SMY]
 gi|296330851|ref|ZP_06873326.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305674369|ref|YP_003866041.1| flagellar export machinery protein [Bacillus subtilis subsp.
          spizizenii str. W23]
 gi|321315403|ref|YP_004207690.1| flagellar biosynthesis protein FliQ [Bacillus subtilis BSn5]
 gi|544316|sp|P35535|FLIQ_BACSU RecName: Full=Flagellar biosynthetic protein FliQ
 gi|142932|gb|AAA22454.1| flagellar protein [Bacillus subtilis]
 gi|2634008|emb|CAB13509.1| component of the flagellar export machinery [Bacillus subtilis
          subsp. subtilis str. 168]
 gi|296151856|gb|EFG92730.1| flagellar biosynthesis protein FliQ [Bacillus subtilis subsp.
          spizizenii ATCC 6633]
 gi|305412613|gb|ADM37732.1| component of the flagellar export machinery [Bacillus subtilis
          subsp. spizizenii str. W23]
 gi|320021677|gb|ADV96663.1| flagellar biosynthesis protein FliQ [Bacillus subtilis BSn5]
          Length = 89

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 52/87 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A  A++  L  S P+L  A+ +G++++  QA TQIQE TL F+PKI+AV +
Sbjct: 1  MSSEFVISMAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           LI   P++   I SF T + S +   
Sbjct: 61 ALIFFGPWMLSTILSFTTELFSNLNRF 87


>gi|299534770|ref|ZP_07048100.1| flagellar biosynthetic protein [Lysinibacillus fusiformis ZC1]
 gi|298729858|gb|EFI70403.1| flagellar biosynthetic protein [Lysinibacillus fusiformis ZC1]
          Length = 89

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 50/88 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ IA  A+  IL +S P+L  A+  G+ ++  QA T IQE TL FVPKIIAV +
Sbjct: 1  MTGELVISIAERAIMIILLTSGPLLLVALISGLAVSIFQATTSIQEQTLAFVPKIIAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++   P++  Q++S+   +   +   +
Sbjct: 61 AIVFFGPWMLSQVTSYARDIFENLTRYI 88


>gi|120554900|ref|YP_959251.1| flagellar biosynthesis protein FliQ [Marinobacter aquaeolei VT8]
 gi|120324749|gb|ABM19064.1| flagellar biosynthetic protein FliQ [Marinobacter aquaeolei VT8]
          Length = 89

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 50/85 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  SA ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWLIVLLSAVIIGPGLVIGLVVSTFQAATQINEQTLSFLPRLLITLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           +I + P++   +      ++SRI 
Sbjct: 61 VIIAAGPWMLTTLLDHANGLISRIP 85


>gi|209963541|ref|YP_002296456.1| flagellar biosynthesis protein FliQ [Rhodospirillum centenum SW]
 gi|209957007|gb|ACI97643.1| flagellar biosynthesis protein FliQ [Rhodospirillum centenum SW]
          Length = 88

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 40/84 (47%), Positives = 63/84 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADV E+ RA +W  + ++ PVL  A+ +G  I+ LQALTQ+QE TL+FVPKI+A+ +
Sbjct: 1  MNEADVFELVRAGIWAAVWAAGPVLAVALLVGFGISLLQALTQLQEATLSFVPKIVAMLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          T++++ PF+ G +++F   V++RI
Sbjct: 61 TIVLALPFMYGVLATFTEQVVARI 84


>gi|308068669|ref|YP_003870274.1| flagellar biosynthetic protein fliQ [Paenibacillus polymyxa E681]
 gi|310641560|ref|YP_003946318.1| flagellar biosynthetic protein fliq [Paenibacillus polymyxa SC2]
 gi|305857948|gb|ADM69736.1| Flagellar biosynthetic protein fliQ [Paenibacillus polymyxa E681]
 gi|309246510|gb|ADO56077.1| Flagellar biosynthetic protein FliQ [Paenibacillus polymyxa SC2]
          Length = 89

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 51/84 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    ++ +A  A++ +L  SAP+L   + +G++I+  QA TQIQE TL FVPKI+AV +
Sbjct: 1  MTSEFIISLAGQAVYIVLKVSAPMLILGLVVGLIISIFQATTQIQEQTLAFVPKIVAVLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P+I   +  F   +L  +
Sbjct: 61 ALLLFGPWILTTLVDFTYNILDNL 84


>gi|116250506|ref|YP_766344.1| flagellar biosynthesis protein FliQ [Rhizobium leguminosarum bv.
          viciae 3841]
 gi|218461406|ref|ZP_03501497.1| flagellar biosynthesis protein FliQ [Rhizobium etli Kim 5]
 gi|218662877|ref|ZP_03518807.1| flagellar biosynthesis protein FliQ [Rhizobium etli IE4771]
 gi|218671389|ref|ZP_03521059.1| flagellar biosynthesis protein FliQ [Rhizobium etli GR56]
 gi|241203130|ref|YP_002974226.1| flagellar biosynthesis protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM1325]
 gi|115255154|emb|CAK06228.1| flagellar biosynthetic protein FliQ [Rhizobium leguminosarum bv.
          viciae 3841]
 gi|240857020|gb|ACS54687.1| flagellar biosynthetic protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM1325]
          Length = 88

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 51/88 (57%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ ++APF+G QIS F  LV SRIQS  
Sbjct: 61 TVGVTAPFVGSQISIFTNLVFSRIQSGF 88


>gi|54124951|gb|AAV30219.1| AscS [Aeromonas hydrophila]
          Length = 105

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 53/85 (62%)

Query: 1   MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
           M+ AD+L      +W +L  S P +  A  +G L++ LQALTQIQE TL FV K++AV I
Sbjct: 18  MSHADILHFTSQTLWLVLILSMPPVLVAALVGTLVSLLQALTQIQEQTLGFVAKLVAVVI 77

Query: 61  TLIISAPFIGGQISSFVTLVLSRIQ 85
           TL  +  ++G ++ SF  +VL ++ 
Sbjct: 78  TLFATTAWLGNELYSFADMVLLKVP 102


>gi|169827137|ref|YP_001697295.1| flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
 gi|168991625|gb|ACA39165.1| Flagellar biosynthetic protein [Lysinibacillus sphaericus C3-41]
          Length = 89

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 50/88 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A  A+  IL +S P+L  A+  G+ ++  QA T IQE TL FVPKI+AV +
Sbjct: 1  MTGELVISVAERAIMIILLTSGPLLLVALITGLAVSIFQATTSIQEQTLAFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++   P++  Q++S+   +   +   +
Sbjct: 61 AIVFFGPWMLSQVTSYARDIFENLTRYI 88


>gi|323705430|ref|ZP_08117005.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          xylanolyticum LX-11]
 gi|323535332|gb|EGB25108.1| flagellar biosynthetic protein FliQ [Thermoanaerobacterium
          xylanolyticum LX-11]
          Length = 89

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 57/88 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL+I R A+   +  SAP+L  ++ +G++I+  QA TQIQE TLTFVPKI+A+F 
Sbjct: 1  MDPGLVLDIGREALMVTMMVSAPLLIISLLVGLIISIFQATTQIQEQTLTFVPKILAIFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          ++I+  P++   + ++   ++  I S +
Sbjct: 61 SIILFGPWMLTVLINYTQKLILNINSFI 88


>gi|190890388|ref|YP_001976930.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
          652]
 gi|190695667|gb|ACE89752.1| flagellar biosynthesis transmembrane protein [Rhizobium etli CIAT
          652]
 gi|327193066|gb|EGE59978.1| flagellar biosynthesis transmembrane protein [Rhizobium etli
          CNPAF512]
          Length = 88

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQEATLTFVPKILAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ ++APFIG QIS F  LV SRIQS  
Sbjct: 61 TVGVTAPFIGSQISIFTNLVFSRIQSGF 88


>gi|220929451|ref|YP_002506360.1| flagellar biosynthetic protein FliQ [Clostridium cellulolyticum
          H10]
 gi|219999779|gb|ACL76380.1| flagellar biosynthetic protein FliQ [Clostridium cellulolyticum
          H10]
          Length = 89

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E+ ++ IA+ A+  IL  SAP+L  +M +G++I+  QA TQIQE TLTFVPKI++V  
Sbjct: 1  MDESGIINIAQDALKVILYVSAPILLISMIVGLVISIFQATTQIQEQTLTFVPKILSVVA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + +   ++   +  +   +L  I   +
Sbjct: 61 AIAVFGSWMLRVLIEYTQNILININQFI 88


>gi|209547952|ref|YP_002279869.1| flagellar biosynthesis protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209533708|gb|ACI53643.1| flagellar biosynthetic protein FliQ [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 88

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ +AA+WT+L ++ P + +AM +G++IA +QALTQ+QE TLTFVPKI+AV I
Sbjct: 1  MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLIIALIQALTQVQEATLTFVPKIVAVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ ++APF+G Q+S F  LV SRIQS  
Sbjct: 61 TVGVTAPFVGSQVSIFTNLVFSRIQSGF 88


>gi|229827383|ref|ZP_04453452.1| hypothetical protein GCWU000182_02771 [Abiotrophia defectiva ATCC
          49176]
 gi|229788321|gb|EEP24435.1| hypothetical protein GCWU000182_02771 [Abiotrophia defectiva ATCC
          49176]
          Length = 102

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V++I+R  +  IL  SAP+L +++ +G++I+ +Q +T IQE TLTFVPK+I   +
Sbjct: 1  MSVDRVIDISRETVMLILKLSAPMLLASLVVGLIISLIQTITSIQEQTLTFVPKLIVTML 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+++  ++   +S F T + S   + +
Sbjct: 61 MLVLTGGWMMTSLSEFATELFSNFGNYI 88


>gi|329888175|ref|ZP_08266773.1| flagellar biosynthetic protein FliQ [Brevundimonas diminuta ATCC
          11568]
 gi|328846731|gb|EGF96293.1| flagellar biosynthetic protein FliQ [Brevundimonas diminuta ATCC
          11568]
          Length = 87

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A+VL++ R A+W  +    P L  A+ +G+ I   QALTQIQE TL + PKIIA+F+
Sbjct: 1  MSGAEVLDVGRDALWLTIQLCLPALIVALVVGVAIGLFQALTQIQEQTLVYAPKIIAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L++  P +G  +  F+  + +RI  
Sbjct: 61 SLLLFLPLMGALLGGFMREIAARIAG 86


>gi|115377825|ref|ZP_01465013.1| flagellar biosynthetic protein FliQ [Stigmatella aurantiaca
          DW4/3-1]
 gi|310820308|ref|YP_003952666.1| bacterial export protein fliq, family 3 [Stigmatella aurantiaca
          DW4/3-1]
 gi|115365157|gb|EAU64204.1| flagellar biosynthetic protein FliQ [Stigmatella aurantiaca
          DW4/3-1]
 gi|309393380|gb|ADO70839.1| Bacterial export protein FliQ, family 3 [Stigmatella aurantiaca
          DW4/3-1]
          Length = 88

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 50/80 (62%)

Query: 9  IARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISAPF 68
          I + A++ +L  SAP +  ++ +G +IA  QA TQIQE TLTF PK++ VFI L ++ P+
Sbjct: 7  ITQQALFLVLIVSAPPVLISLVVGFIIALFQATTQIQEQTLTFAPKVVIVFIVLAMAGPW 66

Query: 69 IGGQISSFVTLVLSRIQSSL 88
          IG Q+  F   V  R  + +
Sbjct: 67 IGHQLLRFTFHVFDRFPALI 86


>gi|85859181|ref|YP_461383.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
 gi|85722272|gb|ABC77215.1| flagellar biosynthetic protein [Syntrophus aciditrophicus SB]
          Length = 89

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 51/88 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ I   A+   L  + P+L   + +G+ I+  QA+TQ+QE+TL FVPKI+AV +
Sbjct: 1  MTPDFVVGIMAEAIKVTLLVAGPLLIVGLVVGVAISLFQAVTQVQEMTLVFVPKIVAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+ + P++   + +F   + S I + +
Sbjct: 61 ALVATLPWMINLLLTFTHNLYSNIPNYV 88


>gi|312126836|ref|YP_003991710.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          hydrothermalis 108]
 gi|311776855|gb|ADQ06341.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          hydrothermalis 108]
          Length = 89

 Score = 68.0 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VLEIAR A+ T    + P+L  +M +GI+++ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTTLVLEIARQAILTAFYVAGPILLVSMVVGIVVSILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I   ++  ++  F   + + I   +
Sbjct: 61 SLLIFGQWMLTKVVEFTRYLWTNINQFV 88


>gi|322421720|ref|YP_004200943.1| flagellar biosynthetic protein FliQ [Geobacter sp. M18]
 gi|320128107|gb|ADW15667.1| flagellar biosynthetic protein FliQ [Geobacter sp. M18]
          Length = 89

 Score = 68.0 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 50/86 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R +   ++  SAP+L  A+ +G+LI+  QA+T I E TL F PKIIAV +
Sbjct: 1  MTPEMVVQLGRRSFEAVILLSAPLLICALVVGLLISIFQAVTSINEATLAFAPKIIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +++  P++   +S F   +   I +
Sbjct: 61 AMVVFFPWMMMYMSDFTREIYGMIAN 86


>gi|39995532|ref|NP_951483.1| flagellar biosynthetic protein FliQ [Geobacter sulfurreducens
          PCA]
 gi|39982295|gb|AAR33756.1| flagellar biosynthetic protein FliQ [Geobacter sulfurreducens
          PCA]
 gi|298504533|gb|ADI83256.1| flagellar biogenesis protein FliQ [Geobacter sulfurreducens
          KN400]
          Length = 89

 Score = 68.0 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 52/86 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+++AR +    L  +AP+L S + +G+ ++  QA+T IQE TL F PKIIAV +
Sbjct: 1  MSPDLVVQLARRSFEVTLMLAAPLLISGLVVGLAVSIFQAVTSIQEATLAFAPKIIAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+I  P++   +S F   V + I +
Sbjct: 61 ALVIFFPWMMNYMSDFTREVYALIAT 86


>gi|323490155|ref|ZP_08095375.1| flagellar biosynthetic protein FliQ [Planococcus donghaensis
          MPA1U2]
 gi|323396203|gb|EGA89029.1| flagellar biosynthetic protein FliQ [Planococcus donghaensis
          MPA1U2]
          Length = 89

 Score = 68.0 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 56/86 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++A  +++T++  SAP+L  A+ +G+L++  QA+TQIQE TL F+PKI+AVFI
Sbjct: 1  MTPDMVIKLAEQSIFTVILISAPMLLIALAVGLLVSVFQAMTQIQEQTLAFIPKILAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L++  P++   +  +   +  ++  
Sbjct: 61 ALVVFGPWMLTLLLDYTRDLFEQLPR 86


>gi|308273530|emb|CBX30132.1| Flagellar biosynthetic protein fliQ [uncultured Desulfobacterium
          sp.]
          Length = 89

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 58/88 (65%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ +A+ A+ T +  S PVL  A+ +G++I+  QA+TQI E+TLTFVPKI+A+F+
Sbjct: 1  MSPEFVINLAQEAIKTTILVSMPVLLIALVVGLVISIFQAVTQINEMTLTFVPKILAIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           LI+   ++   I++F    + +I + +
Sbjct: 61 GLILFGSWMLEHIATFTINTIQQIPNYI 88


>gi|312792664|ref|YP_004025587.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          kristjanssonii 177R1B]
 gi|312876514|ref|ZP_07736497.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          lactoaceticus 6A]
 gi|311796725|gb|EFR13071.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          lactoaceticus 6A]
 gi|312179804|gb|ADQ39974.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          kristjanssonii 177R1B]
          Length = 89

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 36/88 (40%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A VLEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTALVLEIARQAILTAFYVAGPILLVSMVVGIVISILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I   ++  ++  F   + + I   +
Sbjct: 61 SLLIFGQWMLTKVIEFTRYLWTNINQFV 88


>gi|125973003|ref|YP_001036913.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          ATCC 27405]
 gi|256004800|ref|ZP_05429775.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum DSM
          2360]
 gi|281417214|ref|ZP_06248234.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          JW20]
 gi|125713228|gb|ABN51720.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          ATCC 27405]
 gi|255991250|gb|EEU01357.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum DSM
          2360]
 gi|281408616|gb|EFB38874.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum
          JW20]
 gi|316940761|gb|ADU74795.1| flagellar biosynthetic protein FliQ [Clostridium thermocellum DSM
          1313]
          Length = 89

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+E+A+ A+ T+L  +AP+L  ++ +G+ ++  QA TQIQE TLTF+PKI++V  
Sbjct: 1  MEQGLVMELAQKAIMTVLYVAAPMLGLSLLVGLAVSIFQATTQIQEQTLTFIPKILSVLG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + I  P++   +  F   +   I   +
Sbjct: 61 AIAIFGPWMLRVLIEFTQAIYMNINHYI 88


>gi|197120184|ref|YP_002140611.1| flagellar biogenesis protein FliQ [Geobacter bemidjiensis Bem]
 gi|253702493|ref|YP_003023682.1| flagellar biosynthetic protein FliQ [Geobacter sp. M21]
 gi|197089544|gb|ACH40815.1| flagellar biogenesis protein FliQ [Geobacter bemidjiensis Bem]
 gi|251777343|gb|ACT19924.1| flagellar biosynthetic protein FliQ [Geobacter sp. M21]
          Length = 89

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 50/86 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R +   ++  SAP+L  A+ +G+LI+  QA+T I E TL F PKI+AV +
Sbjct: 1  MTPEMVVQLGRRSFEAVILLSAPLLICALVVGLLISIFQAVTSINEATLAFAPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +++  P++   +S F   +   I +
Sbjct: 61 AMVVFFPWMMMYMSDFTREIYGMIAN 86


>gi|320354333|ref|YP_004195672.1| flagellar biosynthetic protein FliQ [Desulfobulbus propionicus
          DSM 2032]
 gi|320122835|gb|ADW18381.1| flagellar biosynthetic protein FliQ [Desulfobulbus propionicus
          DSM 2032]
          Length = 89

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 40/86 (46%), Positives = 62/86 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ I R A+ TIL +SAP+L +AM +G++I+  QA TQI E T+TF+PKI+AVFI
Sbjct: 1  MSPEAVIHIGRKAVETILLTSAPMLIAAMVIGLIISIFQAATQINEQTMTFIPKIVAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+I  P+I   + +F T ++++I +
Sbjct: 61 TLLIFGPWIMELLITFTTGIINQIAT 86


>gi|254500261|ref|ZP_05112412.1| flagellar biosynthetic protein FliQ [Labrenzia alexandrii DFL-11]
 gi|222436332|gb|EEE43011.1| flagellar biosynthetic protein FliQ [Labrenzia alexandrii DFL-11]
          Length = 88

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 67/88 (76%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L++ R A+WTIL  SAP +  AM +GI IA LQALTQ+QE+TLTF+PKI+A+ +
Sbjct: 1  MNEVDALDLVRTAIWTILIGSAPAIIPAMIVGIGIALLQALTQVQEITLTFIPKIVAILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++I+ PFIGGQ+ +  T++ SRI++  
Sbjct: 61 MIVIAGPFIGGQMYALTTVIYSRIENGF 88


>gi|114777579|ref|ZP_01452560.1| flagellar biosynthetic protein FliQ [Mariprofundus ferrooxydans
          PV-1]
 gi|114552050|gb|EAU54567.1| flagellar biosynthetic protein FliQ [Mariprofundus ferrooxydans
          PV-1]
          Length = 89

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 58/86 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I   A+  +L  S P+L  A+ +GI I+  QA+TQIQE+TLTFVPKIIAVF+
Sbjct: 1  MTPDSVIQIGSEALKVVLMISLPMLGVALVVGIAISLFQAVTQIQEMTLTFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           +I++AP++  Q+ SF   + S I +
Sbjct: 61 AMILAAPWMSDQMISFTRELFSMIPT 86


>gi|255523690|ref|ZP_05390656.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
 gi|296186694|ref|ZP_06855096.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
 gi|255512559|gb|EET88833.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
 gi|296048731|gb|EFG88163.1| flagellar biosynthetic protein FliQ [Clostridium carboxidivorans
          P7]
          Length = 89

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+E  V+ I + A+ T L  SAP+L  ++ +G++I+  QA TQIQE TLTFVPK+IA+ +
Sbjct: 1  MSENMVIGIIKDAIQTGLIVSAPILIISILVGLIISIFQATTQIQEQTLTFVPKLIAIAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
            +++  ++  Q+ +F   + + I  
Sbjct: 61 VGLLTGSWMLHQLVNFTERIFTYIAH 86


>gi|83747644|ref|ZP_00944680.1| FliQ [Ralstonia solanacearum UW551]
 gi|207728357|ref|YP_002256751.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          MolK2]
 gi|207739725|ref|YP_002258118.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          IPO1609]
 gi|300696944|ref|YP_003747605.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum CFBP2957]
 gi|83725696|gb|EAP72838.1| FliQ [Ralstonia solanacearum UW551]
 gi|206591603|emb|CAQ57215.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          MolK2]
 gi|206593107|emb|CAQ60013.1| flagellar biosynthetic protein fliq [Ralstonia solanacearum
          IPO1609]
 gi|299073668|emb|CBJ53188.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum CFBP2957]
          Length = 89

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLNMARQAMQVAMMIGAPMLLVSLVVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T++++ P++ G I  +   VL+ I + +
Sbjct: 61 TMVLAGPWVLGVIVDYTRDVLTNIPNYV 88


>gi|299068761|emb|CBJ40001.1| FliQ: flagellar biosynthesis protein. fliQ/mopD/spaQ family
          [Ralstonia solanacearum CMR15]
          Length = 89

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL +AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLNMARQAMQVAMMVGAPMLLVSLVVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+I++ P++ G I  +   VL+ I + +
Sbjct: 61 TMILAGPWVLGVIVDYTRDVLTNIPNYV 88


>gi|117928066|ref|YP_872617.1| flagellar biosynthetic protein FliQ [Acidothermus cellulolyticus
          11B]
 gi|117648529|gb|ABK52631.1| flagellar biosynthetic protein FliQ [Acidothermus cellulolyticus
          11B]
          Length = 91

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 49/88 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +A  AM       AP+L +++ +G  I+  QA TQIQE TL+FVPKI+AV I
Sbjct: 1  MTDTAVIHLAMQAMVVAAKLCAPILLTSLLVGFGISLFQAATQIQEFTLSFVPKILAVGI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           +++S  ++   +  F   +   +   +
Sbjct: 61 AIVVSGHWMLITLVDFTHQLFRSLPGLI 88


>gi|118589960|ref|ZP_01547364.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614]
 gi|118437457|gb|EAV44094.1| flagellar biosynthesis protein Q [Stappia aggregata IAM 12614]
          Length = 88

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 48/88 (54%), Positives = 68/88 (77%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D L++ R A+WTIL  SAP +  AM +GI+IA LQALTQ+QE+TLTF+PKI+A+ +
Sbjct: 1  MNEVDALDLVRTAIWTILVGSAPAIVPAMIVGIVIALLQALTQVQEITLTFIPKIVAILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++++ PFIGGQI S  TL+ +RI++  
Sbjct: 61 MIVVAGPFIGGQIYSLTTLIYNRIETGF 88


>gi|167645347|ref|YP_001683010.1| flagellar biosynthesis protein FliQ [Caulobacter sp. K31]
 gi|167347777|gb|ABZ70512.1| flagellar biosynthetic protein FliQ [Caulobacter sp. K31]
          Length = 87

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 34/86 (39%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+VL++ R A+W  L   AP+L   + +G+ I   QALTQIQE TL + PKI+A+F+
Sbjct: 1  MTGAEVLDVGRDAIWLTLQLCAPILLVGLVVGVAIGLFQALTQIQEATLVYAPKIVAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L++  P +G  +S F+  +  +I  
Sbjct: 61 ALLLFLPLMGALMSGFMKEIAGKIAG 86


>gi|297584052|ref|YP_003699832.1| flagellar biosynthetic protein FliQ [Bacillus selenitireducens
          MLS10]
 gi|297142509|gb|ADH99266.1| flagellar biosynthetic protein FliQ [Bacillus selenitireducens
          MLS10]
          Length = 89

 Score = 67.2 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 49/82 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+  A   ++T L  + P+L +A+ +G+ ++  QA TQIQE TL F+PKI  V I
Sbjct: 1  MSPEMVIGWAEQGVFTTLLIAGPLLITALAIGLAVSVFQATTQIQEQTLAFIPKIAGVLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           L+I  P++   +++F   + S
Sbjct: 61 ALVIFGPWMLQLLTTFAYDIFS 82


>gi|146282915|ref|YP_001173068.1| flagellar biosynthesis protein FliQ [Pseudomonas stutzeri A1501]
 gi|145571120|gb|ABP80226.1| flagellar biosynthetic protein FliQ [Pseudomonas stutzeri A1501]
 gi|327481255|gb|AEA84565.1| flagellar biosynthesis protein FliQ [Pseudomonas stutzeri DSM
          4166]
          Length = 89

 Score = 67.2 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 47/85 (55%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R  +W        ++  ++ +G+++A  QA TQI E TL+F+P+++ + +
Sbjct: 1  MTPEVAVDLFREGLWMTAMIVGVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLLVMLL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          TLI + P++  ++  +   ++  I 
Sbjct: 61 TLIWAGPWLVRELMEYTQNLVHNIP 85


>gi|88813212|ref|ZP_01128452.1| flagellar biosynthetic protein FliQ [Nitrococcus mobilis Nb-231]
 gi|88789534|gb|EAR20661.1| flagellar biosynthetic protein FliQ [Nitrococcus mobilis Nb-231]
          Length = 89

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 50/88 (56%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    +E+ + A+   +  +AP+L SA+  G++I   QA TQI E T++FVPK+  + +
Sbjct: 1  MSPDLAIELGKQALTVAVLIAAPILLSALAAGLIIGMFQAATQINEQTMSFVPKLAVLVL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL ++AP++   +  F   +   I   +
Sbjct: 61 TLFVAAPWMLQVLLDFTQKLFRGIPGFI 88


>gi|158422277|ref|YP_001523569.1| flagellar biosynthesis protein FliQ [Azorhizobium caulinodans ORS
          571]
 gi|158329166|dbj|BAF86651.1| flagellar biosynthesis protein [Azorhizobium caulinodans ORS 571]
          Length = 88

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 61/88 (69%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ R A+WTIL ++ P + +AM +GI IA +QALTQIQE TLTFVPKIIAV +
Sbjct: 1  MNEADALDVVRNAIWTILLAAGPAVAAAMLVGIFIALIQALTQIQEATLTFVPKIIAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
             ++  F+G QI +F   +  RI S  
Sbjct: 61 VCALTGSFMGSQIMAFTEEIYGRIASGF 88


>gi|240145487|ref|ZP_04744088.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          L1-82]
 gi|257202302|gb|EEV00587.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          L1-82]
 gi|291536020|emb|CBL09132.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          M50/1]
 gi|291538512|emb|CBL11623.1| flagellar biosynthetic protein FliQ [Roseburia intestinalis
          XB6B4]
          Length = 89

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 59/88 (67%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M E  VL++A+ A++TI+  SAP+L  ++ +G++++  Q +T IQE TLTFVPKIIAVF+
Sbjct: 1  MTEGQVLDVAKEAIYTIIICSAPMLIISLVVGLIVSIFQTVTSIQEQTLTFVPKIIAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+I   +I   ++ FVT + S     L
Sbjct: 61 GLMIFGSWILTNLTEFVTTLWSNFSMYL 88


>gi|119899017|ref|YP_934230.1| flagellar biosynthesis protein FliQ [Azoarcus sp. BH72]
 gi|119671430|emb|CAL95343.1| flagellar biosynthesis protein FliQ [Azoarcus sp. BH72]
          Length = 89

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+E+ R A+   L  SAP+  +A+  G++I+  QA TQI E+TL+FVPKI+ +F+
Sbjct: 1  MTPTAVIELGRQAIEVTLLVSAPLFLAALVTGLIISIFQAATQINEMTLSFVPKIVVMFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL+++ P++   ++ F+  +   I + +
Sbjct: 61 TLVLAGPWMITMLTDFMRRLFESIPTMI 88


>gi|307131600|ref|YP_003883616.1| flagellar biosynthesis protein fliQ [Dickeya dadantii 3937]
 gi|306529129|gb|ADM99059.1| Flagellar biosynthesis protein fliQ [Dickeya dadantii 3937]
          Length = 89

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P L +A+  G++I+ LQA TQI E+TL+F+PK++ VF 
Sbjct: 1  MTPESVMALGYEAMKIALMLAGPPLVAALVSGLIISLLQAATQINEMTLSFIPKVLTVFF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL+++ P++   I  ++  + S+  + +
Sbjct: 61 TLVVAGPWMLSVILDYMRTMFSQFPNMI 88


>gi|289208348|ref|YP_003460414.1| flagellar biosynthetic protein FliQ [Thioalkalivibrio sp. K90mix]
 gi|288943979|gb|ADC71678.1| flagellar biosynthetic protein FliQ [Thioalkalivibrio sp. K90mix]
          Length = 89

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 51/88 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R  +  ++  +AP L +A+ +G+ I  LQA TQIQE+TL+F+PK++A+F 
Sbjct: 1  MTPEMVVDVGRETLTVVVLLAAPPLLTALAVGLAIGMLQAATQIQEMTLSFIPKLLAMFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+IS  ++   I  +   +       +
Sbjct: 61 ALLISGHWMLALIIEYTERLYDAAPGMV 88


>gi|75675328|ref|YP_317749.1| flagellar biosynthesis protein FliQ [Nitrobacter winogradskyi
          Nb-255]
 gi|74420198|gb|ABA04397.1| Flagellar biosynthesis protein FliQ [Nitrobacter winogradskyi
          Nb-255]
          Length = 87

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 38/87 (43%), Positives = 60/87 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L++AR A+WTI+  S P+L   + +G+ I+ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGAETLDVARDAIWTIVLVSGPLLGVGLIVGVAISLVQALTQIQEQTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          TL+++ PF+   + + +  + SRI   
Sbjct: 61 TLVLALPFMADALHAEMLRISSRIIGG 87


>gi|329901240|ref|ZP_08272765.1| Flagellar biosynthesis protein fliQ [Oxalobacteraceae bacterium
          IMCC9480]
 gi|327549172|gb|EGF33764.1| Flagellar biosynthesis protein fliQ [Oxalobacteraceae bacterium
          IMCC9480]
          Length = 89

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++ +F+
Sbjct: 1  MTPESVMVMGRHAMEVTLMVAAPLLMVALLIGLIVSIFQAATQINEQTLSFIPKLVGIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL+I+ P++   +  ++  + S I S +
Sbjct: 61 TLVIAGPWMLSIMLDYMREMFSGIPSMI 88


>gi|251789177|ref|YP_003003898.1| flagellar biosynthesis protein FliQ [Dickeya zeae Ech1591]
 gi|247537798|gb|ACT06419.1| flagellar biosynthetic protein FliQ [Dickeya zeae Ech1591]
          Length = 89

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P L +A+  G++I+ LQA TQI E+TL+F+PK++ VF 
Sbjct: 1  MTPESVMALGYEAMKIALMLAGPPLIAALVSGLIISLLQAATQINEMTLSFIPKVLTVFF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL+++ P++   I  ++  + S+  + +
Sbjct: 61 TLVVAGPWMLSVILDYMRTMFSQFPNMI 88


>gi|220915855|ref|YP_002491159.1| type III secretion protein, HrpO family [Anaeromyxobacter
          dehalogenans 2CP-1]
 gi|219953709|gb|ACL64093.1| type III secretion protein, HrpO family [Anaeromyxobacter
          dehalogenans 2CP-1]
          Length = 88

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 53/86 (61%), Gaps = 1/86 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A +L + R A+  +L  SAP L +A+ +G++   LQA TQ+QE TL  VP+++AV I
Sbjct: 1  MDPA-LLHLGREALLLVLVLSAPPLGAALLVGLVTGVLQAATQVQEQTLGVVPRLVAVVI 59

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L I+AP+IG +   F     + +  
Sbjct: 60 SLAIAAPWIGARAVRFAADCFALVPR 85


>gi|312621585|ref|YP_004023198.1| flagellar biosynthetic protein fliq [Caldicellulosiruptor
          kronotskyensis 2002]
 gi|312202052|gb|ADQ45379.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          kronotskyensis 2002]
          Length = 89

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VLEIAR A+ T    + P+L  +M +GI+++ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTTVVLEIARQAILTAFYVAGPILLISMVVGIVVSILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I   ++  ++  F   + + I   +
Sbjct: 61 SLLIFGQWMLTKVIEFTRYLWTNINQFV 88


>gi|284989539|ref|YP_003408093.1| export protein FliQ family 3 [Geodermatophilus obscurus DSM
          43160]
 gi|284062784|gb|ADB73722.1| export protein FliQ family 3 [Geodermatophilus obscurus DSM
          43160]
          Length = 91

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++ADV EIA A M      +APVL +A+ +G LI+  QA TQIQE TL+FVPK+IAV I
Sbjct: 1  MSDADVTEIAVATMLVAAKVAAPVLLTALLVGFLISLFQAATQIQEPTLSFVPKVIAVAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+++  ++  ++ +F   +   +   L
Sbjct: 61 ALLVTGNWVLSELVTFTQGLFDSLPRLL 88


>gi|312115274|ref|YP_004012870.1| flagellar biosynthetic protein FliQ [Rhodomicrobium vannielii
          ATCC 17100]
 gi|311220403|gb|ADP71771.1| flagellar biosynthetic protein FliQ [Rhodomicrobium vannielii
          ATCC 17100]
          Length = 88

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 60/88 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN+AD +++ ++A+W ++ +S P++ +AM +GI I+  QALTQIQE TLTF+PKI+ VF+
Sbjct: 1  MNQADAMDLVKSAIWVVILASGPMIGAAMAVGIAISLFQALTQIQEATLTFIPKIVTVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
            +++A FIG  +        SRI+   
Sbjct: 61 VAMLTASFIGSVLLGISEQAYSRIEHGF 88


>gi|302872554|ref|YP_003841190.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          obsidiansis OB47]
 gi|302575413|gb|ADL43204.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor
          obsidiansis OB47]
          Length = 89

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ + VLEIAR A+ T    + P+L  +M +GI+++ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTSVVLEIARQAILTAFYVAGPILLVSMVVGIVVSILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L++   ++  ++  F   +   I   +
Sbjct: 61 SLLVFGQWMLTKVVEFTKYLWININQFV 88


>gi|27904582|ref|NP_777708.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. Bp
          (Baizongia pistaciae)]
 gi|38372221|sp|Q89AZ1|FLIQ_BUCBP RecName: Full=Flagellar biosynthetic protein FliQ
 gi|27903979|gb|AAO26813.1| flagellar biosynthetic protein FliQ [Buchnera aphidicola str. Bp
          (Baizongia pistaciae)]
          Length = 90

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 48/84 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  S P+L SA+  G++++  QA TQI E TL+F+PKI AV +
Sbjct: 1  MTIESVMSLFYDAMKVTLMISLPLLLSALCCGLIVSIFQAATQINEQTLSFIPKIAAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +++I  P++   +S +   +   +
Sbjct: 61 SIVIFGPWMLVILSDYTHTLFYNL 84


>gi|222530122|ref|YP_002574004.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor bescii
          DSM 6725]
 gi|222456969|gb|ACM61231.1| flagellar biosynthetic protein FliQ [Caldicellulosiruptor bescii
          DSM 6725]
          Length = 89

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VLEIAR A+ T    + P+L  +M +GI+I+ LQA TQI E TLTFVPK+IA+ +
Sbjct: 1  MDTTVVLEIARQAILTAFYVAGPILLISMVVGIVISILQATTQINEQTLTFVPKLIAIAL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          +L+I   ++  ++  F   + + I   +
Sbjct: 61 SLLIFGQWMLTKVIEFTRYLWTNINQFV 88


>gi|222147595|ref|YP_002548552.1| flagellar biosynthesis protein FliQ [Agrobacterium vitis S4]
 gi|221734583|gb|ACM35546.1| flagellar biosynthetic protein [Agrobacterium vitis S4]
          Length = 88

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 71/88 (80%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I RAA+WT+L +S P + +AM +G+++A +QALTQIQE+TLTFVPKI+A+ +
Sbjct: 1  MNEADALDIMRAAVWTVLIASGPAVLAAMIVGVVVALIQALTQIQEMTLTFVPKIVAIMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T+ ISAPF+G QIS F  LV SR+QS  
Sbjct: 61 TIGISAPFVGSQISIFANLVFSRVQSGF 88


>gi|149377874|ref|ZP_01895603.1| flagellar biosynthetic protein FliQ [Marinobacter algicola DG893]
 gi|149357816|gb|EDM46309.1| flagellar biosynthetic protein FliQ [Marinobacter algicola DG893]
          Length = 89

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 52/85 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V++I R A+W I+  ++ ++   + +G++++  QA TQI E TL+F+P+++   I
Sbjct: 1  MTPETVIDILREALWMIVLLASLIIGPGLVIGLVVSTFQAATQINEQTLSFLPRLLVTLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          T+I++ P++  Q+      +++ I 
Sbjct: 61 TIIVAGPWMLTQLLDHANRLITSIP 85


>gi|253996310|ref|YP_003048374.1| flagellar biosynthetic protein FliQ [Methylotenera mobilis JLW8]
 gi|253982989|gb|ACT47847.1| flagellar biosynthetic protein FliQ [Methylotenera mobilis JLW8]
          Length = 89

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L + + +G+L++  QA TQI E TL+F+PK++ VF+
Sbjct: 1  MTPESVMTLGRDAMSITLMIAAPILLTVLAIGLLVSIFQAATQINEQTLSFIPKLVGVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+++ P++ G +  ++ LV + I +
Sbjct: 61 ALMLAGPWMLGTMVDYMHLVFTSIPA 86


>gi|92116948|ref|YP_576677.1| flagellar biosynthesis protein FliQ [Nitrobacter hamburgensis
          X14]
 gi|91799842|gb|ABE62217.1| flagellar biosynthetic protein FliQ [Nitrobacter hamburgensis
          X14]
          Length = 87

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 38/87 (43%), Positives = 61/87 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M  A+ L++AR A+WTI+  S P+L   + +G++I+ +QALTQIQE TL FVPKI+A+F+
Sbjct: 1  MTGAETLDVARDAIWTIVLVSGPLLGVGLIVGVVISLVQALTQIQEQTLVFVPKILAIFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
          TL+++ PF+   + + +  + SRI   
Sbjct: 61 TLVLALPFMADALHAEMMRISSRIIGG 87


>gi|77918769|ref|YP_356584.1| flagellar biosynthetic protein FliQ [Pelobacter carbinolicus DSM
          2380]
 gi|77544852|gb|ABA88414.1| flagellar biosynthetic protein FliQ [Pelobacter carbinolicus DSM
          2380]
          Length = 89

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     + + R A+ T+L  +AP+L + + +G++++  QA TQI E T+TF+PKI+AVF+
Sbjct: 1  MTPEFAIALGRQAIETVLMLAAPLLLAGLAVGLMVSIFQAATQINEQTMTFIPKIVAVFV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+I AP++   + +F   +   I +
Sbjct: 61 TLLICAPWMIRTLLTFTKNIFGNIPN 86


>gi|114332026|ref|YP_748248.1| flagellar biosynthetic protein FliQ [Nitrosomonas eutropha C91]
 gi|114309040|gb|ABI60283.1| flagellar biosynthetic protein FliQ [Nitrosomonas eutropha C91]
          Length = 91

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 53/85 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+    + I R A+    + +AP+L +A+  G+ I+  QA TQI E+TL+F+PK++A+F+
Sbjct: 1  MSPEQAMTIGRQALEITFTIAAPLLLAALVTGLAISIFQAATQINEMTLSFIPKLLAIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          TL ++ P++   I  ++  + + I 
Sbjct: 61 TLALAGPWMLQIILDYIERLYTSIP 85


>gi|146307833|ref|YP_001188298.1| flagellar biosynthesis protein FliQ [Pseudomonas mendocina ymp]
 gi|145576034|gb|ABP85566.1| flagellar biosynthetic protein FliQ [Pseudomonas mendocina ymp]
          Length = 89

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 49/85 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++ R A+W I+      +  ++ +G+++A  QA TQI E TL+F+P+++ + I
Sbjct: 1  MTPEVAVDLFREALWLIVLIVGLAVVPSLLVGLVVAMFQAATQINEQTLSFLPRLMVMLI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          TLI + P++  Q+  +   ++  I 
Sbjct: 61 TLIWAGPWLVSQLMEYTQNLIQNIP 85


>gi|302389677|ref|YP_003825498.1| flagellar biosynthetic protein FliQ [Thermosediminibacter oceani
          DSM 16646]
 gi|302200305|gb|ADL07875.1| flagellar biosynthetic protein FliQ [Thermosediminibacter oceani
          DSM 16646]
          Length = 89

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 54/88 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +AR A+  ++  SAP+L   M +G+LI+  QA TQIQE +LTFVPKI+ V +
Sbjct: 1  MTQETVIYLAREALSMVILVSAPMLGIGMLVGLLISIFQATTQIQEQSLTFVPKIVVVMM 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++I  P++   + +F   +   + + +
Sbjct: 61 AILIFGPWMLNLMVNFTETLFREMPNFI 88


>gi|309779458|ref|ZP_07674219.1| flagellar biosynthetic protein FliQ [Ralstonia sp. 5_7_47FAA]
 gi|308921699|gb|EFP67335.1| flagellar biosynthetic protein FliQ [Ralstonia sp. 5_7_47FAA]
          Length = 89

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 55/88 (62%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    VL++AR AM   +   AP+L  ++ +G+L+A  QA TQ+ E TL+F+PK++AV  
Sbjct: 1  MTPEYVLDMARQAMQVAMMVGAPMLLVSLVVGLLVAVFQAATQLNEQTLSFIPKLLAVAA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T++++ P+I   I  +   VL+ I + +
Sbjct: 61 TMVLAGPWIVAVIVDYTRGVLTNIPNYV 88


>gi|121997285|ref|YP_001002072.1| flagellar biosynthetic protein FliQ [Halorhodospira halophila
          SL1]
 gi|121588690|gb|ABM61270.1| flagellar biosynthetic protein FliQ [Halorhodospira halophila
          SL1]
          Length = 89

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 47/88 (53%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +++   A+      + P+L +A+ +G+++   QA TQI E TL+FVPK++ + +
Sbjct: 1  MTPERAIQLGTDALTVATLLAGPILLAALIIGLIVGMFQAATQINEQTLSFVPKLVGLAV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L +  P++   ++ F   ++  I   L
Sbjct: 61 VLFLLTPWMTQVLTDFTEGLIRSIPEIL 88


>gi|315122290|ref|YP_004062779.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495692|gb|ADR52291.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 88

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 79/88 (89%), Positives = 85/88 (96%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADVLEIARAA+WTILS+SAPVL +AMF G+L+AFLQALTQIQEVTLTFVPKIIAVFI
Sbjct: 1  MNEADVLEIARAAIWTILSASAPVLLAAMFFGVLVAFLQALTQIQEVTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TLIISAPFIGGQIS+FVTLVLSRIQSS 
Sbjct: 61 TLIISAPFIGGQISAFVTLVLSRIQSSF 88


>gi|197121154|ref|YP_002133105.1| type III secretion protein, HrpO family [Anaeromyxobacter sp. K]
 gi|196171003|gb|ACG71976.1| type III secretion protein, HrpO family [Anaeromyxobacter sp. K]
          Length = 88

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ A +L + R A+  +L  SAP L +A+ +G++   LQA TQ+QE TL  VP+++AV I
Sbjct: 1  MDPA-LLHLGREALLLVLVLSAPPLGAALLVGLVTGVLQAATQVQEQTLGVVPRLVAVVI 59

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L I+AP+IG +   F     + +  
Sbjct: 60 VLAITAPWIGARAVRFAADCFALVPR 85


>gi|118581841|ref|YP_903091.1| flagellar biosynthetic protein FliQ [Pelobacter propionicus DSM
          2379]
 gi|118504551|gb|ABL01034.1| flagellar biosynthetic protein FliQ [Pelobacter propionicus DSM
          2379]
          Length = 89

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 49/84 (58%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++AR +    L  SAP+L  ++ +G+LI+  QA+T I E TL F PKI+AV +
Sbjct: 1  MTPELVIQLARRSFEATLLLSAPLLIFSLAVGLLISIFQAVTSINEATLAFAPKIVAVMV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           ++I  P++   +  F   + S I
Sbjct: 61 AMVIFFPWMMTYMCDFTREIYSFI 84


>gi|134300234|ref|YP_001113730.1| flagellar biosynthetic protein FliQ [Desulfotomaculum reducens
          MI-1]
 gi|134052934|gb|ABO50905.1| flagellar biosynthetic protein FliQ [Desulfotomaculum reducens
          MI-1]
          Length = 89

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/88 (40%), Positives = 56/88 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  VL +AR A+  ++  S P L  AM +G++I   QA TQIQE TL+FVPK++AVF+
Sbjct: 1  MTQTYVLHLAREALMMVVILSIPTLGVAMLVGLIIGIFQATTQIQEQTLSFVPKMVAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TLI++A ++      F T +  +I + +
Sbjct: 61 TLIVAAGWLLNIAIRFTTRLYEQIPNLI 88


>gi|134095088|ref|YP_001100163.1| flagellar biosynthetic protein fliQ [Herminiimonas
          arsenicoxydans]
 gi|133738991|emb|CAL62039.1| Flagellar biosynthetic protein FliQ [Herminiimonas
          arsenicoxydans]
          Length = 89

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 51/85 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R A+   L  +AP+L  A+ +G++++  QA TQI E TL+F+PK++ +F+
Sbjct: 1  MTPETVMTMGRHAIEITLMVAAPMLLVALGIGLIVSIFQAATQINETTLSFIPKLVGIFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           LII+ P++   +  ++    + I 
Sbjct: 61 ALIIAGPWMLTVLLDYMRETFTNIP 85


>gi|10998534|gb|AAG25964.1|AF300968_6 FliQ [Sinorhizobium meliloti]
          Length = 88

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT++ +S P + +AM +G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVGIAFIQALTQVQEMTLTFVPKILAVMI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T  +SAPF+G QIS F  +V SRIQS  
Sbjct: 61 TAAVSAPFVGAQISIFTDIVFSRIQSGF 88


>gi|239909256|ref|YP_002955998.1| flagellar biosynthetic protein FliQ [Desulfovibrio magneticus
          RS-1]
 gi|239799123|dbj|BAH78112.1| flagellar biosynthetic protein FliQ [Desulfovibrio magneticus
          RS-1]
          Length = 89

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 57/88 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ ++R A+   L  + P+L  ++ +G+ ++ LQA TQIQE+TLTFVPKI+++FI
Sbjct: 1  MTTDMVVALSRQAIELALFLALPMLGVSLVVGVFVSVLQAATQIQEMTLTFVPKILSMFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+++ P++  ++ +F   +   I + L
Sbjct: 61 ALLLAFPWMMDKMLNFTRELFMNIPTYL 88


>gi|148553143|ref|YP_001260725.1| flagellar biosynthetic protein FliQ [Sphingomonas wittichii RW1]
 gi|148498333|gb|ABQ66587.1| flagellar biosynthetic protein FliQ [Sphingomonas wittichii RW1]
          Length = 93

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 49/87 (56%)

Query: 2  NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
          +    + IA+ AMW +  +SAP+L  A+  GI++  +QA T I E TL+FVPK+I V I 
Sbjct: 6  SPDYFIGIAQQAMWILALASAPILIPALVAGIILGMIQAATSINEQTLSFVPKLIVVGIA 65

Query: 62 LIISAPFIGGQISSFVTLVLSRIQSSL 88
          L +    I   ++ F   + +RI   L
Sbjct: 66 LALFGGAILMLLADFTREIFARIPDML 92


>gi|253998479|ref|YP_003050542.1| flagellar biosynthetic protein FliQ [Methylovorus sp. SIP3-4]
 gi|313200554|ref|YP_004039212.1| flagellar biosynthetic protein fliq [Methylovorus sp. MP688]
 gi|253985158|gb|ACT50015.1| flagellar biosynthetic protein FliQ [Methylovorus sp. SIP3-4]
 gi|312439870|gb|ADQ83976.1| flagellar biosynthetic protein FliQ [Methylovorus sp. MP688]
          Length = 89

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 51/86 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  SAP+L   + +G+L++  QA TQI E TL+F+PK++ VF 
Sbjct: 1  MTPEGVMTLGRQAMEVTLMVSAPMLIVVLVIGLLVSIFQAATQINETTLSFIPKLVGVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
           L+I+ P++   +  ++  + + I S
Sbjct: 61 VLVIAGPWMLSVMLDYMRAIFTSIPS 86


>gi|71906401|ref|YP_283988.1| flagellar biosynthesis protein FliQ [Dechloromonas aromatica RCB]
 gi|71846022|gb|AAZ45518.1| Flagellar biosynthesis protein FliQ [Dechloromonas aromatica RCB]
          Length = 83

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 52/82 (63%)

Query: 7  LEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFITLIISA 66
          +EI R A+   L  SAP+L +A+ +G++++  QA TQ+ E TL FVPK++A+F+ L+++ 
Sbjct: 1  MEIGRQAIEVTLLISAPMLITALVVGLIVSIFQAATQLNESTLQFVPKLVAMFVVLLLTG 60

Query: 67 PFIGGQISSFVTLVLSRIQSSL 88
          P++   +  ++  +   I   +
Sbjct: 61 PWMIQYLVDYIQRLFGSIPQLI 82


>gi|328545485|ref|YP_004305594.1| flagellar biosynthesis transmembrane protein [polymorphum gilvum
          SL003B-26A1]
 gi|326415226|gb|ADZ72289.1| Flagellar biosynthesis transmembrane protein [Polymorphum gilvum
          SL003B-26A1]
          Length = 88

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 66/88 (75%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L++ R+A+WTI+  SAP +  AM +GI IA +QALTQ+QEVTLTF+PKI+A+ +
Sbjct: 1  MNEADALDLVRSAIWTIIVGSAPAIVPAMVVGIGIALMQALTQVQEVTLTFIPKIVAILV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++I+ PFIG QI +   LV  RI++  
Sbjct: 61 MIVIAGPFIGAQIYALTALVYGRIETGF 88


>gi|15964438|ref|NP_384791.1| flagellar biosynthesis protein FliQ [Sinorhizobium meliloti 1021]
 gi|150395509|ref|YP_001325976.1| flagellar biosynthesis protein FliQ [Sinorhizobium medicae
          WSM419]
 gi|307311580|ref|ZP_07591221.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti
          BL225C]
 gi|307318935|ref|ZP_07598366.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti AK83]
 gi|15073615|emb|CAC45257.1| Putative flagellar biosynthetic transmembrane protein
          [Sinorhizobium meliloti 1021]
 gi|150027024|gb|ABR59141.1| flagellar biosynthetic protein FliQ [Sinorhizobium medicae
          WSM419]
 gi|306895349|gb|EFN26104.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti AK83]
 gi|306899597|gb|EFN30226.1| flagellar biosynthetic protein FliQ [Sinorhizobium meliloti
          BL225C]
          Length = 88

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 70/88 (79%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEAD L+I +AA+WT++ +S P + +AM +G+ IAF+QALTQ+QE+TLTFVPKI+AV I
Sbjct: 1  MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVGIAFIQALTQVQEMTLTFVPKILAVMI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          T  ISAPF+G QIS F  +V SRIQS  
Sbjct: 61 TAAISAPFVGAQISIFTDIVFSRIQSGF 88


>gi|303240271|ref|ZP_07326790.1| flagellar biosynthetic protein FliQ [Acetivibrio cellulolyticus
          CD2]
 gi|302592181|gb|EFL61910.1| flagellar biosynthetic protein FliQ [Acetivibrio cellulolyticus
          CD2]
          Length = 89

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++  V+E+A+ ++ T++  SAP+L  ++ +G+ I+  QA TQIQE TLTF+PKI+AV  
Sbjct: 1  MDQGMVIELAQKSIMTVIYVSAPMLGLSLIVGLAISIFQATTQIQEQTLTFIPKILAVLA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           + I   ++   +  +   +   I   +
Sbjct: 61 GIAIFGSWMLKMLMEYTQGIYMNINQYI 88


>gi|172057872|ref|YP_001814332.1| flagellar biosynthetic protein FliQ [Exiguobacterium sibiricum
          255-15]
 gi|171990393|gb|ACB61315.1| flagellar biosynthetic protein FliQ [Exiguobacterium sibiricum
          255-15]
          Length = 90

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 60/85 (70%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  ++++A +A+WT+L  SAP+L  ++ +G+L++ LQA TQIQE TL+FVPKI+AVF+
Sbjct: 1  MTQEMIIQLASSAVWTLLKVSAPLLLVSLVVGLLVSILQATTQIQEQTLSFVPKIVAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
           L+   P+I  ++ +F   +  +I 
Sbjct: 61 ALVFFGPWIMEELKTFTIEIFKQIA 85


>gi|167630308|ref|YP_001680807.1| flagellar biosynthetic protein fliq, putative [Heliobacterium
          modesticaldum Ice1]
 gi|167593048|gb|ABZ84796.1| flagellar biosynthetic protein fliq, putative [Heliobacterium
          modesticaldum Ice1]
          Length = 91

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 56/87 (64%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+++ R A+  +L  SAP+L +++ +G++I+  QA TQIQE TLTFVPKIIAV +
Sbjct: 1  MTPELVIQLGRDALAAVLLISAPLLGASLLVGLVISVFQATTQIQEATLTFVPKIIAVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           +++  P++   +  +V  +L  + + 
Sbjct: 61 VILLFGPWMLEAMMKYVDQMLGSLNTY 87


>gi|315648122|ref|ZP_07901223.1| flagellar biosynthetic protein FliQ [Paenibacillus vortex V453]
 gi|315276768|gb|EFU40111.1| flagellar biosynthetic protein FliQ [Paenibacillus vortex V453]
          Length = 89

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 53/84 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++ +L  SAP++  A+ +G++I+  QA TQIQE TL FVPKI+ V +
Sbjct: 1  MSSEFIIGLAGQAVYIVLQVSAPMMVLALVVGLIISIFQATTQIQEQTLAFVPKIVIVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          +L++  P+I   +  F   +L  +
Sbjct: 61 SLLLFGPWILTTLVDFTHGILDNL 84


>gi|271500075|ref|YP_003333100.1| flagellar biosynthetic protein FliQ [Dickeya dadantii Ech586]
 gi|270343630|gb|ACZ76395.1| flagellar biosynthetic protein FliQ [Dickeya dadantii Ech586]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +   AM   L  + P L +A+  G++++ LQA TQI E+TL+F+PK++ VF 
Sbjct: 1  MTPESVMALGYEAMKIALMLAGPPLIAALVSGLIVSMLQAATQINEMTLSFIPKVLTVFF 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TL+++ P++   I  ++  + S+  + +
Sbjct: 61 TLVVAGPWMLSVILDYMRAMFSQFPNMI 88


>gi|197104396|ref|YP_002129773.1| flagellar biosynthesis protein FliQ [Phenylobacterium zucineum
          HLK1]
 gi|196477816|gb|ACG77344.1| flagellar biosynthesis protein FliQ [Phenylobacterium zucineum
          HLK1]
          Length = 87

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 40/86 (46%), Positives = 59/86 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MN A+VL++ R A+W  +  SAPVL   + +G+ I  LQALTQIQE TL + PKI+A+FI
Sbjct: 1  MNGAEVLDVGRDAIWLTIQLSAPVLIVGLIVGVGIGLLQALTQIQEATLVYAPKIVAIFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          +L+I  P +G  +S F+  + +RI +
Sbjct: 61 SLLIFLPLMGALMSGFMRHIAARIAA 86


>gi|10955565|ref|NP_052406.1| YscS [Yersinia enterocolitica]
 gi|16082733|ref|NP_395179.1| needle complex export protein [Yersinia pestis CO92]
 gi|28372986|ref|NP_783680.1| YscS [Yersinia enterocolitica]
 gi|31795276|ref|NP_857737.1| needle complex export protein [Yersinia pestis KIM]
 gi|31795478|ref|NP_857932.1| needle complex export protein [Yersinia pestis KIM]
 gi|32470293|ref|NP_863528.1| YscS [Yersinia enterocolitica]
 gi|45478539|ref|NP_995366.1| type III secretion protein yscS YscS [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51593914|ref|YP_068481.1| yscS; putative type III secretion protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|108793659|ref|YP_636809.1| type III secretion protein [Yersinia pestis Antiqua]
 gi|122815817|ref|YP_001004083.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|145597137|ref|YP_001154601.1| type III secretion protein [Yersinia pestis Pestoides F]
 gi|149192694|ref|YP_001293926.1| putative type III secretion protein [Yersinia pestis CA88-4125]
 gi|162417747|ref|YP_001604477.1| type III secretion apparatus protein YscS [Yersinia pestis
          Angola]
 gi|165927783|ref|ZP_02223615.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165940088|ref|ZP_02228622.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166011708|ref|ZP_02232606.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166214448|ref|ZP_02240483.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167401906|ref|ZP_02307392.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167422415|ref|ZP_02314168.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167422450|ref|ZP_02314203.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167422878|ref|ZP_02314631.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167426849|ref|ZP_02318602.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|186897579|ref|YP_001874690.1| HrpO family type III secretion protein [Yersinia
          pseudotuberculosis PB1/+]
 gi|229896861|ref|ZP_04512021.1| putative type III secretion protein [Yersinia pestis Pestoides A]
 gi|229900216|ref|ZP_04515352.1| putative type III secretion protein [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|270491104|ref|ZP_06208176.1| type III secretion protein, HrpO family [Yersinia pestis KIM D27]
 gi|332163587|ref|YP_004424929.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|57015236|sp|P69982|YSCS_YERPE RecName: Full=Yop proteins translocation protein S
 gi|57015237|sp|P69983|YSCS_YERPS RecName: Full=Yop proteins translocation protein S
 gi|14579351|gb|AAK69228.1|AF336309_23 YscS [Yersinia enterocolitica]
 gi|475124|gb|AAA27679.1| yscS [Yersinia pseudotuberculosis]
 gi|2996236|gb|AAC62559.1| Yop proteins translocation protein S homolog [Yersinia pestis KIM
          10]
 gi|3822066|gb|AAC69786.1| type III secretion protein [Yersinia pestis KIM 10]
 gi|4324352|gb|AAD16829.1| YscS [Yersinia enterocolitica W22703]
 gi|5832465|emb|CAB54922.1| putative type III secretion protein [Yersinia pestis CO92]
 gi|23630558|gb|AAN37514.1| YscS [Yersinia enterocolitica]
 gi|45357161|gb|AAS58557.1| type III secretion protein yscS YscS [Yersinia pestis biovar
          Microtus str. 91001]
 gi|51591611|emb|CAF25415.1| yscS; putative type III secretion protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|108782206|gb|ABG16261.1| type III secretion protein [Yersinia pestis Antiqua]
 gi|121663691|emb|CAL10053.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. enterocolitica 8081]
 gi|145212905|gb|ABP42311.1| type III secretion protein [Yersinia pestis Pestoides F]
 gi|148872352|gb|ABR14842.1| putative type III secretion protein [Yersinia pestis CA88-4125]
 gi|162354767|gb|ABX88714.1| type III secretion apparatus protein YscS [Yersinia pestis
          Angola]
 gi|165911998|gb|EDR30641.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165920219|gb|EDR37520.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165989315|gb|EDR41616.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166204341|gb|EDR48821.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166958168|gb|EDR55189.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|166958652|gb|EDR55673.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|166958687|gb|EDR55708.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167048634|gb|EDR60042.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167054148|gb|EDR63975.1| type III secretion apparatus protein YscS [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|186700605|gb|ACC91233.1| type III secretion protein, HrpO family [Yersinia
          pseudotuberculosis PB1/+]
 gi|229686736|gb|EEO78816.1| putative type III secretion protein [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229700132|gb|EEO88171.1| putative type III secretion protein [Yersinia pestis Pestoides A]
 gi|270334847|gb|EFA45626.1| type III secretion protein, HrpO family [Yersinia pestis KIM D27]
 gi|310923236|emb|CBW54702.1| YscS, T3SS component [Yersinia enterocolitica (type O:8)]
 gi|317374479|gb|ADV16654.1| type III secretion inner membrane protein [Yersinia pestis]
 gi|318608196|emb|CBY78170.1| type III secretion inner membrane protein (YscS,homologous to
          flagellar export components) [Yersinia enterocolitica
          subsp. palearctica Y11]
 gi|325667817|gb|ADZ44460.1| putative type III secretion protein [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
          Length = 88

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/86 (39%), Positives = 55/86 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M++ D++     A+W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV +
Sbjct: 1  MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQEQTLGFVIKLIAVVV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL  +A ++G ++ SF  + + +IQ 
Sbjct: 61 TLFATASWLGNELHSFAEMTMMKIQG 86


>gi|225181594|ref|ZP_03735035.1| flagellar biosynthetic protein FliQ [Dethiobacter alkaliphilus
          AHT 1]
 gi|225167702|gb|EEG76512.1| flagellar biosynthetic protein FliQ [Dethiobacter alkaliphilus
          AHT 1]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 55/87 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   VL +AR A+ T L  +APVL  ++ +G+ I+  QA TQIQE TLTFVPKIIAVF+
Sbjct: 1  MSHEFVLSVARDAILTTLFIAAPVLIISLLVGLGISVFQATTQIQEQTLTFVPKIIAVFL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSS 87
           L++   ++   +  F   + +++ + 
Sbjct: 61 ALLVFGSWMLNTLVQFTANLFAQLGTF 87


>gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040196|gb|ACT56992.1| flagellar biosynthesis protein FliQ [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 88

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI
Sbjct: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
          TLIISAPFIGGQISSFVTLVLSRIQSSL
Sbjct: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88


>gi|229918643|ref|YP_002887289.1| flagellar biosynthetic protein FliQ [Exiguobacterium sp. AT1b]
 gi|229470072|gb|ACQ71844.1| flagellar biosynthetic protein FliQ [Exiguobacterium sp. AT1b]
          Length = 90

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 56/82 (68%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M +  V+ +A  ++WT+L  S P+L  ++ +G++I+ LQA TQIQE TL+FVPKII+VFI
Sbjct: 1  MTQEMVIYLATESVWTLLKISMPLLLISLIVGLVISILQATTQIQEQTLSFVPKIISVFI 60

Query: 61 TLIISAPFIGGQISSFVTLVLS 82
           L+I  P++  QI  F  L+  
Sbjct: 61 GLVIFGPWMLQQIEGFTRLIFE 82


>gi|92114089|ref|YP_574017.1| flagellar biosynthetic protein FliQ [Chromohalobacter salexigens
          DSM 3043]
 gi|91797179|gb|ABE59318.1| flagellar biosynthetic protein FliQ [Chromohalobacter salexigens
          DSM 3043]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 51/88 (57%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ +A   M   L  + P+L +A+ +G+L++  QA TQI E+TLTF+PKI+ VF 
Sbjct: 1  MTPEMVMGLAYQGMKVTLMLAGPLLMTALLIGLLVSLFQAATQINEMTLTFIPKILGVFG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L+++ P++   I  F   +   + S +
Sbjct: 61 ALVVAGPWLIQTIVDFTRELFLNLPSMV 88


>gi|261407967|ref|YP_003244208.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. Y412MC10]
 gi|329929295|ref|ZP_08283048.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. HGF5]
 gi|261284430|gb|ACX66401.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. Y412MC10]
 gi|328936664|gb|EGG33107.1| flagellar biosynthetic protein FliQ [Paenibacillus sp. HGF5]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   ++ +A  A++ +L  SAP+L  A+ +G++I+  QA TQIQE TL FVPKII V +
Sbjct: 1  MSAEFIIGLAGQAVYIVLQVSAPMLVLALVVGLIISIFQATTQIQEQTLAFVPKIIIVLV 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
           L++  P+I   +  F   +L  +
Sbjct: 61 ALLLFGPWILTTLVDFTHGILDNL 84


>gi|297538205|ref|YP_003673974.1| flagellar biosynthetic protein FliQ [Methylotenera sp. 301]
 gi|297257552|gb|ADI29397.1| flagellar biosynthetic protein FliQ [Methylotenera sp. 301]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 51/86 (59%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ + R AM   L  +AP+L   + +G+L++  QA TQI E TL+F+PK++ VF 
Sbjct: 1  MTPESVMTLGRDAMEITLLVAAPILLVVLAIGLLVSIFQAATQINEATLSFIPKLVGVFG 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+ +  ++   +  ++ LV + I +
Sbjct: 61 TLMFAGQWMLTTLVDYMHLVFTSIPA 86


>gi|260778659|ref|ZP_05887551.1| type III secretion protein YscS [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260604823|gb|EEX31118.1| type III secretion protein YscS [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 52/84 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNEA ++      +W +L  S PV+  A  +GIL++  QALTQIQ+ +L F+ K++AV I
Sbjct: 1  MNEAVIIHFTSELLWLVLILSLPVVVVASAVGILVSLFQALTQIQDQSLQFLIKLVAVCI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRI 84
          TL +S  ++G  + ++  L   +I
Sbjct: 61 TLAVSYHWMGSTLLNYAGLAFDQI 84


>gi|218706361|ref|YP_002413880.1| surface presentation of antigens protein [Escherichia coli UMN026]
 gi|218433458|emb|CAR14360.1| surface presentation of antigens protein [Escherichia coli UMN026]
          Length = 115

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%)

Query: 2   NEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFIT 61
           N  D++     A++ IL  SA  +  A F+G+L+   Q +TQ+QE TL F  K++ V I 
Sbjct: 29  NMDDIVFAGNRALYLILVMSAGPIAVATFVGLLVGLFQTVTQLQEQTLPFGVKLLCVSIC 88

Query: 62  LIISAPFIGGQISSFVTLVLS 82
             + + + G ++ SF   +L+
Sbjct: 89  FFLMSGWYGEKLYSFGIEMLN 109


>gi|331005443|ref|ZP_08328822.1| Flagellar biosynthesis protein fliQ [gamma proteobacterium
          IMCC1989]
 gi|330420719|gb|EGG95006.1| Flagellar biosynthesis protein fliQ [gamma proteobacterium
          IMCC1989]
          Length = 88

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 53/88 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M     +E++   +WT +   APVL  +M +G++++ +Q +TQIQE++LTF+PK++A  I
Sbjct: 1  MTPDFAIELSNELLWTAILMCAPVLGISMLVGLIVSMVQVVTQIQEMSLTFIPKMLAAAI 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           L++  P++ G +  F   ++  I    
Sbjct: 61 ALVVFGPWMLGVLIEFARGLIVNIPHYF 88


>gi|91776319|ref|YP_546075.1| flagellar biosynthetic protein FliQ [Methylobacillus flagellatus
          KT]
 gi|91710306|gb|ABE50234.1| flagellar biosynthetic protein FliQ [Methylobacillus flagellatus
          KT]
          Length = 89

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 51/85 (60%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+   V+ + R A   +L  + P+L   + +G+L++  QA TQI E TLTF+PK++ VF 
Sbjct: 1  MSPEHVMTMGRQAAEILLMVAGPMLLVVLAIGLLVSIFQAATQINEATLTFIPKLLGVFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          TL+I+ P++    + ++  V + I 
Sbjct: 61 TLLIAGPWMLSVFTDYLRAVFTSIP 85


>gi|73539700|ref|YP_300067.1| flagellar biosynthesis protein FliQ [Ralstonia eutropha JMP134]
 gi|72123037|gb|AAZ65223.1| Flagellar biosynthesis protein FliQ [Ralstonia eutropha JMP134]
          Length = 89

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 53/86 (61%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M    V+ IA  AM   L  +AP L  A+  G++++  QA TQI E+TLTF+PK++A+F 
Sbjct: 1  MTPETVMTIATHAMKMTLMLAAPPLLVALAAGLVVSLFQAATQINEMTLTFIPKLVALFA 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQS 86
          TL+++ P++   +  ++  VL  I +
Sbjct: 61 TLVLAGPWMINTMVDYMREVLQSIPA 86


>gi|253988528|ref|YP_003039884.1| type III secretion component protein scts [Photorhabdus
          asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211637890|emb|CAR66519.1| type iii secretion component protein scts [Photorhabdus
          asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779978|emb|CAQ83139.1| type iii secretion component protein scts [Photorhabdus
          asymbiotica]
          Length = 88

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 54/85 (63%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          M+ AD+L     ++W +L  S P +  A  +G L++ +QALTQIQE TL FV K+IAV I
Sbjct: 1  MSNADILHFTSQSLWLVLILSLPPVLMAAVVGTLVSLIQALTQIQEQTLGFVIKLIAVII 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQ 85
          TL  +A ++G ++ SF  +  S++ 
Sbjct: 61 TLFATATWLGNELYSFANMAFSKVP 85


>gi|188579931|ref|YP_001923376.1| flagellar biosynthesis protein FliQ [Methylobacterium populi
          BJ001]
 gi|179343429|gb|ACB78841.1| flagellar biosynthetic protein FliQ [Methylobacterium populi
          BJ001]
          Length = 88

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 42/88 (47%), Positives = 64/88 (72%)

Query: 1  MNEADVLEIARAAMWTILSSSAPVLFSAMFLGILIAFLQALTQIQEVTLTFVPKIIAVFI 60
          MNE D LE+ R+A+WT+L ++ P + +AM +GI +A LQALTQ+QEVTLTFVPKI+A+ +
Sbjct: 1  MNEVDALELVRSAIWTVLVAAGPSVGAAMLVGIAVALLQALTQVQEVTLTFVPKIVAILL 60

Query: 61 TLIISAPFIGGQISSFVTLVLSRIQSSL 88
           ++++  F+G QI +F  +   RI +  
Sbjct: 61 VMLVTGTFVGSQIYAFAEMTYGRIATGF 88


>gi|226941266|ref|YP_002796340.1| FliQ1 [Laribacter hongkongensis HLHK9]
 gi|226716193|gb|ACO75331.1| FliQ1 [Laribacter hongkongensis HLHK9]
          Length