RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780519|ref|YP_003064932.1| flagellar biosynthesis protein
FliQ [Candidatus Liberibacter asiaticus str. psy62]
         (88 letters)



>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 28.8 bits (63), Expect = 0.32
 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 18/43 (41%)

Query: 39 QALTQIQEVTLTFVPKIIAVFITLII--SAPFIGGQISSFVTL 79
          QAL ++Q  +L    K+ A         SAP +   I +  T+
Sbjct: 20 QALKKLQ-ASL----KLYA-------DDSAPALA--IKA--TM 46



 Score = 26.5 bits (57), Expect = 1.4
 Identities = 7/23 (30%), Positives = 11/23 (47%)

Query: 3  EADVLEIARAAMWTILSSSAPVL 25
          E   L+  +A++      SAP L
Sbjct: 18 EKQALKKLQASLKLYADDSAPAL 40



 Score = 24.6 bits (52), Expect = 5.4
 Identities = 4/8 (50%), Positives = 7/8 (87%)

Query: 81 LSRIQSSL 88
          L ++Q+SL
Sbjct: 22 LKKLQASL 29


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 27.6 bits (61), Expect = 0.67
 Identities = 16/77 (20%), Positives = 30/77 (38%), Gaps = 24/77 (31%)

Query: 16  TILSSSAPVL---------FSAMF-LGI-LIAFLQALTQIQEVT-LTFVPKIIAVFITLI 63
            ++  SA  L            +F  G+ ++ +L+  +   +   L  +P          
Sbjct: 186 DLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIP---------- 235

Query: 64  ISAPFIG-GQISSF-VT 78
           IS P IG  Q++ + VT
Sbjct: 236 ISCPLIGVIQLAHYVVT 252



 Score = 27.6 bits (61), Expect = 0.69
 Identities = 5/16 (31%), Positives = 8/16 (50%), Gaps = 2/16 (12%)

Query: 53  PKIIAVFITLIISAPF 68
            K    F  L +++PF
Sbjct: 414 LKFSNRF--LPVASPF 427



 Score = 25.3 bits (55), Expect = 3.4
 Identities = 13/54 (24%), Positives = 19/54 (35%), Gaps = 12/54 (22%)

Query: 19  SSSAPVLFSAMFLGILIAF----LQALTQ-IQE----VTLTFVPK--IIAVFIT 61
           S      FS  FL +   F    L   +  I +      ++F  K   I V+ T
Sbjct: 410 SERKLK-FSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDT 462



 Score = 24.5 bits (53), Expect = 6.8
 Identities = 6/34 (17%), Positives = 14/34 (41%), Gaps = 2/34 (5%)

Query: 21 SAPVLFSAMFLGILIAFLQ--ALTQIQEVTLTFV 52
          + P      FLG + + ++   + Q  +V    +
Sbjct: 55 TTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCL 88


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 24.8 bits (53), Expect = 5.3
 Identities = 7/28 (25%), Positives = 16/28 (57%)

Query: 41   LTQIQEVTLTFVPKIIAVFITLIISAPF 68
            ++Q+  +TL  +  ++  FI   I+ P+
Sbjct: 1006 ISQVDPITLFVLVSVVEAFIASGITDPY 1033


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.330    0.139    0.373 

Gapped
Lambda     K      H
   0.267   0.0565    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 641,298
Number of extensions: 22235
Number of successful extensions: 92
Number of sequences better than 10.0: 1
Number of HSP's gapped: 91
Number of HSP's successfully gapped: 24
Length of query: 88
Length of database: 5,693,230
Length adjustment: 55
Effective length of query: 33
Effective length of database: 4,359,810
Effective search space: 143873730
Effective search space used: 143873730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.4 bits)