HHsearch alignment for GI: 254780520 and conserved domain: PRK05842

>PRK05842 flgD flagellar basal body rod modification protein; Reviewed.
Probab=99.97  E-value=3.1e-30  Score=194.22  Aligned_cols=66  Identities=32%  Similarity=0.529  Sum_probs=58.1

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             555556677333388999999999832998999889789999999999999999999999999999
Q gi|254780520|r   11 QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS   76 (131)
Q Consensus        11 ~~~~~~~~~~~~l~~d~FLkLL~aQL~nQDP~~P~d~~e~isQlAqfs~leq~~~~~~~l~~~~~~   76 (131)
T Consensus        15 ~~~~~~~~~~~~LdkDaFLkLLvtQLqnQDPlnPMDn~e~iaQLAQfStvEq~~~~n~tl~~~s~~   80 (269)
T PRK05842         15 ERKKEQPTIANGLDKDAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASA   80 (269)
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             877543556455588899999999973279999866799999999898899888776789999987